diff --git a/go.mod b/go.mod index 7edebef8..69862ab1 100644 --- a/go.mod +++ b/go.mod @@ -6,7 +6,8 @@ require ( github.com/cespare/permute/v2 v2.0.0-beta2 github.com/deckarep/golang-set/v2 v2.3.0 github.com/dustin/go-humanize v1.0.1 - github.com/gin-gonic/gin v1.8.1 + github.com/gin-contrib/pprof v1.5.3 + github.com/gin-gonic/gin v1.10.0 github.com/google/uuid v1.3.0 github.com/huandu/go-clone/generic v1.7.2 github.com/olekukonko/tablewriter v0.0.5 @@ -15,47 +16,54 @@ require ( github.com/rs/zerolog v1.34.0 github.com/samber/lo v1.47.0 github.com/samber/mo v1.13.0 - github.com/stretchr/testify v1.8.0 + github.com/stretchr/testify v1.10.0 github.com/urfave/cli v1.22.9 go.mongodb.org/mongo-driver v1.17.1 golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 - golang.org/x/sync v0.8.0 + golang.org/x/sync v0.13.0 gopkg.in/natefinch/lumberjack.v2 v2.0.0 ) require ( github.com/BurntSushi/toml v0.3.1 // indirect + github.com/bytedance/sonic v1.13.2 // indirect + github.com/bytedance/sonic/loader v0.2.4 // indirect + github.com/cloudwego/base64x v0.1.5 // indirect github.com/cpuguy83/go-md2man/v2 v2.0.2 // indirect github.com/davecgh/go-spew v1.1.1 // indirect - github.com/gin-contrib/sse v0.1.0 // indirect - github.com/go-playground/locales v0.14.0 // indirect - github.com/go-playground/universal-translator v0.18.0 // indirect - github.com/go-playground/validator/v10 v10.10.0 // indirect - github.com/goccy/go-json v0.9.7 // indirect + github.com/gabriel-vasile/mimetype v1.4.8 // indirect + github.com/gin-contrib/sse v1.0.0 // indirect + github.com/go-playground/locales v0.14.1 // indirect + github.com/go-playground/universal-translator v0.18.1 // indirect + github.com/go-playground/validator/v10 v10.26.0 // indirect + github.com/goccy/go-json v0.10.5 // indirect github.com/golang/snappy v0.0.4 // indirect github.com/huandu/go-clone v1.6.0 // indirect github.com/json-iterator/go v1.1.12 // indirect github.com/klauspost/compress v1.13.6 // indirect - github.com/leodido/go-urn v1.2.1 // indirect + github.com/klauspost/cpuid/v2 v2.2.10 // indirect + github.com/leodido/go-urn v1.4.0 // indirect github.com/mattn/go-colorable v0.1.13 // indirect - github.com/mattn/go-isatty v0.0.19 // indirect + github.com/mattn/go-isatty v0.0.20 // indirect github.com/mattn/go-runewidth v0.0.9 // indirect - github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421 // indirect + github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect github.com/modern-go/reflect2 v1.0.2 // indirect github.com/montanaflynn/stats v0.7.1 // indirect - github.com/pelletier/go-toml/v2 v2.0.1 // indirect + github.com/pelletier/go-toml/v2 v2.2.3 // indirect github.com/pmezard/go-difflib v1.0.0 // indirect github.com/russross/blackfriday/v2 v2.1.0 // indirect - github.com/ugorji/go/codec v1.2.7 // indirect + github.com/twitchyliquid64/golang-asm v0.15.1 // indirect + github.com/ugorji/go/codec v1.2.12 // indirect github.com/xdg-go/pbkdf2 v1.0.0 // indirect github.com/xdg-go/scram v1.1.2 // indirect github.com/xdg-go/stringprep v1.0.4 // indirect github.com/youmark/pkcs8 v0.0.0-20240726163527-a2c0da244d78 // indirect - golang.org/x/crypto v0.26.0 // indirect - golang.org/x/net v0.21.0 // indirect - golang.org/x/sys v0.23.0 // indirect - golang.org/x/text v0.17.0 // indirect - google.golang.org/protobuf v1.28.0 // indirect + golang.org/x/arch v0.16.0 // indirect + golang.org/x/crypto v0.37.0 // indirect + golang.org/x/net v0.38.0 // indirect + golang.org/x/sys v0.32.0 // indirect + golang.org/x/text v0.24.0 // indirect + google.golang.org/protobuf v1.36.6 // indirect gopkg.in/yaml.v2 v2.4.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect ) diff --git a/go.sum b/go.sum index 918591a6..73f17909 100644 --- a/go.sum +++ b/go.sum @@ -1,7 +1,15 @@ github.com/BurntSushi/toml v0.3.1 h1:WXkYYl6Yr3qBf1K79EBnL4mak0OimBfB0XUf9Vl28OQ= github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU= +github.com/bytedance/sonic v1.13.2 h1:8/H1FempDZqC4VqjptGo14QQlJx8VdZJegxs6wwfqpQ= +github.com/bytedance/sonic v1.13.2/go.mod h1:o68xyaF9u2gvVBuGHPlUVCy+ZfmNNO5ETf1+KgkJhz4= +github.com/bytedance/sonic/loader v0.1.1/go.mod h1:ncP89zfokxS5LZrJxl5z0UJcsk4M4yY2JpfqGeCtNLU= +github.com/bytedance/sonic/loader v0.2.4 h1:ZWCw4stuXUsn1/+zQDqeE7JKP+QO47tz7QCNan80NzY= +github.com/bytedance/sonic/loader v0.2.4/go.mod h1:N8A3vUdtUebEY2/VQC0MyhYeKUFosQU6FxH2JmUe6VI= github.com/cespare/permute/v2 v2.0.0-beta2 h1:iiJWgDsInCbnwfDZiLJX7cVlJevgIM1pUiArcUylUMc= github.com/cespare/permute/v2 v2.0.0-beta2/go.mod h1:7e2Tqe0fjn1T4rTjDLJjQ+kNtt+UW4B9lg10asqWw0A= +github.com/cloudwego/base64x v0.1.5 h1:XPciSp1xaq2VCSt6lF0phncD4koWyULpl5bUxbfCyP4= +github.com/cloudwego/base64x v0.1.5/go.mod h1:0zlkT4Wn5C6NdauXdJRhSKRlJvmclQ1hhJgA0rcu/8w= +github.com/cloudwego/iasm v0.2.0/go.mod h1:8rXZaNYT2n95jn+zTI1sDr+IgcD2GVs0nlbbQPiEFhY= github.com/coreos/go-systemd/v22 v22.5.0/go.mod h1:Y58oyj3AT4RCenI/lSvhwexgC+NSVTIJ3seZv2GcEnc= github.com/cpuguy83/go-md2man/v2 v2.0.0-20190314233015-f79a8a8ca69d/go.mod h1:maD7wRr/U5Z6m/iR4s+kqSMx2CaBsrgA7czyZG/E6dU= github.com/cpuguy83/go-md2man/v2 v2.0.2 h1:p1EgwI/C7NhT0JmVkwCD2ZBK8j4aeHQX2pMHHBfMQ6w= @@ -14,20 +22,36 @@ github.com/deckarep/golang-set/v2 v2.3.0 h1:qs18EKUfHm2X9fA50Mr/M5hccg2tNnVqsiBI github.com/deckarep/golang-set/v2 v2.3.0/go.mod h1:VAky9rY/yGXJOLEDv3OMci+7wtDpOF4IN+y82NBOac4= github.com/dustin/go-humanize v1.0.1 h1:GzkhY7T5VNhEkwH0PVJgjz+fX1rhBrR7pRT3mDkpeCY= github.com/dustin/go-humanize v1.0.1/go.mod h1:Mu1zIs6XwVuF/gI1OepvI0qD18qycQx+mFykh5fBlto= +github.com/gabriel-vasile/mimetype v1.4.8 h1:FfZ3gj38NjllZIeJAmMhr+qKL8Wu+nOoI3GqacKw1NM= +github.com/gabriel-vasile/mimetype v1.4.8/go.mod h1:ByKUIKGjh1ODkGM1asKUbQZOLGrPjydw3hYPU2YU9t8= +github.com/gin-contrib/pprof v1.5.3 h1:Bj5SxJ3kQDVez/s/+f9+meedJIqLS+xlkIVDe/lcvgM= +github.com/gin-contrib/pprof v1.5.3/go.mod h1:0+LQSZ4SLO0B6+2n6JBzaEygpTBxe/nI+YEYpfQQ6xY= github.com/gin-contrib/sse v0.1.0 h1:Y/yl/+YNO8GZSjAhjMsSuLt29uWRFHdHYUb5lYOV9qE= github.com/gin-contrib/sse v0.1.0/go.mod h1:RHrZQHXnP2xjPF+u1gW/2HnVO7nvIa9PG3Gm+fLHvGI= +github.com/gin-contrib/sse v1.0.0 h1:y3bT1mUWUxDpW4JLQg/HnTqV4rozuW4tC9eFKTxYI9E= +github.com/gin-contrib/sse v1.0.0/go.mod h1:zNuFdwarAygJBht0NTKiSi3jRf6RbqeILZ9Sp6Slhe0= github.com/gin-gonic/gin v1.8.1 h1:4+fr/el88TOO3ewCmQr8cx/CtZ/umlIRIs5M4NTNjf8= github.com/gin-gonic/gin v1.8.1/go.mod h1:ji8BvRH1azfM+SYow9zQ6SZMvR8qOMZHmsCuWR9tTTk= +github.com/gin-gonic/gin v1.10.0 h1:nTuyha1TYqgedzytsKYqna+DfLos46nTv2ygFy86HFU= +github.com/gin-gonic/gin v1.10.0/go.mod h1:4PMNQiOhvDRa013RKVbsiNwoyezlm2rm0uX/T7kzp5Y= github.com/go-playground/assert/v2 v2.0.1 h1:MsBgLAaY856+nPRTKrp3/OZK38U/wa0CcBYNjji3q3A= github.com/go-playground/assert/v2 v2.0.1/go.mod h1:VDjEfimB/XKnb+ZQfWdccd7VUvScMdVu0Titje2rxJ4= github.com/go-playground/locales v0.14.0 h1:u50s323jtVGugKlcYeyzC0etD1HifMjqmJqb8WugfUU= github.com/go-playground/locales v0.14.0/go.mod h1:sawfccIbzZTqEDETgFXqTho0QybSa7l++s0DH+LDiLs= +github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/oXslEjJA= +github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY= github.com/go-playground/universal-translator v0.18.0 h1:82dyy6p4OuJq4/CByFNOn/jYrnRPArHwAcmLoJZxyho= github.com/go-playground/universal-translator v0.18.0/go.mod h1:UvRDBj+xPUEGrFYl+lu/H90nyDXpg0fqeB/AQUGNTVA= +github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY= +github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY= github.com/go-playground/validator/v10 v10.10.0 h1:I7mrTYv78z8k8VXa/qJlOlEXn/nBh+BF8dHX5nt/dr0= github.com/go-playground/validator/v10 v10.10.0/go.mod h1:74x4gJWsvQexRdW8Pn3dXSGrTK4nAUsbPlLADvpJkos= +github.com/go-playground/validator/v10 v10.26.0 h1:SP05Nqhjcvz81uJaRfEV0YBSSSGMc/iMaVtFbr3Sw2k= +github.com/go-playground/validator/v10 v10.26.0/go.mod h1:I5QpIEbmr8On7W0TktmJAumgzX4CA1XNl4ZmDuVHKKo= github.com/goccy/go-json v0.9.7 h1:IcB+Aqpx/iMHu5Yooh7jEzJk1JZ7Pjtmys2ukPr7EeM= github.com/goccy/go-json v0.9.7/go.mod h1:6MelG93GURQebXPDq3khkgXZkazVtN9CRI+MGFi0w8I= +github.com/goccy/go-json v0.10.5 h1:Fq85nIqj+gXn/S5ahsiTlK3TmC85qgirsdTP/+DeaC4= +github.com/goccy/go-json v0.10.5/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA= github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaSAoJOfIk= github.com/golang/snappy v0.0.4 h1:yAGX7huGHXlcLOEtBnF4w7FQwA26wojNCwOYAEhLjQM= @@ -48,6 +72,10 @@ github.com/json-iterator/go v1.1.12 h1:PV8peI4a0ysnczrg+LtxykD8LfKY9ML6u2jnxaEnr github.com/json-iterator/go v1.1.12/go.mod h1:e30LSqwooZae/UwlEbR2852Gd8hjQvJoHmT4TnhNGBo= github.com/klauspost/compress v1.13.6 h1:P76CopJELS0TiO2mebmnzgWaajssP/EszplttgQxcgc= github.com/klauspost/compress v1.13.6/go.mod h1:/3/Vjq9QcHkK5uEr5lBEmyoZ1iFhe47etQ6QUkpK6sk= +github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= +github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE= +github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= +github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= github.com/kr/pretty v0.3.0 h1:WgNl7dwNpEZ6jJ9k1snq4pZsg7DOEN8hP9Xw0Tsjwk0= @@ -58,15 +86,21 @@ github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/leodido/go-urn v1.2.1 h1:BqpAaACuzVSgi/VLzGZIobT2z4v53pjosyNd9Yv6n/w= github.com/leodido/go-urn v1.2.1/go.mod h1:zt4jvISO2HfUBqxjfIshjdMTYS56ZS/qv49ictyFfxY= +github.com/leodido/go-urn v1.4.0 h1:WT9HwE9SGECu3lg4d/dIA+jxlljEa1/ffXKmRjqdmIQ= +github.com/leodido/go-urn v1.4.0/go.mod h1:bvxc+MVxLKB4z00jd1z+Dvzr47oO32F/QSNjSBOlFxI= github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/mattn/go-isatty v0.0.19 h1:JITubQf0MOLdlGRuRq+jtsDlekdYPia9ZFsB8h/APPA= github.com/mattn/go-isatty v0.0.19/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y= +github.com/mattn/go-isatty v0.0.20 h1:xfD0iDuEKnDkl03q4limB+vH+GxLEtL/jb4xVJSWWEY= +github.com/mattn/go-isatty v0.0.20/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y= github.com/mattn/go-runewidth v0.0.9 h1:Lm995f3rfxdpd6TSmuVCHVb/QhupuXlYr8sCI/QdE+0= github.com/mattn/go-runewidth v0.0.9/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m2gUSrubnMI= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421 h1:ZqeYNhU3OHLH3mGKHDcjJRFFRrJa6eAM5H+CtDdOsPc= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= +github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd h1:TRLaZ9cD/w8PVh93nsPXa1VrQ6jlwL5oN8l14QlcNfg= +github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/reflect2 v1.0.2 h1:xBagoLtFs94CBntxluKeaWgTMpvLxC4ur3nMaC9Gz0M= github.com/modern-go/reflect2 v1.0.2/go.mod h1:yWuevngMOJpCy52FWWMvUC8ws7m/LJsjYzDa0/r8luk= github.com/montanaflynn/stats v0.7.1 h1:etflOAAHORrCC44V+aR6Ftzort912ZU+YLiSTuV8eaE= @@ -75,6 +109,8 @@ github.com/olekukonko/tablewriter v0.0.5 h1:P2Ga83D34wi1o9J6Wh1mRuqd4mF/x/lgBS7N github.com/olekukonko/tablewriter v0.0.5/go.mod h1:hPp6KlRPjbx+hW8ykQs1w3UBbZlj6HuIJcUGPhkA7kY= github.com/pelletier/go-toml/v2 v2.0.1 h1:8e3L2cCQzLFi2CR4g7vGFuFxX7Jl1kKX8gW+iV0GUKU= github.com/pelletier/go-toml/v2 v2.0.1/go.mod h1:r9LEWfGN8R5k0VXJ+0BkIe7MYkRdwZOjgMj2KwnJFUo= +github.com/pelletier/go-toml/v2 v2.2.3 h1:YmeHyLY8mFWbdkNWwpr+qIL2bEqT0o95WSdkNHvL12M= +github.com/pelletier/go-toml/v2 v2.2.3/go.mod h1:MfCQTFTvCcUyyvvwm1+G6H/jORL20Xlb6rzQu9GuUkc= github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= @@ -98,6 +134,8 @@ github.com/samber/mo v1.13.0/go.mod h1:BfkrCPuYzVG3ZljnZB783WIJIGk1mcZr9c9CPf8tA github.com/shurcooL/sanitized_anchor_name v1.0.0/go.mod h1:1NzhyTcUVG4SuEtjjoZeVRXNmyL/1OwPU0+IJeTBvfc= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw= +github.com/stretchr/objx v0.5.0/go.mod h1:Yh+to48EsGEfYuaHDzXPcE3xhTkx73EhmCGUpEOglKo= +github.com/stretchr/objx v0.5.2/go.mod h1:FRsXN1f5AsAjCGJKqEizvkpNtU+EGNCLh3NxZ/8L+MA= github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= @@ -105,9 +143,17 @@ github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/ github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.8.0 h1:pSgiaMZlXftHpm5L7V1+rVB+AZJydKsMxsQBIJw4PKk= github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= +github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= +github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= +github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA= +github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= +github.com/twitchyliquid64/golang-asm v0.15.1 h1:SU5vSMR7hnwNxj24w34ZyCi/FmDZTkS4MhqMhdFk5YI= +github.com/twitchyliquid64/golang-asm v0.15.1/go.mod h1:a1lVb/DtPvCB8fslRZhAngC2+aY1QWCk3Cedj/Gdt08= github.com/ugorji/go v1.2.7/go.mod h1:nF9osbDWLy6bDVv/Rtoh6QgnvNDpmCalQV5urGCCS6M= github.com/ugorji/go/codec v1.2.7 h1:YPXUKf7fYbp/y8xloBqZOw2qaVggbfwMlI8WM3wZUJ0= github.com/ugorji/go/codec v1.2.7/go.mod h1:WGN1fab3R1fzQlVQTkfxVtIBhWDRqOviHU95kRgeqEY= +github.com/ugorji/go/codec v1.2.12 h1:9LC83zGrHhuUA9l16C9AHXAqEV/2wBQ4nkvumAE65EE= +github.com/ugorji/go/codec v1.2.12/go.mod h1:UNopzCgEMSXjBc6AOMqYvWC1ktqTAfzJZUZgYf6w6lg= github.com/urfave/cli v1.22.9 h1:cv3/KhXGBGjEXLC4bH0sLuJ9BewaAbpk5oyMOveu4pw= github.com/urfave/cli v1.22.9/go.mod h1:Gos4lmkARVdJ6EkW0WaNv/tZAAMe9V7XWyB60NtXRu0= github.com/xdg-go/pbkdf2 v1.0.0 h1:Su7DPu48wXMwC3bs7MCNG+z4FhcyEuz5dlvchbq0B0c= @@ -121,11 +167,15 @@ github.com/youmark/pkcs8 v0.0.0-20240726163527-a2c0da244d78/go.mod h1:aL8wCCfTfS github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY= go.mongodb.org/mongo-driver v1.17.1 h1:Wic5cJIwJgSpBhe3lx3+/RybR5PiYRMpVFgO7cOHyIM= go.mongodb.org/mongo-driver v1.17.1/go.mod h1:wwWm/+BuOddhcq3n68LKRmgk2wXzmF6s0SFOa0GINL4= +golang.org/x/arch v0.16.0 h1:foMtLTdyOmIniqWCHjY6+JxuC54XP1fDwx4N0ASyW+U= +golang.org/x/arch v0.16.0/go.mod h1:JmwW7aLIoRUKgaTzhkiEFxvcEiQGyOg9BMonBJUS7EE= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20210711020723-a769d52b0f97/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.26.0 h1:RrRspgV4mU+YwB4FYnuBoKsUapNIL5cohGAmSH3azsw= golang.org/x/crypto v0.26.0/go.mod h1:GY7jblb9wI+FOo5y8/S2oY4zWP07AkOJ4+jxCqdqn54= +golang.org/x/crypto v0.37.0 h1:kJNSjF/Xp7kU0iB2Z+9viTPMW4EqqsrywMXLJOOsXSE= +golang.org/x/crypto v0.37.0/go.mod h1:vg+k43peMZ0pUMhYmVAWysMK35e6ioLh3wB8ZCAfbVc= golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8= golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= @@ -134,10 +184,14 @@ golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= golang.org/x/net v0.21.0 h1:AQyQV4dYCvJ7vGmJyKki9+PBdyvhkSd8EIx/qb0AYv4= golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44= +golang.org/x/net v0.38.0 h1:vRMAPTMaeGqVhG5QyLJHqNDwecKTomGeqbnfZyKlBI8= +golang.org/x/net v0.38.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.8.0 h1:3NFvSEYkUoMifnESzZl15y791HH1qU2xm6eCJU5ZPXQ= golang.org/x/sync v0.8.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= +golang.org/x/sync v0.13.0 h1:AauUjRAJ9OSnvULf/ARrrVywoJDy0YS2AwQ98I37610= +golang.org/x/sync v0.13.0/go.mod h1:1dzgHSNfp02xaA81J2MS99Qcpr2w7fw1gpm99rleRqA= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= @@ -149,6 +203,8 @@ golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.23.0 h1:YfKFowiIMvtgl1UERQoTPPToxltDeZfbj4H7dVUCwmM= golang.org/x/sys v0.23.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/sys v0.32.0 h1:s77OFDvIQeibCmezSnk/q6iAfkdiQaJi4VzroCFrN20= +golang.org/x/sys v0.32.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -158,6 +214,8 @@ golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= golang.org/x/text v0.3.8/go.mod h1:E6s5w1FMmriuDzIBO73fBruAKo1PCIq6d2Q6DHfQ8WQ= golang.org/x/text v0.17.0 h1:XtiM5bkSOt+ewxlOE/aE/AKEHibwj/6gvWMl9Rsh0Qc= golang.org/x/text v0.17.0/go.mod h1:BuEKDfySbSR4drPmRPG/7iBdf8hvFMuRexcpahXilzY= +golang.org/x/text v0.24.0 h1:dd5Bzh4yt5KYA8f9CJHCP4FB4D51c2c6JvN37xJJkJ0= +golang.org/x/text v0.24.0/go.mod h1:L8rBsPeo2pSS+xqN0d5u2ikmjtmoJbDBT1b7nHvFCdU= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= @@ -166,6 +224,8 @@ golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8T google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw= google.golang.org/protobuf v1.28.0 h1:w43yiav+6bVFTBQFZX0r7ipe9JQ1QsbMgHwbBziscLw= google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= +google.golang.org/protobuf v1.36.6 h1:z1NpPI8ku2WgiWnf+t9wTPsn6eP1L7ksHUlkfLvd9xY= +google.golang.org/protobuf v1.36.6/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= @@ -180,3 +240,4 @@ gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= +nullprogram.com/x/optparse v1.0.0/go.mod h1:KdyPE+Igbe0jQUrVfMqDMeJQIJZEuyV7pjYmp6pbG50= diff --git a/internal/verifier/webserver.go b/internal/verifier/webserver.go index 712eb440..5b246f5f 100644 --- a/internal/verifier/webserver.go +++ b/internal/verifier/webserver.go @@ -12,6 +12,7 @@ import ( "github.com/10gen/migration-verifier/contextplus" "github.com/10gen/migration-verifier/internal/logger" "github.com/10gen/migration-verifier/internal/verifier/webserver" + "github.com/gin-contrib/pprof" "github.com/gin-gonic/gin" "github.com/google/uuid" "github.com/pkg/errors" @@ -131,6 +132,7 @@ func (server *WebServer) setupRouter() *gin.Engine { gin.EnableJsonDecoderUseNumber() router := gin.New() + pprof.Register(router) router.Use(server.RequestAndResponseLogger(), gin.Recovery()) api := router.Group("/api") diff --git a/vendor/github.com/bytedance/sonic/.codespellrc b/vendor/github.com/bytedance/sonic/.codespellrc new file mode 100644 index 00000000..1ccef98d --- /dev/null +++ b/vendor/github.com/bytedance/sonic/.codespellrc @@ -0,0 +1,5 @@ +[codespell] +# ignore test files, go project names, binary files via `skip` and special var/regex via `ignore-words` +skip = fuzz,*_test.tmpl,testdata,*_test.go,go.mod,go.sum,*.gz +ignore-words = .github/workflows/.ignore_words +check-filenames = true diff --git a/vendor/github.com/bytedance/sonic/.gitignore b/vendor/github.com/bytedance/sonic/.gitignore new file mode 100644 index 00000000..fa60f43a --- /dev/null +++ b/vendor/github.com/bytedance/sonic/.gitignore @@ -0,0 +1,55 @@ +*.o +*.swp +*.swm +*.swn +*.a +*.so +_obj +_test +*.[568vq] +[568vq].out +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* +_testmain.go +*.exe +*.exe~ +*.test +*.prof +*.rar +*.zip +*.gz +*.psd +*.bmd +*.cfg +*.pptx +*.log +*nohup.out +*settings.pyc +*.sublime-project +*.sublime-workspace +.DS_Store +/.idea/ +/.vscode/ +/output/ +/vendor/ +/Gopkg.lock +/Gopkg.toml +coverage.html +coverage.out +coverage.xml +junit.xml +*.profile +*.svg +*.out +ast/test.out +ast/bench.sh + +!testdata/*.json.gz +fuzz/testdata +*__debug_bin* +*pprof +*coverage.txt +tools/venv/* \ No newline at end of file diff --git a/vendor/github.com/bytedance/sonic/.gitmodules b/vendor/github.com/bytedance/sonic/.gitmodules new file mode 100644 index 00000000..ea84b991 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/.gitmodules @@ -0,0 +1,6 @@ +[submodule "cloudwego"] + path = tools/asm2asm + url = https://github.com/cloudwego/asm2asm.git +[submodule "tools/simde"] + path = tools/simde + url = https://github.com/simd-everywhere/simde.git diff --git a/vendor/github.com/bytedance/sonic/.licenserc.yaml b/vendor/github.com/bytedance/sonic/.licenserc.yaml new file mode 100644 index 00000000..1cb993e3 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/.licenserc.yaml @@ -0,0 +1,24 @@ +header: + license: + spdx-id: Apache-2.0 + copyright-owner: ByteDance Inc. + + paths: + - '**/*.go' + - '**/*.s' + + paths-ignore: + - 'ast/asm.s' # empty file + - 'decoder/asm.s' # empty file + - 'encoder/asm.s' # empty file + - 'internal/caching/asm.s' # empty file + - 'internal/jit/asm.s' # empty file + - 'internal/native/avx/native_amd64.s' # auto-generated by asm2asm + - 'internal/native/avx/native_subr_amd64.go' # auto-generated by asm2asm + - 'internal/native/avx2/native_amd64.s' # auto-generated by asm2asm + - 'internal/native/avx2/native_subr_amd64.go' # auto-generated by asm2asm + - 'internal/resolver/asm.s' # empty file + - 'internal/rt/asm.s' # empty file + - 'internal/loader/asm.s' # empty file + + comment: on-failure \ No newline at end of file diff --git a/vendor/github.com/bytedance/sonic/CODE_OF_CONDUCT.md b/vendor/github.com/bytedance/sonic/CODE_OF_CONDUCT.md new file mode 100644 index 00000000..8505feb1 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/CODE_OF_CONDUCT.md @@ -0,0 +1,128 @@ +# Contributor Covenant Code of Conduct + +## Our Pledge + +We as members, contributors, and leaders pledge to make participation in our +community a harassment-free experience for everyone, regardless of age, body +size, visible or invisible disability, ethnicity, sex characteristics, gender +identity and expression, level of experience, education, socio-economic status, +nationality, personal appearance, race, religion, or sexual identity +and orientation. + +We pledge to act and interact in ways that contribute to an open, welcoming, +diverse, inclusive, and healthy community. + +## Our Standards + +Examples of behavior that contributes to a positive environment for our +community include: + +* Demonstrating empathy and kindness toward other people +* Being respectful of differing opinions, viewpoints, and experiences +* Giving and gracefully accepting constructive feedback +* Accepting responsibility and apologizing to those affected by our mistakes, + and learning from the experience +* Focusing on what is best not just for us as individuals, but for the + overall community + +Examples of unacceptable behavior include: + +* The use of sexualized language or imagery, and sexual attention or + advances of any kind +* Trolling, insulting or derogatory comments, and personal or political attacks +* Public or private harassment +* Publishing others' private information, such as a physical or email + address, without their explicit permission +* Other conduct which could reasonably be considered inappropriate in a + professional setting + +## Enforcement Responsibilities + +Community leaders are responsible for clarifying and enforcing our standards of +acceptable behavior and will take appropriate and fair corrective action in +response to any behavior that they deem inappropriate, threatening, offensive, +or harmful. + +Community leaders have the right and responsibility to remove, edit, or reject +comments, commits, code, wiki edits, issues, and other contributions that are +not aligned to this Code of Conduct, and will communicate reasons for moderation +decisions when appropriate. + +## Scope + +This Code of Conduct applies within all community spaces, and also applies when +an individual is officially representing the community in public spaces. +Examples of representing our community include using an official e-mail address, +posting via an official social media account, or acting as an appointed +representative at an online or offline event. + +## Enforcement + +Instances of abusive, harassing, or otherwise unacceptable behavior may be +reported to the community leaders responsible for enforcement at +wudi.daniel@bytedance.com. +All complaints will be reviewed and investigated promptly and fairly. + +All community leaders are obligated to respect the privacy and security of the +reporter of any incident. + +## Enforcement Guidelines + +Community leaders will follow these Community Impact Guidelines in determining +the consequences for any action they deem in violation of this Code of Conduct: + +### 1. Correction + +**Community Impact**: Use of inappropriate language or other behavior deemed +unprofessional or unwelcome in the community. + +**Consequence**: A private, written warning from community leaders, providing +clarity around the nature of the violation and an explanation of why the +behavior was inappropriate. A public apology may be requested. + +### 2. Warning + +**Community Impact**: A violation through a single incident or series +of actions. + +**Consequence**: A warning with consequences for continued behavior. No +interaction with the people involved, including unsolicited interaction with +those enforcing the Code of Conduct, for a specified period of time. This +includes avoiding interactions in community spaces as well as external channels +like social media. Violating these terms may lead to a temporary or +permanent ban. + +### 3. Temporary Ban + +**Community Impact**: A serious violation of community standards, including +sustained inappropriate behavior. + +**Consequence**: A temporary ban from any sort of interaction or public +communication with the community for a specified period of time. No public or +private interaction with the people involved, including unsolicited interaction +with those enforcing the Code of Conduct, is allowed during this period. +Violating these terms may lead to a permanent ban. + +### 4. Permanent Ban + +**Community Impact**: Demonstrating a pattern of violation of community +standards, including sustained inappropriate behavior, harassment of an +individual, or aggression toward or disparagement of classes of individuals. + +**Consequence**: A permanent ban from any sort of public interaction within +the community. + +## Attribution + +This Code of Conduct is adapted from the [Contributor Covenant][homepage], +version 2.0, available at +https://www.contributor-covenant.org/version/2/0/code_of_conduct.html. + +Community Impact Guidelines were inspired by [Mozilla's code of conduct +enforcement ladder](https://github.com/mozilla/diversity). + +[homepage]: https://www.contributor-covenant.org + +For answers to common questions about this code of conduct, see the FAQ at +https://www.contributor-covenant.org/faq. Translations are available at +https://www.contributor-covenant.org/translations. diff --git a/vendor/github.com/bytedance/sonic/CONTRIBUTING.md b/vendor/github.com/bytedance/sonic/CONTRIBUTING.md new file mode 100644 index 00000000..7f63c661 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/CONTRIBUTING.md @@ -0,0 +1,63 @@ +# How to Contribute + +## Your First Pull Request +We use GitHub for our codebase. You can start by reading [How To Pull Request](https://docs.github.com/en/github/collaborating-with-issues-and-pull-requests/about-pull-requests). + +## Without Semantic Versioning +We keep the stable code in branch `main` like `golang.org/x`. Development base on branch `develop`. We promise the **Forward Compatibility** by adding new package directory with suffix `v2/v3` when code has break changes. + +## Branch Organization +We use [git-flow](https://nvie.com/posts/a-successful-git-branching-model/) as our branch organization, as known as [FDD](https://en.wikipedia.org/wiki/Feature-driven_development) + + +## Bugs +### 1. How to Find Known Issues +We are using [Github Issues](https://github.com/bytedance/sonic/issues) for our public bugs. We keep a close eye on this and try to make it clear when we have an internal fix in progress. Before filing a new task, try to make sure your problem doesn’t already exist. + +### 2. Reporting New Issues +Providing a reduced test code is a recommended way for reporting issues. Then can be placed in: +- Just in issues +- [Golang Playground](https://play.golang.org/) + +### 3. Security Bugs +Please do not report the safe disclosure of bugs to public issues. Contact us by [Support Email](mailto:sonic@bytedance.com) + +## How to Get in Touch +- [Email](mailto:wudi.daniel@bytedance.com) + +## Submit a Pull Request +Before you submit your Pull Request (PR) consider the following guidelines: +1. Search [GitHub](https://github.com/bytedance/sonic/pulls) for an open or closed PR that relates to your submission. You don't want to duplicate existing efforts. +2. Be sure that an issue describes the problem you're fixing, or documents the design for the feature you'd like to add. Discussing the design upfront helps to ensure that we're ready to accept your work. +3. [Fork](https://docs.github.com/en/github/getting-started-with-github/fork-a-repo) the bytedance/sonic repo. +4. In your forked repository, make your changes in a new git branch: + ``` + git checkout -b bugfix/security_bug develop + ``` +5. Create your patch, including appropriate test cases. +6. Follow our [Style Guides](#code-style-guides). +7. Commit your changes using a descriptive commit message that follows [AngularJS Git Commit Message Conventions](https://docs.google.com/document/d/1QrDFcIiPjSLDn3EL15IJygNPiHORgU1_OOAqWjiDU5Y/edit). + Adherence to these conventions is necessary because release notes will be automatically generated from these messages. +8. Push your branch to GitHub: + ``` + git push origin bugfix/security_bug + ``` +9. In GitHub, send a pull request to `sonic:main` + +Note: you must use one of `optimize/feature/bugfix/doc/ci/test/refactor` following a slash(`/`) as the branch prefix. + +Your pr title and commit message should follow https://www.conventionalcommits.org/. + +## Contribution Prerequisites +- Our development environment keeps up with [Go Official](https://golang.org/project/). +- You need fully checking with lint tools before submit your pull request. [gofmt](https://golang.org/pkg/cmd/gofmt/) & [golangci-lint](https://github.com/golangci/golangci-lint) +- You are familiar with [Github](https://github.com) +- Maybe you need familiar with [Actions](https://github.com/features/actions)(our default workflow tool). + +## Code Style Guides +See [Go Code Review Comments](https://github.com/golang/go/wiki/CodeReviewComments). + +Good resources: +- [Effective Go](https://golang.org/doc/effective_go) +- [Pingcap General advice](https://pingcap.github.io/style-guide/general.html) +- [Uber Go Style Guide](https://github.com/uber-go/guide/blob/master/style.md) diff --git a/vendor/github.com/bytedance/sonic/CREDITS b/vendor/github.com/bytedance/sonic/CREDITS new file mode 100644 index 00000000..e69de29b diff --git a/vendor/github.com/bytedance/sonic/LICENSE b/vendor/github.com/bytedance/sonic/LICENSE new file mode 100644 index 00000000..261eeb9e --- /dev/null +++ b/vendor/github.com/bytedance/sonic/LICENSE @@ -0,0 +1,201 @@ + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright [yyyy] [name of copyright owner] + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/github.com/bytedance/sonic/README.md b/vendor/github.com/bytedance/sonic/README.md new file mode 100644 index 00000000..317878d0 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/README.md @@ -0,0 +1,501 @@ +# Sonic + +English | [中文](README_ZH_CN.md) + +A blazingly fast JSON serializing & deserializing library, accelerated by JIT (just-in-time compiling) and SIMD (single-instruction-multiple-data). + +## Requirement + +- Go: 1.17~1.24 + - Notice: Go1.24.0 is not supported due to the [issue](https://github.com/golang/go/issues/71672), please use higher go version or add build tag `--ldflags="-checklinkname=0"` +- OS: Linux / MacOS / Windows +- CPU: AMD64 / (ARM64, need go1.20 above) + +## Features + +- Runtime object binding without code generation +- Complete APIs for JSON value manipulation +- Fast, fast, fast! + +## APIs + +see [go.dev](https://pkg.go.dev/github.com/bytedance/sonic) + +## Benchmarks + +For **all sizes** of json and **all scenarios** of usage, **Sonic performs best**. + +- [Medium](https://github.com/bytedance/sonic/blob/main/decoder/testdata_test.go#L19) (13KB, 300+ key, 6 layers) + +```powershell +goversion: 1.17.1 +goos: darwin +goarch: amd64 +cpu: Intel(R) Core(TM) i9-9880H CPU @ 2.30GHz +BenchmarkEncoder_Generic_Sonic-16 32393 ns/op 402.40 MB/s 11965 B/op 4 allocs/op +BenchmarkEncoder_Generic_Sonic_Fast-16 21668 ns/op 601.57 MB/s 10940 B/op 4 allocs/op +BenchmarkEncoder_Generic_JsonIter-16 42168 ns/op 309.12 MB/s 14345 B/op 115 allocs/op +BenchmarkEncoder_Generic_GoJson-16 65189 ns/op 199.96 MB/s 23261 B/op 16 allocs/op +BenchmarkEncoder_Generic_StdLib-16 106322 ns/op 122.60 MB/s 49136 B/op 789 allocs/op +BenchmarkEncoder_Binding_Sonic-16 6269 ns/op 2079.26 MB/s 14173 B/op 4 allocs/op +BenchmarkEncoder_Binding_Sonic_Fast-16 5281 ns/op 2468.16 MB/s 12322 B/op 4 allocs/op +BenchmarkEncoder_Binding_JsonIter-16 20056 ns/op 649.93 MB/s 9488 B/op 2 allocs/op +BenchmarkEncoder_Binding_GoJson-16 8311 ns/op 1568.32 MB/s 9481 B/op 1 allocs/op +BenchmarkEncoder_Binding_StdLib-16 16448 ns/op 792.52 MB/s 9479 B/op 1 allocs/op +BenchmarkEncoder_Parallel_Generic_Sonic-16 6681 ns/op 1950.93 MB/s 12738 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Generic_Sonic_Fast-16 4179 ns/op 3118.99 MB/s 10757 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Generic_JsonIter-16 9861 ns/op 1321.84 MB/s 14362 B/op 115 allocs/op +BenchmarkEncoder_Parallel_Generic_GoJson-16 18850 ns/op 691.52 MB/s 23278 B/op 16 allocs/op +BenchmarkEncoder_Parallel_Generic_StdLib-16 45902 ns/op 283.97 MB/s 49174 B/op 789 allocs/op +BenchmarkEncoder_Parallel_Binding_Sonic-16 1480 ns/op 8810.09 MB/s 13049 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Binding_Sonic_Fast-16 1209 ns/op 10785.23 MB/s 11546 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Binding_JsonIter-16 6170 ns/op 2112.58 MB/s 9504 B/op 2 allocs/op +BenchmarkEncoder_Parallel_Binding_GoJson-16 3321 ns/op 3925.52 MB/s 9496 B/op 1 allocs/op +BenchmarkEncoder_Parallel_Binding_StdLib-16 3739 ns/op 3486.49 MB/s 9480 B/op 1 allocs/op + +BenchmarkDecoder_Generic_Sonic-16 66812 ns/op 195.10 MB/s 57602 B/op 723 allocs/op +BenchmarkDecoder_Generic_Sonic_Fast-16 54523 ns/op 239.07 MB/s 49786 B/op 313 allocs/op +BenchmarkDecoder_Generic_StdLib-16 124260 ns/op 104.90 MB/s 50869 B/op 772 allocs/op +BenchmarkDecoder_Generic_JsonIter-16 91274 ns/op 142.81 MB/s 55782 B/op 1068 allocs/op +BenchmarkDecoder_Generic_GoJson-16 88569 ns/op 147.17 MB/s 66367 B/op 973 allocs/op +BenchmarkDecoder_Binding_Sonic-16 32557 ns/op 400.38 MB/s 28302 B/op 137 allocs/op +BenchmarkDecoder_Binding_Sonic_Fast-16 28649 ns/op 455.00 MB/s 24999 B/op 34 allocs/op +BenchmarkDecoder_Binding_StdLib-16 111437 ns/op 116.97 MB/s 10576 B/op 208 allocs/op +BenchmarkDecoder_Binding_JsonIter-16 35090 ns/op 371.48 MB/s 14673 B/op 385 allocs/op +BenchmarkDecoder_Binding_GoJson-16 28738 ns/op 453.59 MB/s 22039 B/op 49 allocs/op +BenchmarkDecoder_Parallel_Generic_Sonic-16 12321 ns/op 1057.91 MB/s 57233 B/op 723 allocs/op +BenchmarkDecoder_Parallel_Generic_Sonic_Fast-16 10644 ns/op 1224.64 MB/s 49362 B/op 313 allocs/op +BenchmarkDecoder_Parallel_Generic_StdLib-16 57587 ns/op 226.35 MB/s 50874 B/op 772 allocs/op +BenchmarkDecoder_Parallel_Generic_JsonIter-16 38666 ns/op 337.12 MB/s 55789 B/op 1068 allocs/op +BenchmarkDecoder_Parallel_Generic_GoJson-16 30259 ns/op 430.79 MB/s 66370 B/op 974 allocs/op +BenchmarkDecoder_Parallel_Binding_Sonic-16 5965 ns/op 2185.28 MB/s 27747 B/op 137 allocs/op +BenchmarkDecoder_Parallel_Binding_Sonic_Fast-16 5170 ns/op 2521.31 MB/s 24715 B/op 34 allocs/op +BenchmarkDecoder_Parallel_Binding_StdLib-16 27582 ns/op 472.58 MB/s 10576 B/op 208 allocs/op +BenchmarkDecoder_Parallel_Binding_JsonIter-16 13571 ns/op 960.51 MB/s 14685 B/op 385 allocs/op +BenchmarkDecoder_Parallel_Binding_GoJson-16 10031 ns/op 1299.51 MB/s 22111 B/op 49 allocs/op + +BenchmarkGetOne_Sonic-16 3276 ns/op 3975.78 MB/s 24 B/op 1 allocs/op +BenchmarkGetOne_Gjson-16 9431 ns/op 1380.81 MB/s 0 B/op 0 allocs/op +BenchmarkGetOne_Jsoniter-16 51178 ns/op 254.46 MB/s 27936 B/op 647 allocs/op +BenchmarkGetOne_Parallel_Sonic-16 216.7 ns/op 60098.95 MB/s 24 B/op 1 allocs/op +BenchmarkGetOne_Parallel_Gjson-16 1076 ns/op 12098.62 MB/s 0 B/op 0 allocs/op +BenchmarkGetOne_Parallel_Jsoniter-16 17741 ns/op 734.06 MB/s 27945 B/op 647 allocs/op +BenchmarkSetOne_Sonic-16 9571 ns/op 1360.61 MB/s 1584 B/op 17 allocs/op +BenchmarkSetOne_Sjson-16 36456 ns/op 357.22 MB/s 52180 B/op 9 allocs/op +BenchmarkSetOne_Jsoniter-16 79475 ns/op 163.86 MB/s 45862 B/op 964 allocs/op +BenchmarkSetOne_Parallel_Sonic-16 850.9 ns/op 15305.31 MB/s 1584 B/op 17 allocs/op +BenchmarkSetOne_Parallel_Sjson-16 18194 ns/op 715.77 MB/s 52247 B/op 9 allocs/op +BenchmarkSetOne_Parallel_Jsoniter-16 33560 ns/op 388.05 MB/s 45892 B/op 964 allocs/op +BenchmarkLoadNode/LoadAll()-16 11384 ns/op 1143.93 MB/s 6307 B/op 25 allocs/op +BenchmarkLoadNode_Parallel/LoadAll()-16 5493 ns/op 2370.68 MB/s 7145 B/op 25 allocs/op +BenchmarkLoadNode/Interface()-16 17722 ns/op 734.85 MB/s 13323 B/op 88 allocs/op +BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.70 MB/s 15178 B/op 88 allocs/op +``` + +- [Small](https://github.com/bytedance/sonic/blob/main/testdata/small.go) (400B, 11 keys, 3 layers) +![small benchmarks](./docs/imgs/bench-small.png) +- [Large](https://github.com/bytedance/sonic/blob/main/testdata/twitter.json) (635KB, 10000+ key, 6 layers) +![large benchmarks](./docs/imgs/bench-large.png) + +See [bench.sh](https://github.com/bytedance/sonic/blob/main/scripts/bench.sh) for benchmark codes. + +## How it works + +See [INTRODUCTION.md](./docs/INTRODUCTION.md). + +## Usage + +### Marshal/Unmarshal + +Default behaviors are mostly consistent with `encoding/json`, except HTML escaping form (see [Escape HTML](https://github.com/bytedance/sonic/blob/main/README.md#escape-html)) and `SortKeys` feature (optional support see [Sort Keys](https://github.com/bytedance/sonic/blob/main/README.md#sort-keys)) that is **NOT** in conformity to [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259). + + ```go +import "github.com/bytedance/sonic" + +var data YourSchema +// Marshal +output, err := sonic.Marshal(&data) +// Unmarshal +err := sonic.Unmarshal(output, &data) + ``` + +### Streaming IO + +Sonic supports decoding json from `io.Reader` or encoding objects into `io.Writer`, aims at handling multiple values as well as reducing memory consumption. + +- encoder + +```go +var o1 = map[string]interface{}{ + "a": "b", +} +var o2 = 1 +var w = bytes.NewBuffer(nil) +var enc = sonic.ConfigDefault.NewEncoder(w) +enc.Encode(o1) +enc.Encode(o2) +fmt.Println(w.String()) +// Output: +// {"a":"b"} +// 1 +``` + +- decoder + +```go +var o = map[string]interface{}{} +var r = strings.NewReader(`{"a":"b"}{"1":"2"}`) +var dec = sonic.ConfigDefault.NewDecoder(r) +dec.Decode(&o) +dec.Decode(&o) +fmt.Printf("%+v", o) +// Output: +// map[1:2 a:b] +``` + +### Use Number/Use Int64 + + ```go +import "github.com/bytedance/sonic/decoder" + +var input = `1` +var data interface{} + +// default float64 +dc := decoder.NewDecoder(input) +dc.Decode(&data) // data == float64(1) +// use json.Number +dc = decoder.NewDecoder(input) +dc.UseNumber() +dc.Decode(&data) // data == json.Number("1") +// use int64 +dc = decoder.NewDecoder(input) +dc.UseInt64() +dc.Decode(&data) // data == int64(1) + +root, err := sonic.GetFromString(input) +// Get json.Number +jn := root.Number() +jm := root.InterfaceUseNumber().(json.Number) // jn == jm +// Get float64 +fn := root.Float64() +fm := root.Interface().(float64) // jn == jm + ``` + +### Sort Keys + +On account of the performance loss from sorting (roughly 10%), sonic doesn't enable this feature by default. If your component depends on it to work (like [zstd](https://github.com/facebook/zstd)), Use it like this: + +```go +import "github.com/bytedance/sonic" +import "github.com/bytedance/sonic/encoder" + +// Binding map only +m := map[string]interface{}{} +v, err := encoder.Encode(m, encoder.SortMapKeys) + +// Or ast.Node.SortKeys() before marshal +var root := sonic.Get(JSON) +err := root.SortKeys() +``` + +### Escape HTML + +On account of the performance loss (roughly 15%), sonic doesn't enable this feature by default. You can use `encoder.EscapeHTML` option to open this feature (align with `encoding/json.HTMLEscape`). + +```go +import "github.com/bytedance/sonic" + +v := map[string]string{"&&":"<>"} +ret, err := Encode(v, EscapeHTML) // ret == `{"\u0026\u0026":{"X":"\u003c\u003e"}}` +``` + +### Compact Format + +Sonic encodes primitive objects (struct/map...) as compact-format JSON by default, except marshaling `json.RawMessage` or `json.Marshaler`: sonic ensures validating their output JSON but **DO NOT** compacting them for performance concerns. We provide the option `encoder.CompactMarshaler` to add compacting process. + +### Print Error + +If there invalid syntax in input JSON, sonic will return `decoder.SyntaxError`, which supports pretty-printing of error position + +```go +import "github.com/bytedance/sonic" +import "github.com/bytedance/sonic/decoder" + +var data interface{} +err := sonic.UnmarshalString("[[[}]]", &data) +if err != nil { + /* One line by default */ + println(e.Error()) // "Syntax error at index 3: invalid char\n\n\t[[[}]]\n\t...^..\n" + /* Pretty print */ + if e, ok := err.(decoder.SyntaxError); ok { + /*Syntax error at index 3: invalid char + + [[[}]] + ...^.. + */ + print(e.Description()) + } else if me, ok := err.(*decoder.MismatchTypeError); ok { + // decoder.MismatchTypeError is new to Sonic v1.6.0 + print(me.Description()) + } +} +``` + +#### Mismatched Types [Sonic v1.6.0] + +If there a **mismatch-typed** value for a given key, sonic will report `decoder.MismatchTypeError` (if there are many, report the last one), but still skip wrong the value and keep decoding next JSON. + +```go +import "github.com/bytedance/sonic" +import "github.com/bytedance/sonic/decoder" + +var data = struct{ + A int + B int +}{} +err := UnmarshalString(`{"A":"1","B":1}`, &data) +println(err.Error()) // Mismatch type int with value string "at index 5: mismatched type with value\n\n\t{\"A\":\"1\",\"B\":1}\n\t.....^.........\n" +fmt.Printf("%+v", data) // {A:0 B:1} +``` + +### Ast.Node + +Sonic/ast.Node is a completely self-contained AST for JSON. It implements serialization and deserialization both and provides robust APIs for obtaining and modification of generic data. + +#### Get/Index + +Search partial JSON by given paths, which must be non-negative integer or string, or nil + +```go +import "github.com/bytedance/sonic" + +input := []byte(`{"key1":[{},{"key2":{"key3":[1,2,3]}}]}`) + +// no path, returns entire json +root, err := sonic.Get(input) +raw := root.Raw() // == string(input) + +// multiple paths +root, err := sonic.Get(input, "key1", 1, "key2") +sub := root.Get("key3").Index(2).Int64() // == 3 +``` + +**Tip**: since `Index()` uses offset to locate data, which is much faster than scanning like `Get()`, we suggest you use it as much as possible. And sonic also provides another API `IndexOrGet()` to underlying use offset as well as ensure the key is matched. + +#### SearchOption + +`Searcher` provides some options for user to meet different needs: + +```go +opts := ast.SearchOption{ CopyReturn: true ... } +val, err := sonic.GetWithOptions(JSON, opts, "key") +``` + +- CopyReturn +Indicate the searcher to copy the result JSON string instead of refer from the input. This can help to reduce memory usage if you cache the results +- ConcurentRead +Since `ast.Node` use `Lazy-Load` design, it doesn't support Concurrently-Read by default. If you want to read it concurrently, please specify it. +- ValidateJSON +Indicate the searcher to validate the entire JSON. This option is enabled by default, which slow down the search speed a little. + +#### Set/Unset + +Modify the json content by Set()/Unset() + +```go +import "github.com/bytedance/sonic" + +// Set +exist, err := root.Set("key4", NewBool(true)) // exist == false +alias1 := root.Get("key4") +println(alias1.Valid()) // true +alias2 := root.Index(1) +println(alias1 == alias2) // true + +// Unset +exist, err := root.UnsetByIndex(1) // exist == true +println(root.Get("key4").Check()) // "value not exist" +``` + +#### Serialize + +To encode `ast.Node` as json, use `MarshalJson()` or `json.Marshal()` (MUST pass the node's pointer) + +```go +import ( + "encoding/json" + "github.com/bytedance/sonic" +) + +buf, err := root.MarshalJson() +println(string(buf)) // {"key1":[{},{"key2":{"key3":[1,2,3]}}]} +exp, err := json.Marshal(&root) // WARN: use pointer +println(string(buf) == string(exp)) // true +``` + +#### APIs + +- validation: `Check()`, `Error()`, `Valid()`, `Exist()` +- searching: `Index()`, `Get()`, `IndexPair()`, `IndexOrGet()`, `GetByPath()` +- go-type casting: `Int64()`, `Float64()`, `String()`, `Number()`, `Bool()`, `Map[UseNumber|UseNode]()`, `Array[UseNumber|UseNode]()`, `Interface[UseNumber|UseNode]()` +- go-type packing: `NewRaw()`, `NewNumber()`, `NewNull()`, `NewBool()`, `NewString()`, `NewObject()`, `NewArray()` +- iteration: `Values()`, `Properties()`, `ForEach()`, `SortKeys()` +- modification: `Set()`, `SetByIndex()`, `Add()` + +### Ast.Visitor + +Sonic provides an advanced API for fully parsing JSON into non-standard types (neither `struct` not `map[string]interface{}`) without using any intermediate representation (`ast.Node` or `interface{}`). For example, you might have the following types which are like `interface{}` but actually not `interface{}`: + +```go +type UserNode interface {} + +// the following types implement the UserNode interface. +type ( + UserNull struct{} + UserBool struct{ Value bool } + UserInt64 struct{ Value int64 } + UserFloat64 struct{ Value float64 } + UserString struct{ Value string } + UserObject struct{ Value map[string]UserNode } + UserArray struct{ Value []UserNode } +) +``` + +Sonic provides the following API to return **the preorder traversal of a JSON AST**. The `ast.Visitor` is a SAX style interface which is used in some C++ JSON library. You should implement `ast.Visitor` by yourself and pass it to `ast.Preorder()` method. In your visitor you can make your custom types to represent JSON values. There may be an O(n) space container (such as stack) in your visitor to record the object / array hierarchy. + +```go +func Preorder(str string, visitor Visitor, opts *VisitorOptions) error + +type Visitor interface { + OnNull() error + OnBool(v bool) error + OnString(v string) error + OnInt64(v int64, n json.Number) error + OnFloat64(v float64, n json.Number) error + OnObjectBegin(capacity int) error + OnObjectKey(key string) error + OnObjectEnd() error + OnArrayBegin(capacity int) error + OnArrayEnd() error +} +``` + +See [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) for detailed usage. We also implement a demo visitor for `UserNode` in [ast/visitor_test.go](https://github.com/bytedance/sonic/blob/main/ast/visitor_test.go). + +## Compatibility + +For developers who want to use sonic to meet diffirent scenarios, we provide some integrated configs as `sonic.API` + +- `ConfigDefault`: the sonic's default config (`EscapeHTML=false`,`SortKeys=false`...) to run sonic fast meanwhile ensure security. +- `ConfigStd`: the std-compatible config (`EscapeHTML=true`,`SortKeys=true`...) +- `ConfigFastest`: the fastest config (`NoQuoteTextMarshaler=true`) to run on sonic as fast as possible. +Sonic **DOES NOT** ensure to support all environments, due to the difficulty of developing high-performance codes. On non-sonic-supporting environment, the implementation will fall back to `encoding/json`. Thus beflow configs will all equal to `ConfigStd`. + +## Tips + +### Pretouch + +Since Sonic uses [golang-asm](https://github.com/twitchyliquid64/golang-asm) as a JIT assembler, which is NOT very suitable for runtime compiling, first-hit running of a huge schema may cause request-timeout or even process-OOM. For better stability, we advise **using `Pretouch()` for huge-schema or compact-memory applications** before `Marshal()/Unmarshal()`. + +```go +import ( + "reflect" + "github.com/bytedance/sonic" + "github.com/bytedance/sonic/option" +) + +func init() { + var v HugeStruct + + // For most large types (nesting depth <= option.DefaultMaxInlineDepth) + err := sonic.Pretouch(reflect.TypeOf(v)) + + // with more CompileOption... + err := sonic.Pretouch(reflect.TypeOf(v), + // If the type is too deep nesting (nesting depth > option.DefaultMaxInlineDepth), + // you can set compile recursive loops in Pretouch for better stability in JIT. + option.WithCompileRecursiveDepth(loop), + // For a large nested struct, try to set a smaller depth to reduce compiling time. + option.WithCompileMaxInlineDepth(depth), + ) +} +``` + +### Copy string + +When decoding **string values without any escaped characters**, sonic references them from the origin JSON buffer instead of mallocing a new buffer to copy. This helps a lot for CPU performance but may leave the whole JSON buffer in memory as long as the decoded objects are being used. In practice, we found the extra memory introduced by referring JSON buffer is usually 20% ~ 80% of decoded objects. Once an application holds these objects for a long time (for example, cache the decoded objects for reusing), its in-use memory on the server may go up. - `Config.CopyString`/`decoder.CopyString()`: We provide the option for `Decode()` / `Unmarshal()` users to choose not to reference the JSON buffer, which may cause a decline in CPU performance to some degree. + +- `GetFromStringNoCopy()`: For memory safety, `sonic.Get()` / `sonic.GetFromString()` now copies return JSON. If users want to get json more quickly and not care about memory usage, you can use `GetFromStringNoCopy()` to return a JSON directly referenced from source. + +### Pass string or []byte? + +For alignment to `encoding/json`, we provide API to pass `[]byte` as an argument, but the string-to-bytes copy is conducted at the same time considering safety, which may lose performance when the origin JSON is huge. Therefore, you can use `UnmarshalString()` and `GetFromString()` to pass a string, as long as your origin data is a string or **nocopy-cast** is safe for your []byte. We also provide API `MarshalString()` for convenient **nocopy-cast** of encoded JSON []byte, which is safe since sonic's output bytes is always duplicated and unique. + +### Accelerate `encoding.TextMarshaler` + +To ensure data security, sonic.Encoder quotes and escapes string values from `encoding.TextMarshaler` interfaces by default, which may degrade performance much if most of your data is in form of them. We provide `encoder.NoQuoteTextMarshaler` to skip these operations, which means you **MUST** ensure their output string escaped and quoted following [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259). + +### Better performance for generic data + +In **fully-parsed** scenario, `Unmarshal()` performs better than `Get()`+`Node.Interface()`. But if you only have a part of the schema for specific json, you can combine `Get()` and `Unmarshal()` together: + +```go +import "github.com/bytedance/sonic" + +node, err := sonic.GetFromString(_TwitterJson, "statuses", 3, "user") +var user User // your partial schema... +err = sonic.UnmarshalString(node.Raw(), &user) +``` + +Even if you don't have any schema, use `ast.Node` as the container of generic values instead of `map` or `interface`: + +```go +import "github.com/bytedance/sonic" + +root, err := sonic.GetFromString(_TwitterJson) +user := root.GetByPath("statuses", 3, "user") // === root.Get("status").Index(3).Get("user") +err = user.Check() + +// err = user.LoadAll() // only call this when you want to use 'user' concurrently... +go someFunc(user) +``` + +Why? Because `ast.Node` stores its children using `array`: + +- `Array`'s performance is **much better** than `Map` when Inserting (Deserialize) and Scanning (Serialize) data; +- **Hashing** (`map[x]`) is not as efficient as **Indexing** (`array[x]`), which `ast.Node` can conduct on **both array and object**; +- Using `Interface()`/`Map()` means Sonic must parse all the underlying values, while `ast.Node` can parse them **on demand**. + +**CAUTION:** `ast.Node` **DOESN'T** ensure concurrent security directly, due to its **lazy-load** design. However, you can call `Node.Load()`/`Node.LoadAll()` to achieve that, which may bring performance reduction while it still works faster than converting to `map` or `interface{}` + +### Ast.Node or Ast.Visitor? + +For generic data, `ast.Node` should be enough for your needs in most cases. + +However, `ast.Node` is designed for partially processing JSON string. It has some special designs such as lazy-load which might not be suitable for directly parsing the whole JSON string like `Unmarshal()`. Although `ast.Node` is better then `map` or `interface{}`, it's also a kind of intermediate representation after all if your final types are customized and you have to convert the above types to your custom types after parsing. + +For better performance, in previous case the `ast.Visitor` will be the better choice. It performs JSON decoding like `Unmarshal()` and you can directly use your final types to represents a JSON AST without any intermediate representations. + +But `ast.Visitor` is not a very handy API. You might need to write a lot of code to implement your visitor and carefully maintain the tree hierarchy during decoding. Please read the comments in [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) carefully if you decide to use this API. + +### Buffer Size + +Sonic use memory pool in many places like `encoder.Encode`, `ast.Node.MarshalJSON` to improve performance, which may produce more memory usage (in-use) when server's load is high. See [issue 614](https://github.com/bytedance/sonic/issues/614). Therefore, we introduce some options to let user control the behavior of memory pool. See [option](https://pkg.go.dev/github.com/bytedance/sonic@v1.11.9/option#pkg-variables) package. + +### Faster JSON Skip + +For security, sonic use [FSM](native/skip_one.c) algorithm to validate JSON when decoding raw JSON or encoding `json.Marshaler`, which is much slower (1~10x) than [SIMD-searching-pair](native/skip_one_fast.c) algorithm. If user has many redundant JSON value and DO NOT NEED to strictly validate JSON correctness, you can enable below options: + +- `Config.NoValidateSkipJSON`: for faster skipping JSON when decoding, such as unknown fields, json.Unmarshaler(json.RawMessage), mismatched values, and redundant array elements +- `Config.NoValidateJSONMarshaler`: avoid validating JSON when encoding `json.Marshaler` +- `SearchOption.ValidateJSON`: indicates if validate located JSON value when `Get` + +## JSON-Path Support (GJSON) + +[tidwall/gjson](https://github.com/tidwall/gjson) has provided a comprehensive and popular JSON-Path API, and + a lot of older codes heavily relies on it. Therefore, we provides a wrapper library, which combines gjson's API with sonic's SIMD algorithm to boost up the performance. See [cloudwego/gjson](https://github.com/cloudwego/gjson). + +## Community + +Sonic is a subproject of [CloudWeGo](https://www.cloudwego.io/). We are committed to building a cloud native ecosystem. diff --git a/vendor/github.com/bytedance/sonic/README_ZH_CN.md b/vendor/github.com/bytedance/sonic/README_ZH_CN.md new file mode 100644 index 00000000..3c24a51a --- /dev/null +++ b/vendor/github.com/bytedance/sonic/README_ZH_CN.md @@ -0,0 +1,494 @@ +# Sonic + +[English](README.md) | 中文 + +一个速度奇快的 JSON 序列化/反序列化库,由 JIT (即时编译)和 SIMD (单指令流多数据流)加速。 + +## 依赖 + +- Go: 1.17~1.24 + - 注意:Go1.24.0 由于 [issue](https://github.com/golang/go/issues/71672) 不可用,请升级到更高 Go 版本,或添加编译选项 `--ldflags="-checklinkname=0"` +- OS: Linux / MacOS / Windows +- CPU: AMD64 / (ARM64, 需要 Go1.20 以上) + +## 接口 + +详见 [go.dev](https://pkg.go.dev/github.com/bytedance/sonic) + +## 特色 + +- 运行时对象绑定,无需代码生成 +- 完备的 JSON 操作 API +- 快,更快,还要更快! + +## 基准测试 + +对于**所有大小**的 json 和**所有使用场景**, **Sonic 表现均为最佳**。 + +- [中型](https://github.com/bytedance/sonic/blob/main/decoder/testdata_test.go#L19) (13kB, 300+ 键, 6 层) + +```powershell +goversion: 1.17.1 +goos: darwin +goarch: amd64 +cpu: Intel(R) Core(TM) i9-9880H CPU @ 2.30GHz +BenchmarkEncoder_Generic_Sonic-16 32393 ns/op 402.40 MB/s 11965 B/op 4 allocs/op +BenchmarkEncoder_Generic_Sonic_Fast-16 21668 ns/op 601.57 MB/s 10940 B/op 4 allocs/op +BenchmarkEncoder_Generic_JsonIter-16 42168 ns/op 309.12 MB/s 14345 B/op 115 allocs/op +BenchmarkEncoder_Generic_GoJson-16 65189 ns/op 199.96 MB/s 23261 B/op 16 allocs/op +BenchmarkEncoder_Generic_StdLib-16 106322 ns/op 122.60 MB/s 49136 B/op 789 allocs/op +BenchmarkEncoder_Binding_Sonic-16 6269 ns/op 2079.26 MB/s 14173 B/op 4 allocs/op +BenchmarkEncoder_Binding_Sonic_Fast-16 5281 ns/op 2468.16 MB/s 12322 B/op 4 allocs/op +BenchmarkEncoder_Binding_JsonIter-16 20056 ns/op 649.93 MB/s 9488 B/op 2 allocs/op +BenchmarkEncoder_Binding_GoJson-16 8311 ns/op 1568.32 MB/s 9481 B/op 1 allocs/op +BenchmarkEncoder_Binding_StdLib-16 16448 ns/op 792.52 MB/s 9479 B/op 1 allocs/op +BenchmarkEncoder_Parallel_Generic_Sonic-16 6681 ns/op 1950.93 MB/s 12738 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Generic_Sonic_Fast-16 4179 ns/op 3118.99 MB/s 10757 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Generic_JsonIter-16 9861 ns/op 1321.84 MB/s 14362 B/op 115 allocs/op +BenchmarkEncoder_Parallel_Generic_GoJson-16 18850 ns/op 691.52 MB/s 23278 B/op 16 allocs/op +BenchmarkEncoder_Parallel_Generic_StdLib-16 45902 ns/op 283.97 MB/s 49174 B/op 789 allocs/op +BenchmarkEncoder_Parallel_Binding_Sonic-16 1480 ns/op 8810.09 MB/s 13049 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Binding_Sonic_Fast-16 1209 ns/op 10785.23 MB/s 11546 B/op 4 allocs/op +BenchmarkEncoder_Parallel_Binding_JsonIter-16 6170 ns/op 2112.58 MB/s 9504 B/op 2 allocs/op +BenchmarkEncoder_Parallel_Binding_GoJson-16 3321 ns/op 3925.52 MB/s 9496 B/op 1 allocs/op +BenchmarkEncoder_Parallel_Binding_StdLib-16 3739 ns/op 3486.49 MB/s 9480 B/op 1 allocs/op + +BenchmarkDecoder_Generic_Sonic-16 66812 ns/op 195.10 MB/s 57602 B/op 723 allocs/op +BenchmarkDecoder_Generic_Sonic_Fast-16 54523 ns/op 239.07 MB/s 49786 B/op 313 allocs/op +BenchmarkDecoder_Generic_StdLib-16 124260 ns/op 104.90 MB/s 50869 B/op 772 allocs/op +BenchmarkDecoder_Generic_JsonIter-16 91274 ns/op 142.81 MB/s 55782 B/op 1068 allocs/op +BenchmarkDecoder_Generic_GoJson-16 88569 ns/op 147.17 MB/s 66367 B/op 973 allocs/op +BenchmarkDecoder_Binding_Sonic-16 32557 ns/op 400.38 MB/s 28302 B/op 137 allocs/op +BenchmarkDecoder_Binding_Sonic_Fast-16 28649 ns/op 455.00 MB/s 24999 B/op 34 allocs/op +BenchmarkDecoder_Binding_StdLib-16 111437 ns/op 116.97 MB/s 10576 B/op 208 allocs/op +BenchmarkDecoder_Binding_JsonIter-16 35090 ns/op 371.48 MB/s 14673 B/op 385 allocs/op +BenchmarkDecoder_Binding_GoJson-16 28738 ns/op 453.59 MB/s 22039 B/op 49 allocs/op +BenchmarkDecoder_Parallel_Generic_Sonic-16 12321 ns/op 1057.91 MB/s 57233 B/op 723 allocs/op +BenchmarkDecoder_Parallel_Generic_Sonic_Fast-16 10644 ns/op 1224.64 MB/s 49362 B/op 313 allocs/op +BenchmarkDecoder_Parallel_Generic_StdLib-16 57587 ns/op 226.35 MB/s 50874 B/op 772 allocs/op +BenchmarkDecoder_Parallel_Generic_JsonIter-16 38666 ns/op 337.12 MB/s 55789 B/op 1068 allocs/op +BenchmarkDecoder_Parallel_Generic_GoJson-16 30259 ns/op 430.79 MB/s 66370 B/op 974 allocs/op +BenchmarkDecoder_Parallel_Binding_Sonic-16 5965 ns/op 2185.28 MB/s 27747 B/op 137 allocs/op +BenchmarkDecoder_Parallel_Binding_Sonic_Fast-16 5170 ns/op 2521.31 MB/s 24715 B/op 34 allocs/op +BenchmarkDecoder_Parallel_Binding_StdLib-16 27582 ns/op 472.58 MB/s 10576 B/op 208 allocs/op +BenchmarkDecoder_Parallel_Binding_JsonIter-16 13571 ns/op 960.51 MB/s 14685 B/op 385 allocs/op +BenchmarkDecoder_Parallel_Binding_GoJson-16 10031 ns/op 1299.51 MB/s 22111 B/op 49 allocs/op + +BenchmarkGetOne_Sonic-16 3276 ns/op 3975.78 MB/s 24 B/op 1 allocs/op +BenchmarkGetOne_Gjson-16 9431 ns/op 1380.81 MB/s 0 B/op 0 allocs/op +BenchmarkGetOne_Jsoniter-16 51178 ns/op 254.46 MB/s 27936 B/op 647 allocs/op +BenchmarkGetOne_Parallel_Sonic-16 216.7 ns/op 60098.95 MB/s 24 B/op 1 allocs/op +BenchmarkGetOne_Parallel_Gjson-16 1076 ns/op 12098.62 MB/s 0 B/op 0 allocs/op +BenchmarkGetOne_Parallel_Jsoniter-16 17741 ns/op 734.06 MB/s 27945 B/op 647 allocs/op +BenchmarkSetOne_Sonic-16 9571 ns/op 1360.61 MB/s 1584 B/op 17 allocs/op +BenchmarkSetOne_Sjson-16 36456 ns/op 357.22 MB/s 52180 B/op 9 allocs/op +BenchmarkSetOne_Jsoniter-16 79475 ns/op 163.86 MB/s 45862 B/op 964 allocs/op +BenchmarkSetOne_Parallel_Sonic-16 850.9 ns/op 15305.31 MB/s 1584 B/op 17 allocs/op +BenchmarkSetOne_Parallel_Sjson-16 18194 ns/op 715.77 MB/s 52247 B/op 9 allocs/op +BenchmarkSetOne_Parallel_Jsoniter-16 33560 ns/op 388.05 MB/s 45892 B/op 964 allocs/op +BenchmarkLoadNode/LoadAll()-16 11384 ns/op 1143.93 MB/s 6307 B/op 25 allocs/op +BenchmarkLoadNode_Parallel/LoadAll()-16 5493 ns/op 2370.68 MB/s 7145 B/op 25 allocs/op +BenchmarkLoadNode/Interface()-16 17722 ns/op 734.85 MB/s 13323 B/op 88 allocs/op +BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.70 MB/s 15178 B/op 88 allocs/op +``` + +- [小型](https://github.com/bytedance/sonic/blob/main/testdata/small.go) (400B, 11 个键, 3 层) +![small benchmarks](./docs/imgs/bench-small.png) +- [大型](https://github.com/bytedance/sonic/blob/main/testdata/twitter.json) (635kB, 10000+ 个键, 6 层) +![large benchmarks](./docs/imgs/bench-large.png) + +要查看基准测试代码,请参阅 [bench.sh](https://github.com/bytedance/sonic/blob/main/scripts/bench.sh) 。 + +## 工作原理 + +请参阅 [INTRODUCTION_ZH_CN.md](./docs/INTRODUCTION_ZH_CN.md). + +## 使用方式 + +### 序列化/反序列化 + +默认的行为基本上与 `encoding/json` 相一致,除了 HTML 转义形式(参见 [Escape HTML](https://github.com/bytedance/sonic/blob/main/README.md#escape-html)) 和 `SortKeys` 功能(参见 [Sort Keys](https://github.com/bytedance/sonic/blob/main/README.md#sort-keys))**没有**遵循 [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259) 。 + + ```go +import "github.com/bytedance/sonic" + +var data YourSchema +// Marshal +output, err := sonic.Marshal(&data) +// Unmarshal +err := sonic.Unmarshal(output, &data) + ``` + +### 流式输入输出 + +Sonic 支持解码 `io.Reader` 中输入的 json,或将对象编码为 json 后输出至 `io.Writer`,以处理多个值并减少内存消耗。 + +- 编码器 + +```go +var o1 = map[string]interface{}{ + "a": "b", +} +var o2 = 1 +var w = bytes.NewBuffer(nil) +var enc = sonic.ConfigDefault.NewEncoder(w) +enc.Encode(o1) +enc.Encode(o2) +fmt.Println(w.String()) +// Output: +// {"a":"b"} +// 1 +``` + +- 解码器 + +```go +var o = map[string]interface{}{} +var r = strings.NewReader(`{"a":"b"}{"1":"2"}`) +var dec = sonic.ConfigDefault.NewDecoder(r) +dec.Decode(&o) +dec.Decode(&o) +fmt.Printf("%+v", o) +// Output: +// map[1:2 a:b] +``` + +### 使用 `Number` / `int64` + +```go +import "github.com/bytedance/sonic/decoder" + +var input = `1` +var data interface{} + +// default float64 +dc := decoder.NewDecoder(input) +dc.Decode(&data) // data == float64(1) +// use json.Number +dc = decoder.NewDecoder(input) +dc.UseNumber() +dc.Decode(&data) // data == json.Number("1") +// use int64 +dc = decoder.NewDecoder(input) +dc.UseInt64() +dc.Decode(&data) // data == int64(1) + +root, err := sonic.GetFromString(input) +// Get json.Number +jn := root.Number() +jm := root.InterfaceUseNumber().(json.Number) // jn == jm +// Get float64 +fn := root.Float64() +fm := root.Interface().(float64) // jn == jm + ``` + +### 对键排序 + +考虑到排序带来的性能损失(约 10% ), sonic 默认不会启用这个功能。如果你的组件依赖这个行为(如 [zstd](https://github.com/facebook/zstd)) ,可以仿照下面的例子: + +```go +import "github.com/bytedance/sonic" +import "github.com/bytedance/sonic/encoder" + +// Binding map only +m := map[string]interface{}{} +v, err := encoder.Encode(m, encoder.SortMapKeys) + +// Or ast.Node.SortKeys() before marshal +var root := sonic.Get(JSON) +err := root.SortKeys() +``` + +### HTML 转义 + +考虑到性能损失(约15%), sonic 默认不会启用这个功能。你可以使用 `encoder.EscapeHTML` 选项来开启(与 `encoding/json.HTMLEscape` 行为一致)。 + +```go +import "github.com/bytedance/sonic" + +v := map[string]string{"&&":"<>"} +ret, err := Encode(v, EscapeHTML) // ret == `{"\u0026\u0026":{"X":"\u003c\u003e"}}` +``` + +### 紧凑格式 + +Sonic 默认将基本类型( `struct` , `map` 等)编码为紧凑格式的 JSON ,除非使用 `json.RawMessage` or `json.Marshaler` 进行编码: sonic 确保输出的 JSON 合法,但出于性能考虑,**不会**加工成紧凑格式。我们提供选项 `encoder.CompactMarshaler` 来添加此过程, + +### 打印错误 + +如果输入的 JSON 存在无效的语法,sonic 将返回 `decoder.SyntaxError`,该错误支持错误位置的美化输出。 + +```go +import "github.com/bytedance/sonic" +import "github.com/bytedance/sonic/decoder" + +var data interface{} +err := sonic.UnmarshalString("[[[}]]", &data) +if err != nil { + /* One line by default */ + println(e.Error()) // "Syntax error at index 3: invalid char\n\n\t[[[}]]\n\t...^..\n" + /* Pretty print */ + if e, ok := err.(decoder.SyntaxError); ok { + /*Syntax error at index 3: invalid char + + [[[}]] + ...^.. + */ + print(e.Description()) + } else if me, ok := err.(*decoder.MismatchTypeError); ok { + // decoder.MismatchTypeError is new to Sonic v1.6.0 + print(me.Description()) + } +} +``` + +#### 类型不匹配 [Sonic v1.6.0] + +如果给定键中存在**类型不匹配**的值, sonic 会抛出 `decoder.MismatchTypeError` (如果有多个,只会报告最后一个),但仍会跳过错误的值并解码下一个 JSON 。 + +```go +import "github.com/bytedance/sonic" +import "github.com/bytedance/sonic/decoder" + +var data = struct{ + A int + B int +}{} +err := UnmarshalString(`{"A":"1","B":1}`, &data) +println(err.Error()) // Mismatch type int with value string "at index 5: mismatched type with value\n\n\t{\"A\":\"1\",\"B\":1}\n\t.....^.........\n" +fmt.Printf("%+v", data) // {A:0 B:1} +``` + +### `Ast.Node` + +Sonic/ast.Node 是完全独立的 JSON 抽象语法树库。它实现了序列化和反序列化,并提供了获取和修改JSON数据的鲁棒的 API。 + +#### 查找/索引 + +通过给定的路径搜索 JSON 片段,路径必须为非负整数,字符串或 `nil` 。 + +```go +import "github.com/bytedance/sonic" + +input := []byte(`{"key1":[{},{"key2":{"key3":[1,2,3]}}]}`) + +// no path, returns entire json +root, err := sonic.Get(input) +raw := root.Raw() // == string(input) + +// multiple paths +root, err := sonic.Get(input, "key1", 1, "key2") +sub := root.Get("key3").Index(2).Int64() // == 3 +``` + +**注意**:由于 `Index()` 使用偏移量来定位数据,比使用扫描的 `Get()` 要快的多,建议尽可能的使用 `Index` 。 Sonic 也提供了另一个 API, `IndexOrGet()` ,以偏移量为基础并且也确保键的匹配。 + +#### 查找选项 + +`ast.Searcher`提供了一些选项,以满足用户的不同需求: + +```go +opts := ast.SearchOption{CopyReturn: true…} +val, err := sonic.GetWithOptions(JSON, opts, "key") +``` + +- CopyReturn +指示搜索器复制结果JSON字符串,而不是从输入引用。如果用户缓存结果,这有助于减少内存使用 +- ConcurentRead +因为`ast.Node`使用`Lazy-Load`设计,默认不支持并发读取。如果您想同时读取,请指定它。 +- ValidateJSON +指示搜索器来验证整个JSON。默认情况下启用该选项, 但是对于查找速度有一定影响。 + +#### 修改 + +使用 `Set()` / `Unset()` 修改 json 的内容 + +```go +import "github.com/bytedance/sonic" + +// Set +exist, err := root.Set("key4", NewBool(true)) // exist == false +alias1 := root.Get("key4") +println(alias1.Valid()) // true +alias2 := root.Index(1) +println(alias1 == alias2) // true + +// Unset +exist, err := root.UnsetByIndex(1) // exist == true +println(root.Get("key4").Check()) // "value not exist" +``` + +#### 序列化 + +要将 `ast.Node` 编码为 json ,使用 `MarshalJson()` 或者 `json.Marshal()` (必须传递指向节点的指针) + +```go +import ( + "encoding/json" + "github.com/bytedance/sonic" +) + +buf, err := root.MarshalJson() +println(string(buf)) // {"key1":[{},{"key2":{"key3":[1,2,3]}}]} +exp, err := json.Marshal(&root) // WARN: use pointer +println(string(buf) == string(exp)) // true +``` + +#### APIs + +- 合法性检查: `Check()`, `Error()`, `Valid()`, `Exist()` +- 索引: `Index()`, `Get()`, `IndexPair()`, `IndexOrGet()`, `GetByPath()` +- 转换至 go 内置类型: `Int64()`, `Float64()`, `String()`, `Number()`, `Bool()`, `Map[UseNumber|UseNode]()`, `Array[UseNumber|UseNode]()`, `Interface[UseNumber|UseNode]()` +- go 类型打包: `NewRaw()`, `NewNumber()`, `NewNull()`, `NewBool()`, `NewString()`, `NewObject()`, `NewArray()` +- 迭代: `Values()`, `Properties()`, `ForEach()`, `SortKeys()` +- 修改: `Set()`, `SetByIndex()`, `Add()` + +### `Ast.Visitor` + +Sonic 提供了一个高级的 API 用于直接全量解析 JSON 到非标准容器里 (既不是 `struct` 也不是 `map[string]interface{}`) 且不需要借助任何中间表示 (`ast.Node` 或 `interface{}`)。举个例子,你可能定义了下述的类型,它们看起来像 `interface{}`,但实际上并不是: + +```go +type UserNode interface {} + +// the following types implement the UserNode interface. +type ( + UserNull struct{} + UserBool struct{ Value bool } + UserInt64 struct{ Value int64 } + UserFloat64 struct{ Value float64 } + UserString struct{ Value string } + UserObject struct{ Value map[string]UserNode } + UserArray struct{ Value []UserNode } +) +``` + +Sonic 提供了下述的 API 来返回 **“对 JSON AST 的前序遍历”**。`ast.Visitor` 是一个 SAX 风格的接口,这在某些 C++ 的 JSON 解析库中被使用到。你需要自己实现一个 `ast.Visitor`,将它传递给 `ast.Preorder()` 方法。在你的实现中你可以使用自定义的类型来表示 JSON 的值。在你的 `ast.Visitor` 中,可能需要有一个 O(n) 空间复杂度的容器(比如说栈)来记录 object / array 的层级。 + +```go +func Preorder(str string, visitor Visitor, opts *VisitorOptions) error + +type Visitor interface { + OnNull() error + OnBool(v bool) error + OnString(v string) error + OnInt64(v int64, n json.Number) error + OnFloat64(v float64, n json.Number) error + OnObjectBegin(capacity int) error + OnObjectKey(key string) error + OnObjectEnd() error + OnArrayBegin(capacity int) error + OnArrayEnd() error +} +``` + +详细用法参看 [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go),我们还为 `UserNode` 实现了一个示例 `ast.Visitor`,你可以在 [ast/visitor_test.go](https://github.com/bytedance/sonic/blob/main/ast/visitor_test.go) 中找到它。 + +## 兼容性 + +对于想要使用sonic来满足不同场景的开发人员,我们提供了一些集成配置: + +- `ConfigDefault`: sonic的默认配置 (`EscapeHTML=false`, `SortKeys=false`…) 保证性能同时兼顾安全性。 +- `ConfigStd`: 与 `encoding/json` 保证完全兼容的配置 +- `ConfigFastest`: 最快的配置(`NoQuoteTextMarshaler=true...`) 保证性能最优但是会缺少一些安全性检查(validate UTF8 等) +Sonic **不**确保支持所有环境,由于开发高性能代码的困难。在不支持sonic的环境中,实现将回落到 `encoding/json`。因此上述配置将全部等于`ConfigStd`。 + +## 注意事项 + +### 预热 + +由于 Sonic 使用 [golang-asm](https://github.com/twitchyliquid64/golang-asm) 作为 JIT 汇编器,这个库并不适用于运行时编译,第一次运行一个大型模式可能会导致请求超时甚至进程内存溢出。为了更好地稳定性,我们建议在运行大型模式或在内存有限的应用中,在使用 `Marshal()/Unmarshal()` 前运行 `Pretouch()`。 + +```go +import ( + "reflect" + "github.com/bytedance/sonic" + "github.com/bytedance/sonic/option" +) + +func init() { + var v HugeStruct + + // For most large types (nesting depth <= option.DefaultMaxInlineDepth) + err := sonic.Pretouch(reflect.TypeOf(v)) + + // with more CompileOption... + err := sonic.Pretouch(reflect.TypeOf(v), + // If the type is too deep nesting (nesting depth > option.DefaultMaxInlineDepth), + // you can set compile recursive loops in Pretouch for better stability in JIT. + option.WithCompileRecursiveDepth(loop), + // For a large nested struct, try to set a smaller depth to reduce compiling time. + option.WithCompileMaxInlineDepth(depth), + ) +} +``` + +### 拷贝字符串 + +当解码 **没有转义字符的字符串**时, sonic 会从原始的 JSON 缓冲区内引用而不是复制到新的一个缓冲区中。这对 CPU 的性能方面很有帮助,但是可能因此在解码后对象仍在使用的时候将整个 JSON 缓冲区保留在内存中。实践中我们发现,通过引用 JSON 缓冲区引入的额外内存通常是解码后对象的 20% 至 80% ,一旦应用长期保留这些对象(如缓存以备重用),服务器所使用的内存可能会增加。我们提供了选项 `decoder.CopyString()` 供用户选择,不引用 JSON 缓冲区。这可能在一定程度上降低 CPU 性能。 + +### 传递字符串还是字节数组? + +为了和 `encoding/json` 保持一致,我们提供了传递 `[]byte` 作为参数的 API ,但考虑到安全性,字符串到字节的复制是同时进行的,这在原始 JSON 非常大时可能会导致性能损失。因此,你可以使用 `UnmarshalString()` 和 `GetFromString()` 来传递字符串,只要你的原始数据是字符串,或**零拷贝类型转换**对于你的字节数组是安全的。我们也提供了 `MarshalString()` 的 API ,以便对编码的 JSON 字节数组进行**零拷贝类型转换**,因为 sonic 输出的字节始终是重复并且唯一的,所以这样是安全的。 + +### 加速 `encoding.TextMarshaler` + +为了保证数据安全性, `sonic.Encoder` 默认会对来自 `encoding.TextMarshaler` 接口的字符串进行引用和转义,如果大部分数据都是这种形式那可能会导致很大的性能损失。我们提供了 `encoder.NoQuoteTextMarshaler` 选项来跳过这些操作,但你**必须**保证他们的输出字符串依照 [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259) 进行了转义和引用。 + +### 泛型的性能优化 + +在 **完全解析**的场景下, `Unmarshal()` 表现得比 `Get()`+`Node.Interface()` 更好。但是如果你只有特定 JSON 的部分模式,你可以将 `Get()` 和 `Unmarshal()` 结合使用: + +```go +import "github.com/bytedance/sonic" + +node, err := sonic.GetFromString(_TwitterJson, "statuses", 3, "user") +var user User // your partial schema... +err = sonic.UnmarshalString(node.Raw(), &user) +``` + +甚至如果你没有任何模式,可以用 `ast.Node` 代替 `map` 或 `interface` 作为泛型的容器: + +```go +import "github.com/bytedance/sonic" + +root, err := sonic.GetFromString(_TwitterJson) +user := root.GetByPath("statuses", 3, "user") // === root.Get("status").Index(3).Get("user") +err = user.Check() + +// err = user.LoadAll() // only call this when you want to use 'user' concurrently... +go someFunc(user) +``` + +为什么?因为 `ast.Node` 使用 `array` 来存储其子节点: + +- 在插入(反序列化)和扫描(序列化)数据时,`Array` 的性能比 `Map` **好得多**; +- **哈希**(`map[x]`)的效率不如**索引**(`array[x]`)高效,而 `ast.Node` 可以在数组和对象上使用索引; +- 使用 `Interface()` / `Map()` 意味着 sonic 必须解析所有的底层值,而 `ast.Node` 可以**按需解析**它们。 + +**注意**:由于 `ast.Node` 的惰性加载设计,其**不能**直接保证并发安全性,但你可以调用 `Node.Load()` / `Node.LoadAll()` 来实现并发安全。尽管可能会带来性能损失,但仍比转换成 `map` 或 `interface{}` 更为高效。 + +### 使用 `ast.Node` 还是 `ast.Visitor`? + +对于泛型数据的解析,`ast.Node` 在大多数场景上应该能够满足你的需求。 + +然而,`ast.Node` 是一种针对部分解析 JSON 而设计的泛型容器,它包含一些特殊设计,比如惰性加载,如果你希望像 `Unmarshal()` 那样直接解析整个 JSON,这些设计可能并不合适。尽管 `ast.Node` 相较于 `map` 或 `interface{}` 来说是更好的一种泛型容器,但它毕竟也是一种中间表示,如果你的最终类型是自定义的,你还得在解析完成后将上述类型转化成你自定义的类型。 + +在上述场景中,如果想要有更极致的性能,`ast.Visitor` 会是更好的选择。它采用和 `Unmarshal()` 类似的形式解析 JSON,并且你可以直接使用你的最终类型去表示 JSON AST,而不需要经过额外的任何中间表示。 + +但是,`ast.Visitor` 并不是一个很易用的 API。你可能需要写大量的代码去实现自己的 `ast.Visitor`,并且需要在解析过程中仔细维护树的层级。如果你决定要使用这个 API,请先仔细阅读 [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) 中的注释。 + +### 缓冲区大小 + +Sonic在许多地方使用内存池,如`encoder.Encode`, `ast.Node.MarshalJSON`等来提高性能,这可能会在服务器负载高时产生更多的内存使用(in-use)。参见[issue 614](https://github.com/bytedance/sonic/issues/614)。因此,我们引入了一些选项来让用户配置内存池的行为。参见[option](https://pkg.go.dev/github.com/bytedance/sonic@v1.11.9/option#pkg-variables)包。 + +### 更快的 JSON Skip + +为了安全起见,在跳过原始JSON 时,sonic decoder 默认使用[FSM](native/skip_one.c)算法扫描来跳过同时校验 JSON。它相比[SIMD-searching-pair](native/skip_one_fast.c)算法跳过要慢得多(1~10倍)。如果用户有很多冗余的JSON值,并且不需要严格验证JSON的正确性,你可以启用以下选项: + +- `Config.NoValidateSkipJSON`: 用于在解码时更快地跳过JSON,例如未知字段,`json.RawMessage`,不匹配的值和冗余的数组元素等 +- `Config.NoValidateJSONMarshaler`: 编码JSON时避免验证JSON。封送拆收器 +- `SearchOption.ValidateJSON`: 指示当`Get`时是否验证定位的JSON值 + +## 社区 + +Sonic 是 [CloudWeGo](https://www.cloudwego.io/) 下的一个子项目。我们致力于构建云原生生态系统。 diff --git a/vendor/github.com/bytedance/sonic/api.go b/vendor/github.com/bytedance/sonic/api.go new file mode 100644 index 00000000..406715ec --- /dev/null +++ b/vendor/github.com/bytedance/sonic/api.go @@ -0,0 +1,247 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package sonic + +import ( + `io` + + `github.com/bytedance/sonic/ast` + `github.com/bytedance/sonic/internal/rt` +) + +const ( + // UseStdJSON indicates you are using fallback implementation (encoding/json) + UseStdJSON = iota + // UseSonicJSON indicates you are using real sonic implementation + UseSonicJSON +) + +// APIKind is the kind of API, 0 is std json, 1 is sonic. +const APIKind = apiKind + +// Config is a combination of sonic/encoder.Options and sonic/decoder.Options +type Config struct { + // EscapeHTML indicates encoder to escape all HTML characters + // after serializing into JSON (see https://pkg.go.dev/encoding/json#HTMLEscape). + // WARNING: This hurts performance A LOT, USE WITH CARE. + EscapeHTML bool + + // SortMapKeys indicates encoder that the keys of a map needs to be sorted + // before serializing into JSON. + // WARNING: This hurts performance A LOT, USE WITH CARE. + SortMapKeys bool + + // CompactMarshaler indicates encoder that the output JSON from json.Marshaler + // is always compact and needs no validation + CompactMarshaler bool + + // NoQuoteTextMarshaler indicates encoder that the output text from encoding.TextMarshaler + // is always escaped string and needs no quoting + NoQuoteTextMarshaler bool + + // NoNullSliceOrMap indicates encoder that all empty Array or Object are encoded as '[]' or '{}', + // instead of 'null' + NoNullSliceOrMap bool + + // UseInt64 indicates decoder to unmarshal an integer into an interface{} as an + // int64 instead of as a float64. + UseInt64 bool + + // UseNumber indicates decoder to unmarshal a number into an interface{} as a + // json.Number instead of as a float64. + UseNumber bool + + // UseUnicodeErrors indicates decoder to return an error when encounter invalid + // UTF-8 escape sequences. + UseUnicodeErrors bool + + // DisallowUnknownFields indicates decoder to return an error when the destination + // is a struct and the input contains object keys which do not match any + // non-ignored, exported fields in the destination. + DisallowUnknownFields bool + + // CopyString indicates decoder to decode string values by copying instead of referring. + CopyString bool + + // ValidateString indicates decoder and encoder to validate string values: decoder will return errors + // when unescaped control chars(\u0000-\u001f) in the string value of JSON. + ValidateString bool + + // NoValidateJSONMarshaler indicates that the encoder should not validate the output string + // after encoding the JSONMarshaler to JSON. + NoValidateJSONMarshaler bool + + // NoValidateJSONSkip indicates the decoder should not validate the JSON value when skipping it, + // such as unknown-fields, mismatched-type, redundant elements.. + NoValidateJSONSkip bool + + // NoEncoderNewline indicates that the encoder should not add a newline after every message + NoEncoderNewline bool + + // Encode Infinity or Nan float into `null`, instead of returning an error. + EncodeNullForInfOrNan bool +} + +var ( + // ConfigDefault is the default config of APIs, aiming at efficiency and safety. + ConfigDefault = Config{}.Froze() + + // ConfigStd is the standard config of APIs, aiming at being compatible with encoding/json. + ConfigStd = Config{ + EscapeHTML : true, + SortMapKeys: true, + CompactMarshaler: true, + CopyString : true, + ValidateString : true, + }.Froze() + + // ConfigFastest is the fastest config of APIs, aiming at speed. + ConfigFastest = Config{ + NoQuoteTextMarshaler: true, + NoValidateJSONMarshaler: true, + NoValidateJSONSkip: true, + }.Froze() +) + + +// API is a binding of specific config. +// This interface is inspired by github.com/json-iterator/go, +// and has same behaviors under equivalent config. +type API interface { + // MarshalToString returns the JSON encoding string of v + MarshalToString(v interface{}) (string, error) + // Marshal returns the JSON encoding bytes of v. + Marshal(v interface{}) ([]byte, error) + // MarshalIndent returns the JSON encoding bytes with indent and prefix. + MarshalIndent(v interface{}, prefix, indent string) ([]byte, error) + // UnmarshalFromString parses the JSON-encoded bytes and stores the result in the value pointed to by v. + UnmarshalFromString(str string, v interface{}) error + // Unmarshal parses the JSON-encoded string and stores the result in the value pointed to by v. + Unmarshal(data []byte, v interface{}) error + // NewEncoder create a Encoder holding writer + NewEncoder(writer io.Writer) Encoder + // NewDecoder create a Decoder holding reader + NewDecoder(reader io.Reader) Decoder + // Valid validates the JSON-encoded bytes and reports if it is valid + Valid(data []byte) bool +} + +// Encoder encodes JSON into io.Writer +type Encoder interface { + // Encode writes the JSON encoding of v to the stream, followed by a newline character. + Encode(val interface{}) error + // SetEscapeHTML specifies whether problematic HTML characters + // should be escaped inside JSON quoted strings. + // The default behavior NOT ESCAPE + SetEscapeHTML(on bool) + // SetIndent instructs the encoder to format each subsequent encoded value + // as if indented by the package-level function Indent(dst, src, prefix, indent). + // Calling SetIndent("", "") disables indentation + SetIndent(prefix, indent string) +} + +// Decoder decodes JSON from io.Read +type Decoder interface { + // Decode reads the next JSON-encoded value from its input and stores it in the value pointed to by v. + Decode(val interface{}) error + // Buffered returns a reader of the data remaining in the Decoder's buffer. + // The reader is valid until the next call to Decode. + Buffered() io.Reader + // DisallowUnknownFields causes the Decoder to return an error when the destination is a struct + // and the input contains object keys which do not match any non-ignored, exported fields in the destination. + DisallowUnknownFields() + // More reports whether there is another element in the current array or object being parsed. + More() bool + // UseNumber causes the Decoder to unmarshal a number into an interface{} as a Number instead of as a float64. + UseNumber() +} + +// Marshal returns the JSON encoding bytes of v. +func Marshal(val interface{}) ([]byte, error) { + return ConfigDefault.Marshal(val) +} + +// MarshalIndent is like Marshal but applies Indent to format the output. +// Each JSON element in the output will begin on a new line beginning with prefix +// followed by one or more copies of indent according to the indentation nesting. +func MarshalIndent(v interface{}, prefix, indent string) ([]byte, error) { + return ConfigDefault.MarshalIndent(v, prefix, indent) +} + +// MarshalString returns the JSON encoding string of v. +func MarshalString(val interface{}) (string, error) { + return ConfigDefault.MarshalToString(val) +} + +// Unmarshal parses the JSON-encoded data and stores the result in the value pointed to by v. +// NOTICE: This API copies given buffer by default, +// if you want to pass JSON more efficiently, use UnmarshalString instead. +func Unmarshal(buf []byte, val interface{}) error { + return ConfigDefault.Unmarshal(buf, val) +} + +// UnmarshalString is like Unmarshal, except buf is a string. +func UnmarshalString(buf string, val interface{}) error { + return ConfigDefault.UnmarshalFromString(buf, val) +} + +// Get searches and locates the given path from src json, +// and returns a ast.Node representing the partially json. +// +// Each path arg must be integer or string: +// - Integer is target index(>=0), means searching current node as array. +// - String is target key, means searching current node as object. +// +// +// Notice: It expects the src json is **Well-formed** and **Immutable** when calling, +// otherwise it may return unexpected result. +// Considering memory safety, the returned JSON is **Copied** from the input +func Get(src []byte, path ...interface{}) (ast.Node, error) { + return GetCopyFromString(rt.Mem2Str(src), path...) +} + +//GetWithOptions searches and locates the given path from src json, +// with specific options of ast.Searcher +func GetWithOptions(src []byte, opts ast.SearchOptions, path ...interface{}) (ast.Node, error) { + s := ast.NewSearcher(rt.Mem2Str(src)) + s.SearchOptions = opts + return s.GetByPath(path...) +} + +// GetFromString is same with Get except src is string. +// +// WARNING: The returned JSON is **Referenced** from the input. +// Caching or long-time holding the returned node may cause OOM. +// If your src is big, consider use GetFromStringCopy(). +func GetFromString(src string, path ...interface{}) (ast.Node, error) { + return ast.NewSearcher(src).GetByPath(path...) +} + +// GetCopyFromString is same with Get except src is string +func GetCopyFromString(src string, path ...interface{}) (ast.Node, error) { + return ast.NewSearcher(src).GetByPathCopy(path...) +} + +// Valid reports whether data is a valid JSON encoding. +func Valid(data []byte) bool { + return ConfigDefault.Valid(data) +} + +// Valid reports whether data is a valid JSON encoding. +func ValidString(data string) bool { + return ConfigDefault.Valid(rt.Str2Mem(data)) +} diff --git a/vendor/github.com/bytedance/sonic/ast/api.go b/vendor/github.com/bytedance/sonic/ast/api.go new file mode 100644 index 00000000..36151f27 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/api.go @@ -0,0 +1,135 @@ +//go:build (amd64 && go1.17 && !go1.25) || (arm64 && go1.20 && !go1.25) +// +build amd64,go1.17,!go1.25 arm64,go1.20,!go1.25 + +/* + * Copyright 2022 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + `runtime` + `unsafe` + + `github.com/bytedance/sonic/encoder` + `github.com/bytedance/sonic/internal/native` + `github.com/bytedance/sonic/internal/native/types` + `github.com/bytedance/sonic/internal/rt` + uq `github.com/bytedance/sonic/unquote` + `github.com/bytedance/sonic/utf8` +) + +var typeByte = rt.UnpackEface(byte(0)).Type + +//go:nocheckptr +func quote(buf *[]byte, val string) { + *buf = append(*buf, '"') + if len(val) == 0 { + *buf = append(*buf, '"') + return + } + + sp := rt.IndexChar(val, 0) + nb := len(val) + b := (*rt.GoSlice)(unsafe.Pointer(buf)) + + // input buffer + for nb > 0 { + // output buffer + dp := unsafe.Pointer(uintptr(b.Ptr) + uintptr(b.Len)) + dn := b.Cap - b.Len + // call native.Quote, dn is byte count it outputs + ret := native.Quote(sp, nb, dp, &dn, 0) + // update *buf length + b.Len += dn + + // no need more output + if ret >= 0 { + break + } + + // double buf size + *b = rt.GrowSlice(typeByte, *b, b.Cap*2) + // ret is the complement of consumed input + ret = ^ret + // update input buffer + nb -= ret + sp = unsafe.Pointer(uintptr(sp) + uintptr(ret)) + } + + runtime.KeepAlive(buf) + runtime.KeepAlive(sp) + *buf = append(*buf, '"') +} + +func unquote(src string) (string, types.ParsingError) { + return uq.String(src) +} + +func (self *Parser) decodeValue() (val types.JsonState) { + sv := (*rt.GoString)(unsafe.Pointer(&self.s)) + flag := types.F_USE_NUMBER + if self.dbuf != nil { + flag = 0 + val.Dbuf = self.dbuf + val.Dcap = types.MaxDigitNums + } + self.p = native.Value(sv.Ptr, sv.Len, self.p, &val, uint64(flag)) + return +} + +func (self *Parser) skip() (int, types.ParsingError) { + fsm := types.NewStateMachine() + start := native.SkipOne(&self.s, &self.p, fsm, 0) + types.FreeStateMachine(fsm) + + if start < 0 { + return self.p, types.ParsingError(-start) + } + return start, 0 +} + +func (self *Node) encodeInterface(buf *[]byte) error { + //WARN: NOT compatible with json.Encoder + return encoder.EncodeInto(buf, self.packAny(), encoder.NoEncoderNewline) +} + +func (self *Parser) skipFast() (int, types.ParsingError) { + start := native.SkipOneFast(&self.s, &self.p) + if start < 0 { + return self.p, types.ParsingError(-start) + } + return start, 0 +} + +func (self *Parser) getByPath(validate bool, path ...interface{}) (int, types.ParsingError) { + var fsm *types.StateMachine + if validate { + fsm = types.NewStateMachine() + } + start := native.GetByPath(&self.s, &self.p, &path, fsm) + if validate { + types.FreeStateMachine(fsm) + } + runtime.KeepAlive(path) + if start < 0 { + return self.p, types.ParsingError(-start) + } + return start, 0 +} + +func validate_utf8(str string) bool { + return utf8.ValidateString(str) +} diff --git a/vendor/github.com/bytedance/sonic/ast/api_compat.go b/vendor/github.com/bytedance/sonic/ast/api_compat.go new file mode 100644 index 00000000..74119fed --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/api_compat.go @@ -0,0 +1,115 @@ +// +build !amd64,!arm64 go1.25 !go1.17 arm64,!go1.20 + +/* +* Copyright 2022 ByteDance Inc. +* +* Licensed under the Apache License, Version 2.0 (the "License"); +* you may not use this file except in compliance with the License. +* You may obtain a copy of the License at +* +* http://www.apache.org/licenses/LICENSE-2.0 +* +* Unless required by applicable law or agreed to in writing, software +* distributed under the License is distributed on an "AS IS" BASIS, +* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +* See the License for the specific language governing permissions and +* limitations under the License. +*/ + +package ast + +import ( + `encoding/json` + `unicode/utf8` + + `github.com/bytedance/sonic/internal/native/types` + `github.com/bytedance/sonic/internal/rt` + `github.com/bytedance/sonic/internal/compat` +) + +func init() { + compat.Warn("sonic/ast") +} + +func quote(buf *[]byte, val string) { + quoteString(buf, val) +} + +// unquote unescapes an internal JSON string (it doesn't count quotas at the beginning and end) +func unquote(src string) (string, types.ParsingError) { + sp := rt.IndexChar(src, -1) + out, ok := unquoteBytes(rt.BytesFrom(sp, len(src)+2, len(src)+2)) + if !ok { + return "", types.ERR_INVALID_ESCAPE + } + return rt.Mem2Str(out), 0 +} + + +func (self *Parser) decodeValue() (val types.JsonState) { + e, v := decodeValue(self.s, self.p, self.dbuf == nil) + if e < 0 { + return v + } + self.p = e + return v +} + +func (self *Parser) skip() (int, types.ParsingError) { + e, s := skipValue(self.s, self.p) + if e < 0 { + return self.p, types.ParsingError(-e) + } + self.p = e + return s, 0 +} + +func (self *Parser) skipFast() (int, types.ParsingError) { + e, s := skipValueFast(self.s, self.p) + if e < 0 { + return self.p, types.ParsingError(-e) + } + self.p = e + return s, 0 +} + +func (self *Node) encodeInterface(buf *[]byte) error { + out, err := json.Marshal(self.packAny()) + if err != nil { + return err + } + *buf = append(*buf, out...) + return nil +} + +func (self *Parser) getByPath(validate bool, path ...interface{}) (int, types.ParsingError) { + for _, p := range path { + if idx, ok := p.(int); ok && idx >= 0 { + if err := self.searchIndex(idx); err != 0 { + return self.p, err + } + } else if key, ok := p.(string); ok { + if err := self.searchKey(key); err != 0 { + return self.p, err + } + } else { + panic("path must be either int(>=0) or string") + } + } + + var start int + var e types.ParsingError + if validate { + start, e = self.skip() + } else { + start, e = self.skipFast() + } + if e != 0 { + return self.p, e + } + return start, 0 +} + +func validate_utf8(str string) bool { + return utf8.ValidString(str) +} diff --git a/vendor/github.com/bytedance/sonic/ast/asm.s b/vendor/github.com/bytedance/sonic/ast/asm.s new file mode 100644 index 00000000..e69de29b diff --git a/vendor/github.com/bytedance/sonic/ast/buffer.go b/vendor/github.com/bytedance/sonic/ast/buffer.go new file mode 100644 index 00000000..04701ef5 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/buffer.go @@ -0,0 +1,470 @@ +/** + * Copyright 2023 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + "sort" + "unsafe" + + "github.com/bytedance/sonic/internal/caching" +) + +type nodeChunk [_DEFAULT_NODE_CAP]Node + +type linkedNodes struct { + head nodeChunk + tail []*nodeChunk + size int +} + +func (self *linkedNodes) Cap() int { + if self == nil { + return 0 + } + return (len(self.tail)+1)*_DEFAULT_NODE_CAP +} + +func (self *linkedNodes) Len() int { + if self == nil { + return 0 + } + return self.size +} + +func (self *linkedNodes) At(i int) (*Node) { + if self == nil { + return nil + } + if i >= 0 && i= _DEFAULT_NODE_CAP && i= self.size || target < 0 || target >= self.size { + return + } + // reserve source + n := *self.At(source) + if source < target { + // move every element (source,target] one step back + for i:=source; itarget; i-- { + *self.At(i) = *self.At(i-1) + } + } + // set target + *self.At(target) = n +} + +func (self *linkedNodes) Pop() { + if self == nil || self.size == 0 { + return + } + self.Set(self.size-1, Node{}) + self.size-- +} + +func (self *linkedNodes) Push(v Node) { + self.Set(self.size, v) +} + + +func (self *linkedNodes) Set(i int, v Node) { + if i < _DEFAULT_NODE_CAP { + self.head[i] = v + if self.size <= i { + self.size = i+1 + } + return + } + a, b := i/_DEFAULT_NODE_CAP-1, i%_DEFAULT_NODE_CAP + if a < 0 { + self.head[b] = v + } else { + self.growTailLength(a+1) + var n = &self.tail[a] + if *n == nil { + *n = new(nodeChunk) + } + (*n)[b] = v + } + if self.size <= i { + self.size = i+1 + } +} + +func (self *linkedNodes) growTailLength(l int) { + if l <= len(self.tail) { + return + } + c := cap(self.tail) + for c < l { + c += 1 + c>>_APPEND_GROW_SHIFT + } + if c == cap(self.tail) { + self.tail = self.tail[:l] + return + } + tmp := make([]*nodeChunk, l, c) + copy(tmp, self.tail) + self.tail = tmp +} + +func (self *linkedNodes) ToSlice(con []Node) { + if len(con) < self.size { + return + } + i := (self.size-1) + a, b := i/_DEFAULT_NODE_CAP-1, i%_DEFAULT_NODE_CAP + if a < 0 { + copy(con, self.head[:b+1]) + return + } else { + copy(con, self.head[:]) + con = con[_DEFAULT_NODE_CAP:] + } + + for i:=0; i>_APPEND_GROW_SHIFT + self.tail = make([]*nodeChunk, a+1, c) + } + self.tail = self.tail[:a+1] + + for i:=0; i= 0 && i < _DEFAULT_NODE_CAP && i= _DEFAULT_NODE_CAP && i>_APPEND_GROW_SHIFT + } + if c == cap(self.tail) { + self.tail = self.tail[:l] + return + } + tmp := make([]*pairChunk, l, c) + copy(tmp, self.tail) + self.tail = tmp +} + +// linear search +func (self *linkedPairs) Get(key string) (*Pair, int) { + if self.index != nil { + // fast-path + i, ok := self.index[caching.StrHash(key)] + if ok { + n := self.At(i) + if n.Key == key { + return n, i + } + // hash conflicts + goto linear_search + } else { + return nil, -1 + } + } +linear_search: + for i:=0; i>_APPEND_GROW_SHIFT + self.tail = make([]*pairChunk, a+1, c) + } + self.tail = self.tail[:a+1] + + for i:=0; i len(b) { + l = len(b) + } + for i := d; i < l; i++ { + if a[i] == b[i] { + continue + } + return a[i] < b[i] + } + return len(a) < len(b) +} + +type parseObjectStack struct { + parser Parser + v linkedPairs +} + +type parseArrayStack struct { + parser Parser + v linkedNodes +} + +func newLazyArray(p *Parser) Node { + s := new(parseArrayStack) + s.parser = *p + return Node{ + t: _V_ARRAY_LAZY, + p: unsafe.Pointer(s), + } +} + +func newLazyObject(p *Parser) Node { + s := new(parseObjectStack) + s.parser = *p + return Node{ + t: _V_OBJECT_LAZY, + p: unsafe.Pointer(s), + } +} + +func (self *Node) getParserAndArrayStack() (*Parser, *parseArrayStack) { + stack := (*parseArrayStack)(self.p) + return &stack.parser, stack +} + +func (self *Node) getParserAndObjectStack() (*Parser, *parseObjectStack) { + stack := (*parseObjectStack)(self.p) + return &stack.parser, stack +} + diff --git a/vendor/github.com/bytedance/sonic/ast/decode.go b/vendor/github.com/bytedance/sonic/ast/decode.go new file mode 100644 index 00000000..135ee6eb --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/decode.go @@ -0,0 +1,562 @@ +/* + * Copyright 2022 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + "encoding/base64" + "runtime" + "strconv" + "unsafe" + + "github.com/bytedance/sonic/internal/native/types" + "github.com/bytedance/sonic/internal/rt" + "github.com/bytedance/sonic/internal/utils" +) + +// Hack: this is used for both checking space and cause friendly compile errors in 32-bit arch. +const _Sonic_Not_Support_32Bit_Arch__Checking_32Bit_Arch_Here = (1 << ' ') | (1 << '\t') | (1 << '\r') | (1 << '\n') + +var bytesNull = []byte("null") + +const ( + strNull = "null" + bytesTrue = "true" + bytesFalse = "false" + bytesObject = "{}" + bytesArray = "[]" +) + +func isSpace(c byte) bool { + return (int(1<= se { + return -int(types.ERR_EOF) + } + runtime.KeepAlive(src) + return int(sp - uintptr(rt.IndexChar(src, 0))) +} + +func decodeNull(src string, pos int) (ret int) { + ret = pos + 4 + if ret > len(src) { + return -int(types.ERR_EOF) + } + if src[pos:ret] == strNull { + return ret + } else { + return -int(types.ERR_INVALID_CHAR) + } +} + +func decodeTrue(src string, pos int) (ret int) { + ret = pos + 4 + if ret > len(src) { + return -int(types.ERR_EOF) + } + if src[pos:ret] == bytesTrue { + return ret + } else { + return -int(types.ERR_INVALID_CHAR) + } + +} + +func decodeFalse(src string, pos int) (ret int) { + ret = pos + 5 + if ret > len(src) { + return -int(types.ERR_EOF) + } + if src[pos:ret] == bytesFalse { + return ret + } + return -int(types.ERR_INVALID_CHAR) +} + +//go:nocheckptr +func decodeString(src string, pos int) (ret int, v string) { + ret, ep := skipString(src, pos) + if ep == -1 { + (*rt.GoString)(unsafe.Pointer(&v)).Ptr = rt.IndexChar(src, pos+1) + (*rt.GoString)(unsafe.Pointer(&v)).Len = ret - pos - 2 + return ret, v + } + + vv, ok := unquoteBytes(rt.Str2Mem(src[pos:ret])) + if !ok { + return -int(types.ERR_INVALID_CHAR), "" + } + + runtime.KeepAlive(src) + return ret, rt.Mem2Str(vv) +} + +func decodeBinary(src string, pos int) (ret int, v []byte) { + var vv string + ret, vv = decodeString(src, pos) + if ret < 0 { + return ret, nil + } + var err error + v, err = base64.StdEncoding.DecodeString(vv) + if err != nil { + return -int(types.ERR_INVALID_CHAR), nil + } + return ret, v +} + +func isDigit(c byte) bool { + return c >= '0' && c <= '9' +} + +//go:nocheckptr +func decodeInt64(src string, pos int) (ret int, v int64, err error) { + sp := uintptr(rt.IndexChar(src, pos)) + ss := uintptr(sp) + se := uintptr(rt.IndexChar(src, len(src))) + if uintptr(sp) >= se { + return -int(types.ERR_EOF), 0, nil + } + + if c := *(*byte)(unsafe.Pointer(sp)); c == '-' { + sp += 1 + } + if sp == se { + return -int(types.ERR_EOF), 0, nil + } + + for ; sp < se; sp += uintptr(1) { + if !isDigit(*(*byte)(unsafe.Pointer(sp))) { + break + } + } + + if sp < se { + if c := *(*byte)(unsafe.Pointer(sp)); c == '.' || c == 'e' || c == 'E' { + return -int(types.ERR_INVALID_NUMBER_FMT), 0, nil + } + } + + var vv string + ret = int(uintptr(sp) - uintptr((*rt.GoString)(unsafe.Pointer(&src)).Ptr)) + (*rt.GoString)(unsafe.Pointer(&vv)).Ptr = unsafe.Pointer(ss) + (*rt.GoString)(unsafe.Pointer(&vv)).Len = ret - pos + + v, err = strconv.ParseInt(vv, 10, 64) + if err != nil { + //NOTICE: allow overflow here + if err.(*strconv.NumError).Err == strconv.ErrRange { + return ret, 0, err + } + return -int(types.ERR_INVALID_CHAR), 0, err + } + + runtime.KeepAlive(src) + return ret, v, nil +} + +func isNumberChars(c byte) bool { + return (c >= '0' && c <= '9') || c == '+' || c == '-' || c == 'e' || c == 'E' || c == '.' +} + +//go:nocheckptr +func decodeFloat64(src string, pos int) (ret int, v float64, err error) { + sp := uintptr(rt.IndexChar(src, pos)) + ss := uintptr(sp) + se := uintptr(rt.IndexChar(src, len(src))) + if uintptr(sp) >= se { + return -int(types.ERR_EOF), 0, nil + } + + if c := *(*byte)(unsafe.Pointer(sp)); c == '-' { + sp += 1 + } + if sp == se { + return -int(types.ERR_EOF), 0, nil + } + + for ; sp < se; sp += uintptr(1) { + if !isNumberChars(*(*byte)(unsafe.Pointer(sp))) { + break + } + } + + var vv string + ret = int(uintptr(sp) - uintptr((*rt.GoString)(unsafe.Pointer(&src)).Ptr)) + (*rt.GoString)(unsafe.Pointer(&vv)).Ptr = unsafe.Pointer(ss) + (*rt.GoString)(unsafe.Pointer(&vv)).Len = ret - pos + + v, err = strconv.ParseFloat(vv, 64) + if err != nil { + //NOTICE: allow overflow here + if err.(*strconv.NumError).Err == strconv.ErrRange { + return ret, 0, err + } + return -int(types.ERR_INVALID_CHAR), 0, err + } + + runtime.KeepAlive(src) + return ret, v, nil +} + +func decodeValue(src string, pos int, skipnum bool) (ret int, v types.JsonState) { + pos = skipBlank(src, pos) + if pos < 0 { + return pos, types.JsonState{Vt: types.ValueType(pos)} + } + switch c := src[pos]; c { + case 'n': + ret = decodeNull(src, pos) + if ret < 0 { + return ret, types.JsonState{Vt: types.ValueType(ret)} + } + return ret, types.JsonState{Vt: types.V_NULL} + case '"': + var ep int + ret, ep = skipString(src, pos) + if ret < 0 { + return ret, types.JsonState{Vt: types.ValueType(ret)} + } + return ret, types.JsonState{Vt: types.V_STRING, Iv: int64(pos + 1), Ep: ep} + case '{': + return pos + 1, types.JsonState{Vt: types.V_OBJECT} + case '[': + return pos + 1, types.JsonState{Vt: types.V_ARRAY} + case 't': + ret = decodeTrue(src, pos) + if ret < 0 { + return ret, types.JsonState{Vt: types.ValueType(ret)} + } + return ret, types.JsonState{Vt: types.V_TRUE} + case 'f': + ret = decodeFalse(src, pos) + if ret < 0 { + return ret, types.JsonState{Vt: types.ValueType(ret)} + } + return ret, types.JsonState{Vt: types.V_FALSE} + case '-', '+', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + if skipnum { + ret = skipNumber(src, pos) + if ret >= 0 { + return ret, types.JsonState{Vt: types.V_DOUBLE, Iv: 0, Ep: pos} + } else { + return ret, types.JsonState{Vt: types.ValueType(ret)} + } + } else { + var iv int64 + ret, iv, _ = decodeInt64(src, pos) + if ret >= 0 { + return ret, types.JsonState{Vt: types.V_INTEGER, Iv: iv, Ep: pos} + } else if ret != -int(types.ERR_INVALID_NUMBER_FMT) { + return ret, types.JsonState{Vt: types.ValueType(ret)} + } + var fv float64 + ret, fv, _ = decodeFloat64(src, pos) + if ret >= 0 { + return ret, types.JsonState{Vt: types.V_DOUBLE, Dv: fv, Ep: pos} + } else { + return ret, types.JsonState{Vt: types.ValueType(ret)} + } + } + + default: + return -int(types.ERR_INVALID_CHAR), types.JsonState{Vt:-types.ValueType(types.ERR_INVALID_CHAR)} + } +} + +//go:nocheckptr +func skipNumber(src string, pos int) (ret int) { + return utils.SkipNumber(src, pos) +} + +//go:nocheckptr +func skipString(src string, pos int) (ret int, ep int) { + if pos+1 >= len(src) { + return -int(types.ERR_EOF), -1 + } + + sp := uintptr(rt.IndexChar(src, pos)) + se := uintptr(rt.IndexChar(src, len(src))) + + // not start with quote + if *(*byte)(unsafe.Pointer(sp)) != '"' { + return -int(types.ERR_INVALID_CHAR), -1 + } + sp += 1 + + ep = -1 + for sp < se { + c := *(*byte)(unsafe.Pointer(sp)) + if c == '\\' { + if ep == -1 { + ep = int(uintptr(sp) - uintptr((*rt.GoString)(unsafe.Pointer(&src)).Ptr)) + } + sp += 2 + continue + } + sp += 1 + if c == '"' { + return int(uintptr(sp) - uintptr((*rt.GoString)(unsafe.Pointer(&src)).Ptr)), ep + } + } + + runtime.KeepAlive(src) + // not found the closed quote until EOF + return -int(types.ERR_EOF), -1 +} + +//go:nocheckptr +func skipPair(src string, pos int, lchar byte, rchar byte) (ret int) { + if pos+1 >= len(src) { + return -int(types.ERR_EOF) + } + + sp := uintptr(rt.IndexChar(src, pos)) + se := uintptr(rt.IndexChar(src, len(src))) + + if *(*byte)(unsafe.Pointer(sp)) != lchar { + return -int(types.ERR_INVALID_CHAR) + } + + sp += 1 + nbrace := 1 + inquote := false + + for sp < se { + c := *(*byte)(unsafe.Pointer(sp)) + if c == '\\' { + sp += 2 + continue + } else if c == '"' { + inquote = !inquote + } else if c == lchar { + if !inquote { + nbrace += 1 + } + } else if c == rchar { + if !inquote { + nbrace -= 1 + if nbrace == 0 { + sp += 1 + break + } + } + } + sp += 1 + } + + if nbrace != 0 { + return -int(types.ERR_INVALID_CHAR) + } + + runtime.KeepAlive(src) + return int(uintptr(sp) - uintptr((*rt.GoString)(unsafe.Pointer(&src)).Ptr)) +} + +func skipValueFast(src string, pos int) (ret int, start int) { + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + switch c := src[pos]; c { + case 'n': + ret = decodeNull(src, pos) + case '"': + ret, _ = skipString(src, pos) + case '{': + ret = skipPair(src, pos, '{', '}') + case '[': + ret = skipPair(src, pos, '[', ']') + case 't': + ret = decodeTrue(src, pos) + case 'f': + ret = decodeFalse(src, pos) + case '-', '+', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + ret = skipNumber(src, pos) + default: + ret = -int(types.ERR_INVALID_CHAR) + } + return ret, pos +} + +func skipValue(src string, pos int) (ret int, start int) { + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + switch c := src[pos]; c { + case 'n': + ret = decodeNull(src, pos) + case '"': + ret, _ = skipString(src, pos) + case '{': + ret, _ = skipObject(src, pos) + case '[': + ret, _ = skipArray(src, pos) + case 't': + ret = decodeTrue(src, pos) + case 'f': + ret = decodeFalse(src, pos) + case '-', '+', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + ret = skipNumber(src, pos) + default: + ret = -int(types.ERR_INVALID_CHAR) + } + return ret, pos +} + +func skipObject(src string, pos int) (ret int, start int) { + start = skipBlank(src, pos) + if start < 0 { + return start, -1 + } + + if src[start] != '{' { + return -int(types.ERR_INVALID_CHAR), -1 + } + + pos = start + 1 + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + if src[pos] == '}' { + return pos + 1, start + } + + for { + pos, _ = skipString(src, pos) + if pos < 0 { + return pos, -1 + } + + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + if src[pos] != ':' { + return -int(types.ERR_INVALID_CHAR), -1 + } + + pos++ + pos, _ = skipValue(src, pos) + if pos < 0 { + return pos, -1 + } + + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + if src[pos] == '}' { + return pos + 1, start + } + if src[pos] != ',' { + return -int(types.ERR_INVALID_CHAR), -1 + } + + pos++ + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + + } +} + +func skipArray(src string, pos int) (ret int, start int) { + start = skipBlank(src, pos) + if start < 0 { + return start, -1 + } + + if src[start] != '[' { + return -int(types.ERR_INVALID_CHAR), -1 + } + + pos = start + 1 + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + if src[pos] == ']' { + return pos + 1, start + } + + for { + pos, _ = skipValue(src, pos) + if pos < 0 { + return pos, -1 + } + + pos = skipBlank(src, pos) + if pos < 0 { + return pos, -1 + } + if src[pos] == ']' { + return pos + 1, start + } + if src[pos] != ',' { + return -int(types.ERR_INVALID_CHAR), -1 + } + pos++ + } +} + +// DecodeString decodes a JSON string from pos and return golang string. +// - needEsc indicates if to unescaped escaping chars +// - hasEsc tells if the returned string has escaping chars +// - validStr enables validating UTF8 charset +// +func _DecodeString(src string, pos int, needEsc bool, validStr bool) (v string, ret int, hasEsc bool) { + p := NewParserObj(src) + p.p = pos + switch val := p.decodeValue(); val.Vt { + case types.V_STRING: + str := p.s[val.Iv : p.p-1] + if validStr && !validate_utf8(str) { + return "", -int(types.ERR_INVALID_UTF8), false + } + /* fast path: no escape sequence */ + if val.Ep == -1 { + return str, p.p, false + } else if !needEsc { + return str, p.p, true + } + /* unquote the string */ + out, err := unquote(str) + /* check for errors */ + if err != 0 { + return "", -int(err), true + } else { + return out, p.p, true + } + default: + return "", -int(_ERR_UNSUPPORT_TYPE), false + } +} diff --git a/vendor/github.com/bytedance/sonic/ast/encode.go b/vendor/github.com/bytedance/sonic/ast/encode.go new file mode 100644 index 00000000..eae0bd25 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/encode.go @@ -0,0 +1,274 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + "sync" + "unicode/utf8" + + "github.com/bytedance/sonic/internal/rt" + "github.com/bytedance/sonic/option" +) + +func quoteString(e *[]byte, s string) { + *e = append(*e, '"') + start := 0 + for i := 0; i < len(s); { + if b := s[i]; b < utf8.RuneSelf { + if rt.SafeSet[b] { + i++ + continue + } + if start < i { + *e = append(*e, s[start:i]...) + } + *e = append(*e, '\\') + switch b { + case '\\', '"': + *e = append(*e, b) + case '\n': + *e = append(*e, 'n') + case '\r': + *e = append(*e, 'r') + case '\t': + *e = append(*e, 't') + default: + // This encodes bytes < 0x20 except for \t, \n and \r. + // If escapeHTML is set, it also escapes <, >, and & + // because they can lead to security holes when + // user-controlled strings are rendered into JSON + // and served to some browsers. + *e = append(*e, `u00`...) + *e = append(*e, rt.Hex[b>>4]) + *e = append(*e, rt.Hex[b&0xF]) + } + i++ + start = i + continue + } + c, size := utf8.DecodeRuneInString(s[i:]) + // if c == utf8.RuneError && size == 1 { + // if start < i { + // e.Write(s[start:i]) + // } + // e.WriteString(`\ufffd`) + // i += size + // start = i + // continue + // } + if c == '\u2028' || c == '\u2029' { + if start < i { + *e = append(*e, s[start:i]...) + } + *e = append(*e, `\u202`...) + *e = append(*e, rt.Hex[c&0xF]) + i += size + start = i + continue + } + i += size + } + if start < len(s) { + *e = append(*e, s[start:]...) + } + *e = append(*e, '"') +} + +var bytesPool = sync.Pool{} + +func (self *Node) MarshalJSON() ([]byte, error) { + if self == nil { + return bytesNull, nil + } + + buf := newBuffer() + err := self.encode(buf) + if err != nil { + freeBuffer(buf) + return nil, err + } + var ret []byte + if !rt.CanSizeResue(cap(*buf)) { + ret = *buf + } else { + ret = make([]byte, len(*buf)) + copy(ret, *buf) + freeBuffer(buf) + } + return ret, err +} + +func newBuffer() *[]byte { + if ret := bytesPool.Get(); ret != nil { + return ret.(*[]byte) + } else { + buf := make([]byte, 0, option.DefaultAstBufferSize) + return &buf + } +} + +func freeBuffer(buf *[]byte) { + if !rt.CanSizeResue(cap(*buf)) { + return + } + *buf = (*buf)[:0] + bytesPool.Put(buf) +} + +func (self *Node) encode(buf *[]byte) error { + if self.isRaw() { + return self.encodeRaw(buf) + } + switch int(self.itype()) { + case V_NONE : return ErrNotExist + case V_ERROR : return self.Check() + case V_NULL : return self.encodeNull(buf) + case V_TRUE : return self.encodeTrue(buf) + case V_FALSE : return self.encodeFalse(buf) + case V_ARRAY : return self.encodeArray(buf) + case V_OBJECT: return self.encodeObject(buf) + case V_STRING: return self.encodeString(buf) + case V_NUMBER: return self.encodeNumber(buf) + case V_ANY : return self.encodeInterface(buf) + default : return ErrUnsupportType + } +} + +func (self *Node) encodeRaw(buf *[]byte) error { + lock := self.rlock() + if !self.isRaw() { + self.runlock() + return self.encode(buf) + } + raw := self.toString() + if lock { + self.runlock() + } + *buf = append(*buf, raw...) + return nil +} + +func (self *Node) encodeNull(buf *[]byte) error { + *buf = append(*buf, strNull...) + return nil +} + +func (self *Node) encodeTrue(buf *[]byte) error { + *buf = append(*buf, bytesTrue...) + return nil +} + +func (self *Node) encodeFalse(buf *[]byte) error { + *buf = append(*buf, bytesFalse...) + return nil +} + +func (self *Node) encodeNumber(buf *[]byte) error { + str := self.toString() + *buf = append(*buf, str...) + return nil +} + +func (self *Node) encodeString(buf *[]byte) error { + if self.l == 0 { + *buf = append(*buf, '"', '"') + return nil + } + + quote(buf, self.toString()) + return nil +} + +func (self *Node) encodeArray(buf *[]byte) error { + if self.isLazy() { + if err := self.skipAllIndex(); err != nil { + return err + } + } + + nb := self.len() + if nb == 0 { + *buf = append(*buf, bytesArray...) + return nil + } + + *buf = append(*buf, '[') + + var started bool + for i := 0; i < nb; i++ { + n := self.nodeAt(i) + if !n.Exists() { + continue + } + if started { + *buf = append(*buf, ',') + } + started = true + if err := n.encode(buf); err != nil { + return err + } + } + + *buf = append(*buf, ']') + return nil +} + +func (self *Pair) encode(buf *[]byte) error { + if len(*buf) == 0 { + *buf = append(*buf, '"', '"', ':') + return self.Value.encode(buf) + } + + quote(buf, self.Key) + *buf = append(*buf, ':') + + return self.Value.encode(buf) +} + +func (self *Node) encodeObject(buf *[]byte) error { + if self.isLazy() { + if err := self.skipAllKey(); err != nil { + return err + } + } + + nb := self.len() + if nb == 0 { + *buf = append(*buf, bytesObject...) + return nil + } + + *buf = append(*buf, '{') + + var started bool + for i := 0; i < nb; i++ { + n := self.pairAt(i) + if n == nil || !n.Value.Exists() { + continue + } + if started { + *buf = append(*buf, ',') + } + started = true + if err := n.encode(buf); err != nil { + return err + } + } + + *buf = append(*buf, '}') + return nil +} diff --git a/vendor/github.com/bytedance/sonic/ast/error.go b/vendor/github.com/bytedance/sonic/ast/error.go new file mode 100644 index 00000000..3716e7a9 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/error.go @@ -0,0 +1,134 @@ +package ast + +import ( + `fmt` + `strings` + `unsafe` + + `github.com/bytedance/sonic/internal/native/types` +) + + +func newError(err types.ParsingError, msg string) *Node { + return &Node{ + t: V_ERROR, + l: uint(err), + p: unsafe.Pointer(&msg), + } +} + +func newErrorPair(err SyntaxError) *Pair { + return &Pair{0, "", *newSyntaxError(err)} +} + +// Error returns error message if the node is invalid +func (self Node) Error() string { + if self.t != V_ERROR { + return "" + } else { + return *(*string)(self.p) + } +} + +func newSyntaxError(err SyntaxError) *Node { + msg := err.Description() + return &Node{ + t: V_ERROR, + l: uint(err.Code), + p: unsafe.Pointer(&msg), + } +} + +func (self *Parser) syntaxError(err types.ParsingError) SyntaxError { + return SyntaxError{ + Pos : self.p, + Src : self.s, + Code: err, + } +} + +func unwrapError(err error) *Node { + if se, ok := err.(*Node); ok { + return se + }else if sse, ok := err.(Node); ok { + return &sse + } else { + msg := err.Error() + return &Node{ + t: V_ERROR, + p: unsafe.Pointer(&msg), + } + } +} + +type SyntaxError struct { + Pos int + Src string + Code types.ParsingError + Msg string +} + +func (self SyntaxError) Error() string { + return fmt.Sprintf("%q", self.Description()) +} + +func (self SyntaxError) Description() string { + return "Syntax error " + self.description() +} + +func (self SyntaxError) description() string { + i := 16 + p := self.Pos - i + q := self.Pos + i + + /* check for empty source */ + if self.Src == "" { + return fmt.Sprintf("no sources available, the input json is empty: %#v", self) + } + + /* prevent slicing before the beginning */ + if p < 0 { + p, q, i = 0, q - p, i + p + } + + /* prevent slicing beyond the end */ + if n := len(self.Src); q > n { + n = q - n + q = len(self.Src) + + /* move the left bound if possible */ + if p > n { + i += n + p -= n + } + } + + /* left and right length */ + x := clamp_zero(i) + y := clamp_zero(q - p - i - 1) + + /* compose the error description */ + return fmt.Sprintf( + "at index %d: %s\n\n\t%s\n\t%s^%s\n", + self.Pos, + self.Message(), + self.Src[p:q], + strings.Repeat(".", x), + strings.Repeat(".", y), + ) +} + +func (self SyntaxError) Message() string { + if self.Msg == "" { + return self.Code.Message() + } + return self.Msg +} + +func clamp_zero(v int) int { + if v < 0 { + return 0 + } else { + return v + } +} diff --git a/vendor/github.com/bytedance/sonic/ast/iterator.go b/vendor/github.com/bytedance/sonic/ast/iterator.go new file mode 100644 index 00000000..1052dd0a --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/iterator.go @@ -0,0 +1,216 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + "fmt" + + "github.com/bytedance/sonic/internal/caching" + "github.com/bytedance/sonic/internal/native/types" +) + +type Pair struct { + hash uint64 + Key string + Value Node +} + +func NewPair(key string, val Node) Pair { + return Pair{ + hash: caching.StrHash(key), + Key: key, + Value: val, + } +} + +// Values returns iterator for array's children traversal +func (self *Node) Values() (ListIterator, error) { + if err := self.should(types.V_ARRAY); err != nil { + return ListIterator{}, err + } + return self.values(), nil +} + +func (self *Node) values() ListIterator { + return ListIterator{Iterator{p: self}} +} + +// Properties returns iterator for object's children traversal +func (self *Node) Properties() (ObjectIterator, error) { + if err := self.should(types.V_OBJECT); err != nil { + return ObjectIterator{}, err + } + return self.properties(), nil +} + +func (self *Node) properties() ObjectIterator { + return ObjectIterator{Iterator{p: self}} +} + +type Iterator struct { + i int + p *Node +} + +func (self *Iterator) Pos() int { + return self.i +} + +func (self *Iterator) Len() int { + return self.p.len() +} + +// HasNext reports if it is the end of iteration or has error. +func (self *Iterator) HasNext() bool { + if !self.p.isLazy() { + return self.p.Valid() && self.i < self.p.len() + } else if self.p.t == _V_ARRAY_LAZY { + return self.p.skipNextNode().Valid() + } else if self.p.t == _V_OBJECT_LAZY { + pair := self.p.skipNextPair() + if pair == nil { + return false + } + return pair.Value.Valid() + } + return false +} + +// ListIterator is specialized iterator for V_ARRAY +type ListIterator struct { + Iterator +} + +// ObjectIterator is specialized iterator for V_ARRAY +type ObjectIterator struct { + Iterator +} + +func (self *ListIterator) next() *Node { +next_start: + if !self.HasNext() { + return nil + } else { + n := self.p.nodeAt(self.i) + self.i++ + if !n.Exists() { + goto next_start + } + return n + } +} + +// Next scans through children of underlying V_ARRAY, +// copies each child to v, and returns .HasNext(). +func (self *ListIterator) Next(v *Node) bool { + n := self.next() + if n == nil { + return false + } + *v = *n + return true +} + +func (self *ObjectIterator) next() *Pair { +next_start: + if !self.HasNext() { + return nil + } else { + n := self.p.pairAt(self.i) + self.i++ + if n == nil || !n.Value.Exists() { + goto next_start + } + return n + } +} + +// Next scans through children of underlying V_OBJECT, +// copies each child to v, and returns .HasNext(). +func (self *ObjectIterator) Next(p *Pair) bool { + n := self.next() + if n == nil { + return false + } + *p = *n + return true +} + +// Sequence represents scanning path of single-layer nodes. +// Index indicates the value's order in both V_ARRAY and V_OBJECT json. +// Key is the value's key (for V_OBJECT json only, otherwise it will be nil). +type Sequence struct { + Index int + Key *string + // Level int +} + +// String is string representation of one Sequence +func (s Sequence) String() string { + k := "" + if s.Key != nil { + k = *s.Key + } + return fmt.Sprintf("Sequence(%d, %q)", s.Index, k) +} + +type Scanner func(path Sequence, node *Node) bool + +// ForEach scans one V_OBJECT node's children from JSON head to tail, +// and pass the Sequence and Node of corresponding JSON value. +// +// Especially, if the node is not V_ARRAY or V_OBJECT, +// the node itself will be returned and Sequence.Index == -1. +// +// NOTICE: A unsetted node WON'T trigger sc, but its index still counts into Path.Index +func (self *Node) ForEach(sc Scanner) error { + if err := self.checkRaw(); err != nil { + return err + } + switch self.itype() { + case types.V_ARRAY: + iter, err := self.Values() + if err != nil { + return err + } + v := iter.next() + for v != nil { + if !sc(Sequence{iter.i-1, nil}, v) { + return nil + } + v = iter.next() + } + case types.V_OBJECT: + iter, err := self.Properties() + if err != nil { + return err + } + v := iter.next() + for v != nil { + if !sc(Sequence{iter.i-1, &v.Key}, &v.Value) { + return nil + } + v = iter.next() + } + default: + if self.Check() != nil { + return self + } + sc(Sequence{-1, nil}, self) + } + return nil +} diff --git a/vendor/github.com/bytedance/sonic/ast/node.go b/vendor/github.com/bytedance/sonic/ast/node.go new file mode 100644 index 00000000..17964c32 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/node.go @@ -0,0 +1,1843 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + "encoding/json" + "fmt" + "strconv" + "sync" + "sync/atomic" + "unsafe" + + "github.com/bytedance/sonic/internal/native/types" + "github.com/bytedance/sonic/internal/rt" +) + +const ( + _V_NONE types.ValueType = 0 + _V_NODE_BASE types.ValueType = 1 << 5 + _V_LAZY types.ValueType = 1 << 7 + _V_RAW types.ValueType = 1 << 8 + _V_NUMBER = _V_NODE_BASE + 1 + _V_ANY = _V_NODE_BASE + 2 + _V_ARRAY_LAZY = _V_LAZY | types.V_ARRAY + _V_OBJECT_LAZY = _V_LAZY | types.V_OBJECT + _MASK_LAZY = _V_LAZY - 1 + _MASK_RAW = _V_RAW - 1 +) + +const ( + V_NONE = 0 + V_ERROR = 1 + V_NULL = int(types.V_NULL) + V_TRUE = int(types.V_TRUE) + V_FALSE = int(types.V_FALSE) + V_ARRAY = int(types.V_ARRAY) + V_OBJECT = int(types.V_OBJECT) + V_STRING = int(types.V_STRING) + V_NUMBER = int(_V_NUMBER) + V_ANY = int(_V_ANY) +) + +type Node struct { + t types.ValueType + l uint + p unsafe.Pointer + m *sync.RWMutex +} + +// UnmarshalJSON is just an adapter to json.Unmarshaler. +// If you want better performance, use Searcher.GetByPath() directly +func (self *Node) UnmarshalJSON(data []byte) (err error) { + *self = NewRaw(string(data)) + return self.Check() +} + +/** Node Type Accessor **/ + +// Type returns json type represented by the node +// It will be one of bellows: +// V_NONE = 0 (empty node, key not exists) +// V_ERROR = 1 (error node) +// V_NULL = 2 (json value `null`, key exists) +// V_TRUE = 3 (json value `true`) +// V_FALSE = 4 (json value `false`) +// V_ARRAY = 5 (json value array) +// V_OBJECT = 6 (json value object) +// V_STRING = 7 (json value string) +// V_NUMBER = 33 (json value number ) +// V_ANY = 34 (golang interface{}) +// +// Deprecated: not concurrent safe. Use TypeSafe instead +func (self Node) Type() int { + return int(self.t & _MASK_LAZY & _MASK_RAW) +} + +// Type concurrently-safe returns json type represented by the node +// It will be one of bellows: +// V_NONE = 0 (empty node, key not exists) +// V_ERROR = 1 (error node) +// V_NULL = 2 (json value `null`, key exists) +// V_TRUE = 3 (json value `true`) +// V_FALSE = 4 (json value `false`) +// V_ARRAY = 5 (json value array) +// V_OBJECT = 6 (json value object) +// V_STRING = 7 (json value string) +// V_NUMBER = 33 (json value number ) +// V_ANY = 34 (golang interface{}) +func (self *Node) TypeSafe() int { + return int(self.loadt() & _MASK_LAZY & _MASK_RAW) +} + +func (self *Node) itype() types.ValueType { + return self.t & _MASK_LAZY & _MASK_RAW +} + +// Exists returns false only if the self is nil or empty node V_NONE +func (self *Node) Exists() bool { + if self == nil { + return false + } + t := self.loadt() + return t != V_ERROR && t != _V_NONE +} + +// Valid reports if self is NOT V_ERROR or nil +func (self *Node) Valid() bool { + if self == nil { + return false + } + return self.loadt() != V_ERROR +} + +// Check checks if the node itself is valid, and return: +// - ErrNotExist If the node is nil +// - Its underlying error If the node is V_ERROR +func (self *Node) Check() error { + if self == nil { + return ErrNotExist + } else if self.loadt() != V_ERROR { + return nil + } else { + return self + } +} + +// isRaw returns true if node's underlying value is raw json +// +// Deprecated: not concurrent safe +func (self Node) IsRaw() bool { + return self.t & _V_RAW != 0 +} + +// IsRaw returns true if node's underlying value is raw json +func (self *Node) isRaw() bool { + return self.loadt() & _V_RAW != 0 +} + +func (self *Node) isLazy() bool { + return self != nil && self.t & _V_LAZY != 0 +} + +func (self *Node) isAny() bool { + return self != nil && self.loadt() == _V_ANY +} + +/** Simple Value Methods **/ + +// Raw returns json representation of the node, +func (self *Node) Raw() (string, error) { + if self == nil { + return "", ErrNotExist + } + lock := self.rlock() + if !self.isRaw() { + if lock { + self.runlock() + } + buf, err := self.MarshalJSON() + return rt.Mem2Str(buf), err + } + ret := self.toString() + if lock { + self.runlock() + } + return ret, nil +} + +func (self *Node) checkRaw() error { + if err := self.Check(); err != nil { + return err + } + if self.isRaw() { + self.parseRaw(false) + } + return self.Check() +} + +// Bool returns bool value represented by this node, +// including types.V_TRUE|V_FALSE|V_NUMBER|V_STRING|V_ANY|V_NULL, +// V_NONE will return error +func (self *Node) Bool() (bool, error) { + if err := self.checkRaw(); err != nil { + return false, err + } + switch self.t { + case types.V_TRUE : return true , nil + case types.V_FALSE : return false, nil + case types.V_NULL : return false, nil + case _V_NUMBER : + if i, err := self.toInt64(); err == nil { + return i != 0, nil + } else if f, err := self.toFloat64(); err == nil { + return f != 0, nil + } else { + return false, err + } + case types.V_STRING: return strconv.ParseBool(self.toString()) + case _V_ANY : + any := self.packAny() + switch v := any.(type) { + case bool : return v, nil + case int : return v != 0, nil + case int8 : return v != 0, nil + case int16 : return v != 0, nil + case int32 : return v != 0, nil + case int64 : return v != 0, nil + case uint : return v != 0, nil + case uint8 : return v != 0, nil + case uint16 : return v != 0, nil + case uint32 : return v != 0, nil + case uint64 : return v != 0, nil + case float32: return v != 0, nil + case float64: return v != 0, nil + case string : return strconv.ParseBool(v) + case json.Number: + if i, err := v.Int64(); err == nil { + return i != 0, nil + } else if f, err := v.Float64(); err == nil { + return f != 0, nil + } else { + return false, err + } + default: return false, ErrUnsupportType + } + default : return false, ErrUnsupportType + } +} + +// Int64 casts the node to int64 value, +// including V_NUMBER|V_TRUE|V_FALSE|V_ANY|V_STRING +// V_NONE it will return error +func (self *Node) Int64() (int64, error) { + if err := self.checkRaw(); err != nil { + return 0, err + } + switch self.t { + case _V_NUMBER, types.V_STRING : + if i, err := self.toInt64(); err == nil { + return i, nil + } else if f, err := self.toFloat64(); err == nil { + return int64(f), nil + } else { + return 0, err + } + case types.V_TRUE : return 1, nil + case types.V_FALSE : return 0, nil + case types.V_NULL : return 0, nil + case _V_ANY : + any := self.packAny() + switch v := any.(type) { + case bool : if v { return 1, nil } else { return 0, nil } + case int : return int64(v), nil + case int8 : return int64(v), nil + case int16 : return int64(v), nil + case int32 : return int64(v), nil + case int64 : return int64(v), nil + case uint : return int64(v), nil + case uint8 : return int64(v), nil + case uint16 : return int64(v), nil + case uint32 : return int64(v), nil + case uint64 : return int64(v), nil + case float32: return int64(v), nil + case float64: return int64(v), nil + case string : + if i, err := strconv.ParseInt(v, 10, 64); err == nil { + return i, nil + } else if f, err := strconv.ParseFloat(v, 64); err == nil { + return int64(f), nil + } else { + return 0, err + } + case json.Number: + if i, err := v.Int64(); err == nil { + return i, nil + } else if f, err := v.Float64(); err == nil { + return int64(f), nil + } else { + return 0, err + } + default: return 0, ErrUnsupportType + } + default : return 0, ErrUnsupportType + } +} + +// StrictInt64 exports underlying int64 value, including V_NUMBER, V_ANY +func (self *Node) StrictInt64() (int64, error) { + if err := self.checkRaw(); err != nil { + return 0, err + } + switch self.t { + case _V_NUMBER : return self.toInt64() + case _V_ANY : + any := self.packAny() + switch v := any.(type) { + case int : return int64(v), nil + case int8 : return int64(v), nil + case int16 : return int64(v), nil + case int32 : return int64(v), nil + case int64 : return int64(v), nil + case uint : return int64(v), nil + case uint8 : return int64(v), nil + case uint16: return int64(v), nil + case uint32: return int64(v), nil + case uint64: return int64(v), nil + case json.Number: + if i, err := v.Int64(); err == nil { + return i, nil + } else { + return 0, err + } + default: return 0, ErrUnsupportType + } + default : return 0, ErrUnsupportType + } +} + +func castNumber(v bool) json.Number { + if v { + return json.Number("1") + } else { + return json.Number("0") + } +} + +// Number casts node to float64, +// including V_NUMBER|V_TRUE|V_FALSE|V_ANY|V_STRING|V_NULL, +// V_NONE it will return error +func (self *Node) Number() (json.Number, error) { + if err := self.checkRaw(); err != nil { + return json.Number(""), err + } + switch self.t { + case _V_NUMBER : return self.toNumber(), nil + case types.V_STRING : + if _, err := self.toInt64(); err == nil { + return self.toNumber(), nil + } else if _, err := self.toFloat64(); err == nil { + return self.toNumber(), nil + } else { + return json.Number(""), err + } + case types.V_TRUE : return json.Number("1"), nil + case types.V_FALSE : return json.Number("0"), nil + case types.V_NULL : return json.Number("0"), nil + case _V_ANY : + any := self.packAny() + switch v := any.(type) { + case bool : return castNumber(v), nil + case int : return castNumber(v != 0), nil + case int8 : return castNumber(v != 0), nil + case int16 : return castNumber(v != 0), nil + case int32 : return castNumber(v != 0), nil + case int64 : return castNumber(v != 0), nil + case uint : return castNumber(v != 0), nil + case uint8 : return castNumber(v != 0), nil + case uint16 : return castNumber(v != 0), nil + case uint32 : return castNumber(v != 0), nil + case uint64 : return castNumber(v != 0), nil + case float32: return castNumber(v != 0), nil + case float64: return castNumber(v != 0), nil + case string : + if _, err := strconv.ParseFloat(v, 64); err == nil { + return json.Number(v), nil + } else { + return json.Number(""), err + } + case json.Number: return v, nil + default: return json.Number(""), ErrUnsupportType + } + default : return json.Number(""), ErrUnsupportType + } +} + +// Number exports underlying float64 value, including V_NUMBER, V_ANY of json.Number +func (self *Node) StrictNumber() (json.Number, error) { + if err := self.checkRaw(); err != nil { + return json.Number(""), err + } + switch self.t { + case _V_NUMBER : return self.toNumber() , nil + case _V_ANY : + if v, ok := self.packAny().(json.Number); ok { + return v, nil + } else { + return json.Number(""), ErrUnsupportType + } + default : return json.Number(""), ErrUnsupportType + } +} + +// String cast node to string, +// including V_NUMBER|V_TRUE|V_FALSE|V_ANY|V_STRING|V_NULL, +// V_NONE it will return error +func (self *Node) String() (string, error) { + if err := self.checkRaw(); err != nil { + return "", err + } + switch self.t { + case types.V_NULL : return "" , nil + case types.V_TRUE : return "true" , nil + case types.V_FALSE : return "false", nil + case types.V_STRING, _V_NUMBER : return self.toString(), nil + case _V_ANY : + any := self.packAny() + switch v := any.(type) { + case bool : return strconv.FormatBool(v), nil + case int : return strconv.Itoa(v), nil + case int8 : return strconv.Itoa(int(v)), nil + case int16 : return strconv.Itoa(int(v)), nil + case int32 : return strconv.Itoa(int(v)), nil + case int64 : return strconv.Itoa(int(v)), nil + case uint : return strconv.Itoa(int(v)), nil + case uint8 : return strconv.Itoa(int(v)), nil + case uint16 : return strconv.Itoa(int(v)), nil + case uint32 : return strconv.Itoa(int(v)), nil + case uint64 : return strconv.Itoa(int(v)), nil + case float32: return strconv.FormatFloat(float64(v), 'g', -1, 64), nil + case float64: return strconv.FormatFloat(float64(v), 'g', -1, 64), nil + case string : return v, nil + case json.Number: return v.String(), nil + default: return "", ErrUnsupportType + } + default : return "" , ErrUnsupportType + } +} + +// StrictString returns string value (unescaped), including V_STRING, V_ANY of string. +// In other cases, it will return empty string. +func (self *Node) StrictString() (string, error) { + if err := self.checkRaw(); err != nil { + return "", err + } + switch self.t { + case types.V_STRING : return self.toString(), nil + case _V_ANY : + if v, ok := self.packAny().(string); ok { + return v, nil + } else { + return "", ErrUnsupportType + } + default : return "", ErrUnsupportType + } +} + +// Float64 cast node to float64, +// including V_NUMBER|V_TRUE|V_FALSE|V_ANY|V_STRING|V_NULL, +// V_NONE it will return error +func (self *Node) Float64() (float64, error) { + if err := self.checkRaw(); err != nil { + return 0.0, err + } + switch self.t { + case _V_NUMBER, types.V_STRING : return self.toFloat64() + case types.V_TRUE : return 1.0, nil + case types.V_FALSE : return 0.0, nil + case types.V_NULL : return 0.0, nil + case _V_ANY : + any := self.packAny() + switch v := any.(type) { + case bool : + if v { + return 1.0, nil + } else { + return 0.0, nil + } + case int : return float64(v), nil + case int8 : return float64(v), nil + case int16 : return float64(v), nil + case int32 : return float64(v), nil + case int64 : return float64(v), nil + case uint : return float64(v), nil + case uint8 : return float64(v), nil + case uint16 : return float64(v), nil + case uint32 : return float64(v), nil + case uint64 : return float64(v), nil + case float32: return float64(v), nil + case float64: return float64(v), nil + case string : + if f, err := strconv.ParseFloat(v, 64); err == nil { + return float64(f), nil + } else { + return 0, err + } + case json.Number: + if f, err := v.Float64(); err == nil { + return float64(f), nil + } else { + return 0, err + } + default : return 0, ErrUnsupportType + } + default : return 0.0, ErrUnsupportType + } +} + +// Float64 exports underlying float64 value, including V_NUMBER, V_ANY +func (self *Node) StrictFloat64() (float64, error) { + if err := self.checkRaw(); err != nil { + return 0.0, err + } + switch self.t { + case _V_NUMBER : return self.toFloat64() + case _V_ANY : + any := self.packAny() + switch v := any.(type) { + case float32 : return float64(v), nil + case float64 : return float64(v), nil + default : return 0, ErrUnsupportType + } + default : return 0.0, ErrUnsupportType + } +} + +/** Sequential Value Methods **/ + +// Len returns children count of a array|object|string node +// WARN: For partially loaded node, it also works but only counts the parsed children +func (self *Node) Len() (int, error) { + if err := self.checkRaw(); err != nil { + return 0, err + } + if self.t == types.V_ARRAY || self.t == types.V_OBJECT || self.t == _V_ARRAY_LAZY || self.t == _V_OBJECT_LAZY || self.t == types.V_STRING { + return int(self.l), nil + } else if self.t == _V_NONE || self.t == types.V_NULL { + return 0, nil + } else { + return 0, ErrUnsupportType + } +} + +func (self *Node) len() int { + return int(self.l) +} + +// Cap returns malloc capacity of a array|object node for children +func (self *Node) Cap() (int, error) { + if err := self.checkRaw(); err != nil { + return 0, err + } + switch self.t { + case types.V_ARRAY: return (*linkedNodes)(self.p).Cap(), nil + case types.V_OBJECT: return (*linkedPairs)(self.p).Cap(), nil + case _V_ARRAY_LAZY: return (*parseArrayStack)(self.p).v.Cap(), nil + case _V_OBJECT_LAZY: return (*parseObjectStack)(self.p).v.Cap(), nil + case _V_NONE, types.V_NULL: return 0, nil + default: return 0, ErrUnsupportType + } +} + +// Set sets the node of given key under self, and reports if the key has existed. +// +// If self is V_NONE or V_NULL, it becomes V_OBJECT and sets the node at the key. +func (self *Node) Set(key string, node Node) (bool, error) { + if err := self.checkRaw(); err != nil { + return false, err + } + if err := node.Check(); err != nil { + return false, err + } + + if self.t == _V_NONE || self.t == types.V_NULL { + *self = NewObject([]Pair{NewPair(key, node)}) + return false, nil + } else if self.itype() != types.V_OBJECT { + return false, ErrUnsupportType + } + + p := self.Get(key) + + if !p.Exists() { + // self must be fully-loaded here + if self.len() == 0 { + *self = newObject(new(linkedPairs)) + } + s := (*linkedPairs)(self.p) + s.Push(NewPair(key, node)) + self.l++ + return false, nil + + } else if err := p.Check(); err != nil { + return false, err + } + + *p = node + return true, nil +} + +// SetAny wraps val with V_ANY node, and Set() the node. +func (self *Node) SetAny(key string, val interface{}) (bool, error) { + return self.Set(key, NewAny(val)) +} + +// Unset REMOVE (soft) the node of given key under object parent, and reports if the key has existed. +func (self *Node) Unset(key string) (bool, error) { + if err := self.should(types.V_OBJECT); err != nil { + return false, err + } + // NOTICE: must get accurate length before deduct + if err := self.skipAllKey(); err != nil { + return false, err + } + p, i := self.skipKey(key) + if !p.Exists() { + return false, nil + } else if err := p.Check(); err != nil { + return false, err + } + self.removePairAt(i) + return true, nil +} + +// SetByIndex sets the node of given index, and reports if the key has existed. +// +// The index must be within self's children. +func (self *Node) SetByIndex(index int, node Node) (bool, error) { + if err := self.checkRaw(); err != nil { + return false, err + } + if err := node.Check(); err != nil { + return false, err + } + + if index == 0 && (self.t == _V_NONE || self.t == types.V_NULL) { + *self = NewArray([]Node{node}) + return false, nil + } + + p := self.Index(index) + if !p.Exists() { + return false, ErrNotExist + } else if err := p.Check(); err != nil { + return false, err + } + + *p = node + return true, nil +} + +// SetAny wraps val with V_ANY node, and SetByIndex() the node. +func (self *Node) SetAnyByIndex(index int, val interface{}) (bool, error) { + return self.SetByIndex(index, NewAny(val)) +} + +// UnsetByIndex REMOVE (softly) the node of given index. +// +// WARN: this will change address of elements, which is a dangerous action. +// Use Unset() for object or Pop() for array instead. +func (self *Node) UnsetByIndex(index int) (bool, error) { + if err := self.checkRaw(); err != nil { + return false, err + } + + var p *Node + it := self.itype() + + if it == types.V_ARRAY { + if err := self.skipAllIndex(); err != nil { + return false, err + } + p = self.nodeAt(index) + } else if it == types.V_OBJECT { + if err := self.skipAllKey(); err != nil { + return false, err + } + pr := self.pairAt(index) + if pr == nil { + return false, ErrNotExist + } + p = &pr.Value + } else { + return false, ErrUnsupportType + } + + if !p.Exists() { + return false, ErrNotExist + } + + // last elem + if index == self.len() - 1 { + return true, self.Pop() + } + + // not last elem, self.len() change but linked-chunk not change + if it == types.V_ARRAY { + self.removeNode(index) + }else if it == types.V_OBJECT { + self.removePair(index) + } + return true, nil +} + +// Add appends the given node under self. +// +// If self is V_NONE or V_NULL, it becomes V_ARRAY and sets the node at index 0. +func (self *Node) Add(node Node) error { + if err := self.checkRaw(); err != nil { + return err + } + + if self != nil && (self.t == _V_NONE || self.t == types.V_NULL) { + *self = NewArray([]Node{node}) + return nil + } + if err := self.should(types.V_ARRAY); err != nil { + return err + } + + s, err := self.unsafeArray() + if err != nil { + return err + } + + // Notice: array won't have unset node in tail + s.Push(node) + self.l++ + return nil +} + +// Pop remove the last child of the V_Array or V_Object node. +func (self *Node) Pop() error { + if err := self.checkRaw(); err != nil { + return err + } + + if it := self.itype(); it == types.V_ARRAY { + s, err := self.unsafeArray() + if err != nil { + return err + } + // remove tail unset nodes + for i := s.Len()-1; i >= 0; i-- { + if s.At(i).Exists() { + s.Pop() + self.l-- + break + } + s.Pop() + } + + } else if it == types.V_OBJECT { + s, err := self.unsafeMap() + if err != nil { + return err + } + // remove tail unset nodes + for i := s.Len()-1; i >= 0; i-- { + if p := s.At(i); p != nil && p.Value.Exists() { + s.Pop() + self.l-- + break + } + s.Pop() + } + + } else { + return ErrUnsupportType + } + + return nil +} + +// Move moves the child at src index to dst index, +// meanwhile slides sliblings from src+1 to dst. +// +// WARN: this will change address of elements, which is a dangerous action. +func (self *Node) Move(dst, src int) error { + if err := self.should(types.V_ARRAY); err != nil { + return err + } + + s, err := self.unsafeArray() + if err != nil { + return err + } + + // check if any unset node exists + if l := s.Len(); self.len() != l { + di, si := dst, src + // find real pos of src and dst + for i := 0; i < l; i++ { + if s.At(i).Exists() { + di-- + si-- + } + if di == -1 { + dst = i + di-- + } + if si == -1 { + src = i + si-- + } + if di == -2 && si == -2 { + break + } + } + } + + s.MoveOne(src, dst) + return nil +} + +// SetAny wraps val with V_ANY node, and Add() the node. +func (self *Node) AddAny(val interface{}) error { + return self.Add(NewAny(val)) +} + +// GetByPath load given path on demands, +// which only ensure nodes before this path got parsed. +// +// Note, the api expects the json is well-formed at least, +// otherwise it may return unexpected result. +func (self *Node) GetByPath(path ...interface{}) *Node { + if !self.Valid() { + return self + } + var s = self + for _, p := range path { + switch p := p.(type) { + case int: + s = s.Index(p) + if !s.Valid() { + return s + } + case string: + s = s.Get(p) + if !s.Valid() { + return s + } + default: + panic("path must be either int or string") + } + } + return s +} + +// Get loads given key of an object node on demands +func (self *Node) Get(key string) *Node { + if err := self.should(types.V_OBJECT); err != nil { + return unwrapError(err) + } + n, _ := self.skipKey(key) + return n +} + +// Index indexies node at given idx, +// node type CAN be either V_OBJECT or V_ARRAY +func (self *Node) Index(idx int) *Node { + if err := self.checkRaw(); err != nil { + return unwrapError(err) + } + + it := self.itype() + if it == types.V_ARRAY { + return self.skipIndex(idx) + + }else if it == types.V_OBJECT { + pr := self.skipIndexPair(idx) + if pr == nil { + return newError(_ERR_NOT_FOUND, "value not exists") + } + return &pr.Value + + } else { + return newError(_ERR_UNSUPPORT_TYPE, fmt.Sprintf("unsupported type: %v", self.itype())) + } +} + +// IndexPair indexies pair at given idx, +// node type MUST be either V_OBJECT +func (self *Node) IndexPair(idx int) *Pair { + if err := self.should(types.V_OBJECT); err != nil { + return nil + } + return self.skipIndexPair(idx) +} + +func (self *Node) indexOrGet(idx int, key string) (*Node, int) { + if err := self.should(types.V_OBJECT); err != nil { + return unwrapError(err), idx + } + + pr := self.skipIndexPair(idx) + if pr != nil && pr.Key == key { + return &pr.Value, idx + } + + return self.skipKey(key) +} + +// IndexOrGet firstly use idx to index a value and check if its key matches +// If not, then use the key to search value +func (self *Node) IndexOrGet(idx int, key string) *Node { + node, _ := self.indexOrGet(idx, key) + return node +} + +// IndexOrGetWithIdx attempts to retrieve a node by index and key, returning the node and its correct index. +// If the key does not match at the given index, it searches by key and returns the node with its updated index. +func (self *Node) IndexOrGetWithIdx(idx int, key string) (*Node, int) { + return self.indexOrGet(idx, key) +} + +/** Generic Value Converters **/ + +// Map loads all keys of an object node +func (self *Node) Map() (map[string]interface{}, error) { + if self.isAny() { + any := self.packAny() + if v, ok := any.(map[string]interface{}); ok { + return v, nil + } else { + return nil, ErrUnsupportType + } + } + if err := self.should(types.V_OBJECT); err != nil { + return nil, err + } + if err := self.loadAllKey(false); err != nil { + return nil, err + } + return self.toGenericObject() +} + +// MapUseNumber loads all keys of an object node, with numeric nodes casted to json.Number +func (self *Node) MapUseNumber() (map[string]interface{}, error) { + if self.isAny() { + any := self.packAny() + if v, ok := any.(map[string]interface{}); ok { + return v, nil + } else { + return nil, ErrUnsupportType + } + } + if err := self.should(types.V_OBJECT); err != nil { + return nil, err + } + if err := self.loadAllKey(false); err != nil { + return nil, err + } + return self.toGenericObjectUseNumber() +} + +// MapUseNode scans both parsed and non-parsed children nodes, +// and map them by their keys +func (self *Node) MapUseNode() (map[string]Node, error) { + if self.isAny() { + any := self.packAny() + if v, ok := any.(map[string]Node); ok { + return v, nil + } else { + return nil, ErrUnsupportType + } + } + if err := self.should(types.V_OBJECT); err != nil { + return nil, err + } + if err := self.skipAllKey(); err != nil { + return nil, err + } + return self.toGenericObjectUseNode() +} + +// MapUnsafe exports the underlying pointer to its children map +// WARN: don't use it unless you know what you are doing +// +// Deprecated: this API now returns copied nodes instead of directly reference, +// func (self *Node) UnsafeMap() ([]Pair, error) { +// if err := self.should(types.V_OBJECT, "an object"); err != nil { +// return nil, err +// } +// if err := self.skipAllKey(); err != nil { +// return nil, err +// } +// return self.toGenericObjectUsePair() +// } + +//go:nocheckptr +func (self *Node) unsafeMap() (*linkedPairs, error) { + if err := self.skipAllKey(); err != nil { + return nil, err + } + if self.p == nil { + *self = newObject(new(linkedPairs)) + } + return (*linkedPairs)(self.p), nil +} + +// SortKeys sorts children of a V_OBJECT node in ascending key-order. +// If recurse is true, it recursively sorts children's children as long as a V_OBJECT node is found. +func (self *Node) SortKeys(recurse bool) error { + // check raw node first + if err := self.checkRaw(); err != nil { + return err + } + if self.itype() == types.V_OBJECT { + return self.sortKeys(recurse) + } else if self.itype() == types.V_ARRAY { + var err error + err2 := self.ForEach(func(path Sequence, node *Node) bool { + it := node.itype() + if it == types.V_ARRAY || it == types.V_OBJECT { + err = node.SortKeys(recurse) + if err != nil { + return false + } + } + return true + }) + if err != nil { + return err + } + return err2 + } else { + return nil + } +} + +func (self *Node) sortKeys(recurse bool) (err error) { + // check raw node first + if err := self.checkRaw(); err != nil { + return err + } + ps, err := self.unsafeMap() + if err != nil { + return err + } + ps.Sort() + if recurse { + var sc Scanner + sc = func(path Sequence, node *Node) bool { + if node.itype() == types.V_OBJECT { + if err := node.sortKeys(recurse); err != nil { + return false + } + } + if node.itype() == types.V_ARRAY { + if err := node.ForEach(sc); err != nil { + return false + } + } + return true + } + if err := self.ForEach(sc); err != nil { + return err + } + } + return nil +} + +// Array loads all indexes of an array node +func (self *Node) Array() ([]interface{}, error) { + if self.isAny() { + any := self.packAny() + if v, ok := any.([]interface{}); ok { + return v, nil + } else { + return nil, ErrUnsupportType + } + } + if err := self.should(types.V_ARRAY); err != nil { + return nil, err + } + if err := self.loadAllIndex(false); err != nil { + return nil, err + } + return self.toGenericArray() +} + +// ArrayUseNumber loads all indexes of an array node, with numeric nodes casted to json.Number +func (self *Node) ArrayUseNumber() ([]interface{}, error) { + if self.isAny() { + any := self.packAny() + if v, ok := any.([]interface{}); ok { + return v, nil + } else { + return nil, ErrUnsupportType + } + } + if err := self.should(types.V_ARRAY); err != nil { + return nil, err + } + if err := self.loadAllIndex(false); err != nil { + return nil, err + } + return self.toGenericArrayUseNumber() +} + +// ArrayUseNode copies both parsed and non-parsed children nodes, +// and indexes them by original order +func (self *Node) ArrayUseNode() ([]Node, error) { + if self.isAny() { + any := self.packAny() + if v, ok := any.([]Node); ok { + return v, nil + } else { + return nil, ErrUnsupportType + } + } + if err := self.should(types.V_ARRAY); err != nil { + return nil, err + } + if err := self.skipAllIndex(); err != nil { + return nil, err + } + return self.toGenericArrayUseNode() +} + +// ArrayUnsafe exports the underlying pointer to its children array +// WARN: don't use it unless you know what you are doing +// +// Deprecated: this API now returns copied nodes instead of directly reference, +// which has no difference with ArrayUseNode +// func (self *Node) UnsafeArray() ([]Node, error) { +// if err := self.should(types.V_ARRAY, "an array"); err != nil { +// return nil, err +// } +// if err := self.skipAllIndex(); err != nil { +// return nil, err +// } +// return self.toGenericArrayUseNode() +// } + +func (self *Node) unsafeArray() (*linkedNodes, error) { + if err := self.skipAllIndex(); err != nil { + return nil, err + } + if self.p == nil { + *self = newArray(new(linkedNodes)) + } + return (*linkedNodes)(self.p), nil +} + +// Interface loads all children under all paths from this node, +// and converts itself as generic type. +// WARN: all numeric nodes are casted to float64 +func (self *Node) Interface() (interface{}, error) { + if err := self.checkRaw(); err != nil { + return nil, err + } + switch self.t { + case V_ERROR : return nil, self.Check() + case types.V_NULL : return nil, nil + case types.V_TRUE : return true, nil + case types.V_FALSE : return false, nil + case types.V_ARRAY : return self.toGenericArray() + case types.V_OBJECT : return self.toGenericObject() + case types.V_STRING : return self.toString(), nil + case _V_NUMBER : + v, err := self.toFloat64() + if err != nil { + return nil, err + } + return v, nil + case _V_ARRAY_LAZY : + if err := self.loadAllIndex(false); err != nil { + return nil, err + } + return self.toGenericArray() + case _V_OBJECT_LAZY : + if err := self.loadAllKey(false); err != nil { + return nil, err + } + return self.toGenericObject() + case _V_ANY: + switch v := self.packAny().(type) { + case Node : return v.Interface() + case *Node: return v.Interface() + default : return v, nil + } + default : return nil, ErrUnsupportType + } +} + +func (self *Node) packAny() interface{} { + return *(*interface{})(self.p) +} + +// InterfaceUseNumber works same with Interface() +// except numeric nodes are casted to json.Number +func (self *Node) InterfaceUseNumber() (interface{}, error) { + if err := self.checkRaw(); err != nil { + return nil, err + } + switch self.t { + case V_ERROR : return nil, self.Check() + case types.V_NULL : return nil, nil + case types.V_TRUE : return true, nil + case types.V_FALSE : return false, nil + case types.V_ARRAY : return self.toGenericArrayUseNumber() + case types.V_OBJECT : return self.toGenericObjectUseNumber() + case types.V_STRING : return self.toString(), nil + case _V_NUMBER : return self.toNumber(), nil + case _V_ARRAY_LAZY : + if err := self.loadAllIndex(false); err != nil { + return nil, err + } + return self.toGenericArrayUseNumber() + case _V_OBJECT_LAZY : + if err := self.loadAllKey(false); err != nil { + return nil, err + } + return self.toGenericObjectUseNumber() + case _V_ANY : return self.packAny(), nil + default : return nil, ErrUnsupportType + } +} + +// InterfaceUseNode clone itself as a new node, +// or its children as map[string]Node (or []Node) +func (self *Node) InterfaceUseNode() (interface{}, error) { + if err := self.checkRaw(); err != nil { + return nil, err + } + switch self.t { + case types.V_ARRAY : return self.toGenericArrayUseNode() + case types.V_OBJECT : return self.toGenericObjectUseNode() + case _V_ARRAY_LAZY : + if err := self.skipAllIndex(); err != nil { + return nil, err + } + return self.toGenericArrayUseNode() + case _V_OBJECT_LAZY : + if err := self.skipAllKey(); err != nil { + return nil, err + } + return self.toGenericObjectUseNode() + default : return *self, self.Check() + } +} + +// LoadAll loads the node's children +// and ensure all its children can be READ concurrently (include its children's children) +func (self *Node) LoadAll() error { + return self.Load() +} + +// Load loads the node's children as parsed. +// and ensure all its children can be READ concurrently (include its children's children) +func (self *Node) Load() error { + switch self.t { + case _V_ARRAY_LAZY: self.loadAllIndex(true) + case _V_OBJECT_LAZY: self.loadAllKey(true) + case V_ERROR: return self + case V_NONE: return nil + } + if self.m == nil { + self.m = new(sync.RWMutex) + } + return self.checkRaw() +} + +/**---------------------------------- Internal Helper Methods ----------------------------------**/ + +func (self *Node) should(t types.ValueType) error { + if err := self.checkRaw(); err != nil { + return err + } + if self.itype() != t { + return ErrUnsupportType + } + return nil +} + +func (self *Node) nodeAt(i int) *Node { + var p *linkedNodes + if self.isLazy() { + _, stack := self.getParserAndArrayStack() + p = &stack.v + } else { + p = (*linkedNodes)(self.p) + if l := p.Len(); l != self.len() { + // some nodes got unset, iterate to skip them + for j:=0; j 0 { + /* linear search */ + var p *Pair + var i int + if lazy { + s := (*parseObjectStack)(self.p) + p, i = s.v.Get(key) + } else { + p, i = (*linkedPairs)(self.p).Get(key) + } + + if p != nil { + return &p.Value, i + } + } + + /* not found */ + if !lazy { + return nil, -1 + } + + // lazy load + for last, i := self.skipNextPair(), nb; last != nil; last, i = self.skipNextPair(), i+1 { + if last.Value.Check() != nil { + return &last.Value, -1 + } + if last.Key == key { + return &last.Value, i + } + } + + return nil, -1 +} + +func (self *Node) skipIndex(index int) *Node { + nb := self.len() + if nb > index { + v := self.nodeAt(index) + return v + } + if !self.isLazy() { + return nil + } + + // lazy load + for last := self.skipNextNode(); last != nil; last = self.skipNextNode(){ + if last.Check() != nil { + return last + } + if self.len() > index { + return last + } + } + + return nil +} + +func (self *Node) skipIndexPair(index int) *Pair { + nb := self.len() + if nb > index { + return self.pairAt(index) + } + if !self.isLazy() { + return nil + } + + // lazy load + for last := self.skipNextPair(); last != nil; last = self.skipNextPair(){ + if last.Value.Check() != nil { + return last + } + if self.len() > index { + return last + } + } + + return nil +} + +func (self *Node) loadAllIndex(loadOnce bool) error { + if !self.isLazy() { + return nil + } + var err types.ParsingError + parser, stack := self.getParserAndArrayStack() + if !loadOnce { + parser.noLazy = true + } else { + parser.loadOnce = true + } + *self, err = parser.decodeArray(&stack.v) + if err != 0 { + return parser.ExportError(err) + } + return nil +} + +func (self *Node) loadAllKey(loadOnce bool) error { + if !self.isLazy() { + return nil + } + var err types.ParsingError + parser, stack := self.getParserAndObjectStack() + if !loadOnce { + parser.noLazy = true + *self, err = parser.decodeObject(&stack.v) + } else { + parser.loadOnce = true + *self, err = parser.decodeObject(&stack.v) + } + if err != 0 { + return parser.ExportError(err) + } + return nil +} + +func (self *Node) removeNode(i int) { + node := self.nodeAt(i) + if node == nil { + return + } + *node = Node{} + // NOTICE: not be consistent with linkedNode.Len() + self.l-- +} + +func (self *Node) removePair(i int) { + last := self.pairAt(i) + if last == nil { + return + } + *last = Pair{} + // NOTICE: should be consistent with linkedPair.Len() + self.l-- +} + +func (self *Node) removePairAt(i int) { + p := (*linkedPairs)(self.p).At(i) + if p == nil { + return + } + *p = Pair{} + // NOTICE: should be consistent with linkedPair.Len() + self.l-- +} + +func (self *Node) toGenericArray() ([]interface{}, error) { + nb := self.len() + if nb == 0 { + return []interface{}{}, nil + } + ret := make([]interface{}, 0, nb) + + /* convert each item */ + it := self.values() + for v := it.next(); v != nil; v = it.next() { + vv, err := v.Interface() + if err != nil { + return nil, err + } + ret = append(ret, vv) + } + + /* all done */ + return ret, nil +} + +func (self *Node) toGenericArrayUseNumber() ([]interface{}, error) { + nb := self.len() + if nb == 0 { + return []interface{}{}, nil + } + ret := make([]interface{}, 0, nb) + + /* convert each item */ + it := self.values() + for v := it.next(); v != nil; v = it.next() { + vv, err := v.InterfaceUseNumber() + if err != nil { + return nil, err + } + ret = append(ret, vv) + } + + /* all done */ + return ret, nil +} + +func (self *Node) toGenericArrayUseNode() ([]Node, error) { + var nb = self.len() + if nb == 0 { + return []Node{}, nil + } + + var s = (*linkedNodes)(self.p) + var out = make([]Node, nb) + s.ToSlice(out) + + return out, nil +} + +func (self *Node) toGenericObject() (map[string]interface{}, error) { + nb := self.len() + if nb == 0 { + return map[string]interface{}{}, nil + } + ret := make(map[string]interface{}, nb) + + /* convert each item */ + it := self.properties() + for v := it.next(); v != nil; v = it.next() { + vv, err := v.Value.Interface() + if err != nil { + return nil, err + } + ret[v.Key] = vv + } + + /* all done */ + return ret, nil +} + + +func (self *Node) toGenericObjectUseNumber() (map[string]interface{}, error) { + nb := self.len() + if nb == 0 { + return map[string]interface{}{}, nil + } + ret := make(map[string]interface{}, nb) + + /* convert each item */ + it := self.properties() + for v := it.next(); v != nil; v = it.next() { + vv, err := v.Value.InterfaceUseNumber() + if err != nil { + return nil, err + } + ret[v.Key] = vv + } + + /* all done */ + return ret, nil +} + +func (self *Node) toGenericObjectUseNode() (map[string]Node, error) { + var nb = self.len() + if nb == 0 { + return map[string]Node{}, nil + } + + var s = (*linkedPairs)(self.p) + var out = make(map[string]Node, nb) + s.ToMap(out) + + /* all done */ + return out, nil +} + +/**------------------------------------ Factory Methods ------------------------------------**/ + +var ( + nullNode = Node{t: types.V_NULL} + trueNode = Node{t: types.V_TRUE} + falseNode = Node{t: types.V_FALSE} +) + +// NewRaw creates a node of raw json. +// If the input json is invalid, NewRaw returns a error Node. +func NewRaw(json string) Node { + parser := NewParserObj(json) + start, err := parser.skip() + if err != 0 { + return *newError(err, err.Message()) + } + it := switchRawType(parser.s[start]) + if it == _V_NONE { + return Node{} + } + return newRawNode(parser.s[start:parser.p], it, false) +} + +// NewRawConcurrentRead creates a node of raw json, which can be READ +// (GetByPath/Get/Index/GetOrIndex/Int64/Bool/Float64/String/Number/Interface/Array/Map/Raw/MarshalJSON) concurrently. +// If the input json is invalid, NewRaw returns a error Node. +func NewRawConcurrentRead(json string) Node { + parser := NewParserObj(json) + start, err := parser.skip() + if err != 0 { + return *newError(err, err.Message()) + } + it := switchRawType(parser.s[start]) + if it == _V_NONE { + return Node{} + } + return newRawNode(parser.s[start:parser.p], it, true) +} + +// NewAny creates a node of type V_ANY if any's type isn't Node or *Node, +// which stores interface{} and can be only used for `.Interface()`\`.MarshalJSON()`. +func NewAny(any interface{}) Node { + switch n := any.(type) { + case Node: + return n + case *Node: + return *n + default: + return Node{ + t: _V_ANY, + p: unsafe.Pointer(&any), + } + } +} + +// NewBytes encodes given src with Base64 (RFC 4648), and creates a node of type V_STRING. +func NewBytes(src []byte) Node { + if len(src) == 0 { + panic("empty src bytes") + } + out := rt.EncodeBase64ToString(src) + return NewString(out) +} + +// NewNull creates a node of type V_NULL +func NewNull() Node { + return Node{ + p: nil, + t: types.V_NULL, + } +} + +// NewBool creates a node of type bool: +// If v is true, returns V_TRUE node +// If v is false, returns V_FALSE node +func NewBool(v bool) Node { + var t = types.V_FALSE + if v { + t = types.V_TRUE + } + return Node{ + p: nil, + t: t, + } +} + +// NewNumber creates a json.Number node +// v must be a decimal string complying with RFC8259 +func NewNumber(v string) Node { + return Node{ + l: uint(len(v)), + p: rt.StrPtr(v), + t: _V_NUMBER, + } +} + +func (node *Node) toNumber() json.Number { + return json.Number(rt.StrFrom(node.p, int64(node.l))) +} + +func (self *Node) toString() string { + return rt.StrFrom(self.p, int64(self.l)) +} + +func (node *Node) toFloat64() (float64, error) { + ret, err := node.toNumber().Float64() + if err != nil { + return 0, err + } + return ret, nil +} + +func (node *Node) toInt64() (int64, error) { + ret,err := node.toNumber().Int64() + if err != nil { + return 0, err + } + return ret, nil +} + +func newBytes(v []byte) Node { + return Node{ + t: types.V_STRING, + p: mem2ptr(v), + l: uint(len(v)), + } +} + +// NewString creates a node of type V_STRING. +// v is considered to be a valid UTF-8 string, +// which means it won't be validated and unescaped. +// when the node is encoded to json, v will be escaped. +func NewString(v string) Node { + return Node{ + t: types.V_STRING, + p: rt.StrPtr(v), + l: uint(len(v)), + } +} + +// NewArray creates a node of type V_ARRAY, +// using v as its underlying children +func NewArray(v []Node) Node { + s := new(linkedNodes) + s.FromSlice(v) + return newArray(s) +} + +const _Threshold_Index = 16 + +func newArray(v *linkedNodes) Node { + return Node{ + t: types.V_ARRAY, + l: uint(v.Len()), + p: unsafe.Pointer(v), + } +} + +func (self *Node) setArray(v *linkedNodes) { + self.t = types.V_ARRAY + self.l = uint(v.Len()) + self.p = unsafe.Pointer(v) +} + +// NewObject creates a node of type V_OBJECT, +// using v as its underlying children +func NewObject(v []Pair) Node { + s := new(linkedPairs) + s.FromSlice(v) + return newObject(s) +} + +func newObject(v *linkedPairs) Node { + if v.size > _Threshold_Index { + v.BuildIndex() + } + return Node{ + t: types.V_OBJECT, + l: uint(v.Len()), + p: unsafe.Pointer(v), + } +} + +func (self *Node) setObject(v *linkedPairs) { + if v.size > _Threshold_Index { + v.BuildIndex() + } + self.t = types.V_OBJECT + self.l = uint(v.Len()) + self.p = unsafe.Pointer(v) +} + +func (self *Node) parseRaw(full bool) { + lock := self.lock() + defer self.unlock() + if !self.isRaw() { + return + } + raw := self.toString() + parser := NewParserObj(raw) + var e types.ParsingError + if full { + parser.noLazy = true + *self, e = parser.Parse() + } else if lock { + var n Node + parser.noLazy = true + parser.loadOnce = true + n, e = parser.Parse() + self.assign(n) + } else { + *self, e = parser.Parse() + } + if e != 0 { + *self = *newSyntaxError(parser.syntaxError(e)) + } +} + +func (self *Node) assign(n Node) { + self.l = n.l + self.p = n.p + atomic.StoreInt64(&self.t, n.t) +} diff --git a/vendor/github.com/bytedance/sonic/ast/parser.go b/vendor/github.com/bytedance/sonic/ast/parser.go new file mode 100644 index 00000000..30bd1f45 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/parser.go @@ -0,0 +1,766 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + "fmt" + "sync" + "sync/atomic" + + "github.com/bytedance/sonic/internal/native/types" + "github.com/bytedance/sonic/internal/rt" +) + +const ( + _DEFAULT_NODE_CAP int = 16 + _APPEND_GROW_SHIFT = 1 +) + +const ( + _ERR_NOT_FOUND types.ParsingError = 33 + _ERR_UNSUPPORT_TYPE types.ParsingError = 34 +) + +var ( + // ErrNotExist means both key and value doesn't exist + ErrNotExist error = newError(_ERR_NOT_FOUND, "value not exists") + + // ErrUnsupportType means API on the node is unsupported + ErrUnsupportType error = newError(_ERR_UNSUPPORT_TYPE, "unsupported type") +) + +type Parser struct { + p int + s string + noLazy bool + loadOnce bool + skipValue bool + dbuf *byte +} + +/** Parser Private Methods **/ + +func (self *Parser) delim() types.ParsingError { + n := len(self.s) + p := self.lspace(self.p) + + /* check for EOF */ + if p >= n { + return types.ERR_EOF + } + + /* check for the delimtier */ + if self.s[p] != ':' { + return types.ERR_INVALID_CHAR + } + + /* update the read pointer */ + self.p = p + 1 + return 0 +} + +func (self *Parser) object() types.ParsingError { + n := len(self.s) + p := self.lspace(self.p) + + /* check for EOF */ + if p >= n { + return types.ERR_EOF + } + + /* check for the delimtier */ + if self.s[p] != '{' { + return types.ERR_INVALID_CHAR + } + + /* update the read pointer */ + self.p = p + 1 + return 0 +} + +func (self *Parser) array() types.ParsingError { + n := len(self.s) + p := self.lspace(self.p) + + /* check for EOF */ + if p >= n { + return types.ERR_EOF + } + + /* check for the delimtier */ + if self.s[p] != '[' { + return types.ERR_INVALID_CHAR + } + + /* update the read pointer */ + self.p = p + 1 + return 0 +} + +func (self *Parser) lspace(sp int) int { + ns := len(self.s) + for ; sp= 0 && isSpace(self.s[self.p]); self.p-=1 {} +} + +func (self *Parser) decodeArray(ret *linkedNodes) (Node, types.ParsingError) { + sp := self.p + ns := len(self.s) + + /* check for EOF */ + if self.p = self.lspace(sp); self.p >= ns { + return Node{}, types.ERR_EOF + } + + /* check for empty array */ + if self.s[self.p] == ']' { + self.p++ + return Node{t: types.V_ARRAY}, 0 + } + + /* allocate array space and parse every element */ + for { + var val Node + var err types.ParsingError + + if self.skipValue { + /* skip the value */ + var start int + if start, err = self.skipFast(); err != 0 { + return Node{}, err + } + if self.p > ns { + return Node{}, types.ERR_EOF + } + t := switchRawType(self.s[start]) + if t == _V_NONE { + return Node{}, types.ERR_INVALID_CHAR + } + val = newRawNode(self.s[start:self.p], t, false) + }else{ + /* decode the value */ + if val, err = self.Parse(); err != 0 { + return Node{}, err + } + } + + /* add the value to result */ + ret.Push(val) + self.p = self.lspace(self.p) + + /* check for EOF */ + if self.p >= ns { + return Node{}, types.ERR_EOF + } + + /* check for the next character */ + switch self.s[self.p] { + case ',' : self.p++ + case ']' : self.p++; return newArray(ret), 0 + default: + // if val.isLazy() { + // return newLazyArray(self, ret), 0 + // } + return Node{}, types.ERR_INVALID_CHAR + } + } +} + +func (self *Parser) decodeObject(ret *linkedPairs) (Node, types.ParsingError) { + sp := self.p + ns := len(self.s) + + /* check for EOF */ + if self.p = self.lspace(sp); self.p >= ns { + return Node{}, types.ERR_EOF + } + + /* check for empty object */ + if self.s[self.p] == '}' { + self.p++ + return Node{t: types.V_OBJECT}, 0 + } + + /* decode each pair */ + for { + var val Node + var njs types.JsonState + var err types.ParsingError + + /* decode the key */ + if njs = self.decodeValue(); njs.Vt != types.V_STRING { + return Node{}, types.ERR_INVALID_CHAR + } + + /* extract the key */ + idx := self.p - 1 + key := self.s[njs.Iv:idx] + + /* check for escape sequence */ + if njs.Ep != -1 { + if key, err = unquote(key); err != 0 { + return Node{}, err + } + } + + /* expect a ':' delimiter */ + if err = self.delim(); err != 0 { + return Node{}, err + } + + + if self.skipValue { + /* skip the value */ + var start int + if start, err = self.skipFast(); err != 0 { + return Node{}, err + } + if self.p > ns { + return Node{}, types.ERR_EOF + } + t := switchRawType(self.s[start]) + if t == _V_NONE { + return Node{}, types.ERR_INVALID_CHAR + } + val = newRawNode(self.s[start:self.p], t, false) + } else { + /* decode the value */ + if val, err = self.Parse(); err != 0 { + return Node{}, err + } + } + + /* add the value to result */ + // FIXME: ret's address may change here, thus previous referred node in ret may be invalid !! + ret.Push(NewPair(key, val)) + self.p = self.lspace(self.p) + + /* check for EOF */ + if self.p >= ns { + return Node{}, types.ERR_EOF + } + + /* check for the next character */ + switch self.s[self.p] { + case ',' : self.p++ + case '}' : self.p++; return newObject(ret), 0 + default: + // if val.isLazy() { + // return newLazyObject(self, ret), 0 + // } + return Node{}, types.ERR_INVALID_CHAR + } + } +} + +func (self *Parser) decodeString(iv int64, ep int) (Node, types.ParsingError) { + p := self.p - 1 + s := self.s[iv:p] + + /* fast path: no escape sequence */ + if ep == -1 { + return NewString(s), 0 + } + + /* unquote the string */ + out, err := unquote(s) + + /* check for errors */ + if err != 0 { + return Node{}, err + } else { + return newBytes(rt.Str2Mem(out)), 0 + } +} + +/** Parser Interface **/ + +func (self *Parser) Pos() int { + return self.p +} + + +// Parse returns a ast.Node representing the parser's JSON. +// NOTICE: the specific parsing lazy dependens parser's option +// It only parse first layer and first child for Object or Array be default +func (self *Parser) Parse() (Node, types.ParsingError) { + switch val := self.decodeValue(); val.Vt { + case types.V_EOF : return Node{}, types.ERR_EOF + case types.V_NULL : return nullNode, 0 + case types.V_TRUE : return trueNode, 0 + case types.V_FALSE : return falseNode, 0 + case types.V_STRING : return self.decodeString(val.Iv, val.Ep) + case types.V_ARRAY: + s := self.p - 1; + if p := skipBlank(self.s, self.p); p >= self.p && self.s[p] == ']' { + self.p = p + 1 + return Node{t: types.V_ARRAY}, 0 + } + if self.noLazy { + if self.loadOnce { + self.noLazy = false + } + return self.decodeArray(new(linkedNodes)) + } + // NOTICE: loadOnce always keep raw json for object or array + if self.loadOnce { + self.p = s + s, e := self.skipFast() + if e != 0 { + return Node{}, e + } + return newRawNode(self.s[s:self.p], types.V_ARRAY, true), 0 + } + return newLazyArray(self), 0 + case types.V_OBJECT: + s := self.p - 1; + if p := skipBlank(self.s, self.p); p >= self.p && self.s[p] == '}' { + self.p = p + 1 + return Node{t: types.V_OBJECT}, 0 + } + // NOTICE: loadOnce always keep raw json for object or array + if self.noLazy { + if self.loadOnce { + self.noLazy = false + } + return self.decodeObject(new(linkedPairs)) + } + if self.loadOnce { + self.p = s + s, e := self.skipFast() + if e != 0 { + return Node{}, e + } + return newRawNode(self.s[s:self.p], types.V_OBJECT, true), 0 + } + return newLazyObject(self), 0 + case types.V_DOUBLE : return NewNumber(self.s[val.Ep:self.p]), 0 + case types.V_INTEGER : return NewNumber(self.s[val.Ep:self.p]), 0 + default : return Node{}, types.ParsingError(-val.Vt) + } +} + +func (self *Parser) searchKey(match string) types.ParsingError { + ns := len(self.s) + if err := self.object(); err != 0 { + return err + } + + /* check for EOF */ + if self.p = self.lspace(self.p); self.p >= ns { + return types.ERR_EOF + } + + /* check for empty object */ + if self.s[self.p] == '}' { + self.p++ + return _ERR_NOT_FOUND + } + + var njs types.JsonState + var err types.ParsingError + /* decode each pair */ + for { + + /* decode the key */ + if njs = self.decodeValue(); njs.Vt != types.V_STRING { + return types.ERR_INVALID_CHAR + } + + /* extract the key */ + idx := self.p - 1 + key := self.s[njs.Iv:idx] + + /* check for escape sequence */ + if njs.Ep != -1 { + if key, err = unquote(key); err != 0 { + return err + } + } + + /* expect a ':' delimiter */ + if err = self.delim(); err != 0 { + return err + } + + /* skip value */ + if key != match { + if _, err = self.skipFast(); err != 0 { + return err + } + } else { + return 0 + } + + /* check for EOF */ + self.p = self.lspace(self.p) + if self.p >= ns { + return types.ERR_EOF + } + + /* check for the next character */ + switch self.s[self.p] { + case ',': + self.p++ + case '}': + self.p++ + return _ERR_NOT_FOUND + default: + return types.ERR_INVALID_CHAR + } + } +} + +func (self *Parser) searchIndex(idx int) types.ParsingError { + ns := len(self.s) + if err := self.array(); err != 0 { + return err + } + + /* check for EOF */ + if self.p = self.lspace(self.p); self.p >= ns { + return types.ERR_EOF + } + + /* check for empty array */ + if self.s[self.p] == ']' { + self.p++ + return _ERR_NOT_FOUND + } + + var err types.ParsingError + /* allocate array space and parse every element */ + for i := 0; i < idx; i++ { + + /* decode the value */ + if _, err = self.skipFast(); err != 0 { + return err + } + + /* check for EOF */ + self.p = self.lspace(self.p) + if self.p >= ns { + return types.ERR_EOF + } + + /* check for the next character */ + switch self.s[self.p] { + case ',': + self.p++ + case ']': + self.p++ + return _ERR_NOT_FOUND + default: + return types.ERR_INVALID_CHAR + } + } + + return 0 +} + +func (self *Node) skipNextNode() *Node { + if !self.isLazy() { + return nil + } + + parser, stack := self.getParserAndArrayStack() + ret := &stack.v + sp := parser.p + ns := len(parser.s) + + /* check for EOF */ + if parser.p = parser.lspace(sp); parser.p >= ns { + return newSyntaxError(parser.syntaxError(types.ERR_EOF)) + } + + /* check for empty array */ + if parser.s[parser.p] == ']' { + parser.p++ + self.setArray(ret) + return nil + } + + var val Node + /* skip the value */ + if start, err := parser.skipFast(); err != 0 { + return newSyntaxError(parser.syntaxError(err)) + } else { + t := switchRawType(parser.s[start]) + if t == _V_NONE { + return newSyntaxError(parser.syntaxError(types.ERR_INVALID_CHAR)) + } + val = newRawNode(parser.s[start:parser.p], t, false) + } + + /* add the value to result */ + ret.Push(val) + self.l++ + parser.p = parser.lspace(parser.p) + + /* check for EOF */ + if parser.p >= ns { + return newSyntaxError(parser.syntaxError(types.ERR_EOF)) + } + + /* check for the next character */ + switch parser.s[parser.p] { + case ',': + parser.p++ + return ret.At(ret.Len()-1) + case ']': + parser.p++ + self.setArray(ret) + return ret.At(ret.Len()-1) + default: + return newSyntaxError(parser.syntaxError(types.ERR_INVALID_CHAR)) + } +} + +func (self *Node) skipNextPair() (*Pair) { + if !self.isLazy() { + return nil + } + + parser, stack := self.getParserAndObjectStack() + ret := &stack.v + sp := parser.p + ns := len(parser.s) + + /* check for EOF */ + if parser.p = parser.lspace(sp); parser.p >= ns { + return newErrorPair(parser.syntaxError(types.ERR_EOF)) + } + + /* check for empty object */ + if parser.s[parser.p] == '}' { + parser.p++ + self.setObject(ret) + return nil + } + + /* decode one pair */ + var val Node + var njs types.JsonState + var err types.ParsingError + + /* decode the key */ + if njs = parser.decodeValue(); njs.Vt != types.V_STRING { + return newErrorPair(parser.syntaxError(types.ERR_INVALID_CHAR)) + } + + /* extract the key */ + idx := parser.p - 1 + key := parser.s[njs.Iv:idx] + + /* check for escape sequence */ + if njs.Ep != -1 { + if key, err = unquote(key); err != 0 { + return newErrorPair(parser.syntaxError(err)) + } + } + + /* expect a ':' delimiter */ + if err = parser.delim(); err != 0 { + return newErrorPair(parser.syntaxError(err)) + } + + /* skip the value */ + if start, err := parser.skipFast(); err != 0 { + return newErrorPair(parser.syntaxError(err)) + } else { + t := switchRawType(parser.s[start]) + if t == _V_NONE { + return newErrorPair(parser.syntaxError(types.ERR_INVALID_CHAR)) + } + val = newRawNode(parser.s[start:parser.p], t, false) + } + + /* add the value to result */ + ret.Push(NewPair(key, val)) + self.l++ + parser.p = parser.lspace(parser.p) + + /* check for EOF */ + if parser.p >= ns { + return newErrorPair(parser.syntaxError(types.ERR_EOF)) + } + + /* check for the next character */ + switch parser.s[parser.p] { + case ',': + parser.p++ + return ret.At(ret.Len()-1) + case '}': + parser.p++ + self.setObject(ret) + return ret.At(ret.Len()-1) + default: + return newErrorPair(parser.syntaxError(types.ERR_INVALID_CHAR)) + } +} + + +/** Parser Factory **/ + +// Loads parse all json into interface{} +func Loads(src string) (int, interface{}, error) { + ps := &Parser{s: src} + np, err := ps.Parse() + + /* check for errors */ + if err != 0 { + return 0, nil, ps.ExportError(err) + } else { + x, err := np.Interface() + if err != nil { + return 0, nil, err + } + return ps.Pos(), x, nil + } +} + +// LoadsUseNumber parse all json into interface{}, with numeric nodes casted to json.Number +func LoadsUseNumber(src string) (int, interface{}, error) { + ps := &Parser{s: src} + np, err := ps.Parse() + + /* check for errors */ + if err != 0 { + return 0, nil, err + } else { + x, err := np.InterfaceUseNumber() + if err != nil { + return 0, nil, err + } + return ps.Pos(), x, nil + } +} + +// NewParser returns pointer of new allocated parser +func NewParser(src string) *Parser { + return &Parser{s: src} +} + +// NewParser returns new allocated parser +func NewParserObj(src string) Parser { + return Parser{s: src} +} + +// decodeNumber controls if parser decodes the number values instead of skip them +// WARN: once you set decodeNumber(true), please set decodeNumber(false) before you drop the parser +// otherwise the memory CANNOT be reused +func (self *Parser) decodeNumber(decode bool) { + if !decode && self.dbuf != nil { + types.FreeDbuf(self.dbuf) + self.dbuf = nil + return + } + if decode && self.dbuf == nil { + self.dbuf = types.NewDbuf() + } +} + +// ExportError converts types.ParsingError to std Error +func (self *Parser) ExportError(err types.ParsingError) error { + if err == _ERR_NOT_FOUND { + return ErrNotExist + } + return fmt.Errorf("%q", SyntaxError{ + Pos : self.p, + Src : self.s, + Code: err, + }.Description()) +} + +func backward(src string, i int) int { + for ; i>=0 && isSpace(src[i]); i-- {} + return i +} + + +func newRawNode(str string, typ types.ValueType, lock bool) Node { + ret := Node{ + t: typ | _V_RAW, + p: rt.StrPtr(str), + l: uint(len(str)), + } + if lock { + ret.m = new(sync.RWMutex) + } + return ret +} + +var typeJumpTable = [256]types.ValueType{ + '"' : types.V_STRING, + '-' : _V_NUMBER, + '0' : _V_NUMBER, + '1' : _V_NUMBER, + '2' : _V_NUMBER, + '3' : _V_NUMBER, + '4' : _V_NUMBER, + '5' : _V_NUMBER, + '6' : _V_NUMBER, + '7' : _V_NUMBER, + '8' : _V_NUMBER, + '9' : _V_NUMBER, + '[' : types.V_ARRAY, + 'f' : types.V_FALSE, + 'n' : types.V_NULL, + 't' : types.V_TRUE, + '{' : types.V_OBJECT, +} + +func switchRawType(c byte) types.ValueType { + return typeJumpTable[c] +} + +func (self *Node) loadt() types.ValueType { + return (types.ValueType)(atomic.LoadInt64(&self.t)) +} + +func (self *Node) lock() bool { + if m := self.m; m != nil { + m.Lock() + return true + } + return false +} + +func (self *Node) unlock() { + if m := self.m; m != nil { + m.Unlock() + } +} + +func (self *Node) rlock() bool { + if m := self.m; m != nil { + m.RLock() + return true + } + return false +} + +func (self *Node) runlock() { + if m := self.m; m != nil { + m.RUnlock() + } +} diff --git a/vendor/github.com/bytedance/sonic/ast/search.go b/vendor/github.com/bytedance/sonic/ast/search.go new file mode 100644 index 00000000..9a5fb942 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/search.go @@ -0,0 +1,157 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + `github.com/bytedance/sonic/internal/rt` + `github.com/bytedance/sonic/internal/native/types` +) + +// SearchOptions controls Searcher's behavior +type SearchOptions struct { + // ValidateJSON indicates the searcher to validate the entire JSON + ValidateJSON bool + + // CopyReturn indicates the searcher to copy the result JSON instead of refer from the input + // This can help to reduce memory usage if you cache the results + CopyReturn bool + + // ConcurrentRead indicates the searcher to return a concurrently-READ-safe node, + // including: GetByPath/Get/Index/GetOrIndex/Int64/Bool/Float64/String/Number/Interface/Array/Map/Raw/MarshalJSON + ConcurrentRead bool +} + +type Searcher struct { + parser Parser + SearchOptions +} + +func NewSearcher(str string) *Searcher { + return &Searcher{ + parser: Parser{ + s: str, + noLazy: false, + }, + SearchOptions: SearchOptions{ + ValidateJSON: true, + }, + } +} + +// GetByPathCopy search in depth from top json and returns a **Copied** json node at the path location +func (self *Searcher) GetByPathCopy(path ...interface{}) (Node, error) { + self.CopyReturn = true + return self.getByPath(path...) +} + +// GetByPathNoCopy search in depth from top json and returns a **Referenced** json node at the path location +// +// WARN: this search directly refer partial json from top json, which has faster speed, +// may consumes more memory. +func (self *Searcher) GetByPath(path ...interface{}) (Node, error) { + return self.getByPath(path...) +} + +func (self *Searcher) getByPath(path ...interface{}) (Node, error) { + var err types.ParsingError + var start int + + self.parser.p = 0 + start, err = self.parser.getByPath(self.ValidateJSON, path...) + if err != 0 { + // for compatibility with old version + if err == types.ERR_NOT_FOUND { + return Node{}, ErrNotExist + } + if err == types.ERR_UNSUPPORT_TYPE { + panic("path must be either int(>=0) or string") + } + return Node{}, self.parser.syntaxError(err) + } + + t := switchRawType(self.parser.s[start]) + if t == _V_NONE { + return Node{}, self.parser.ExportError(err) + } + + // copy string to reducing memory usage + var raw string + if self.CopyReturn { + raw = rt.Mem2Str([]byte(self.parser.s[start:self.parser.p])) + } else { + raw = self.parser.s[start:self.parser.p] + } + return newRawNode(raw, t, self.ConcurrentRead), nil +} + +// GetByPath searches a path and returns relaction and types of target +func _GetByPath(src string, path ...interface{}) (start int, end int, typ int, err error) { + p := NewParserObj(src) + s, e := p.getByPath(false, path...) + if e != 0 { + // for compatibility with old version + if e == types.ERR_NOT_FOUND { + return -1, -1, 0, ErrNotExist + } + if e == types.ERR_UNSUPPORT_TYPE { + panic("path must be either int(>=0) or string") + } + return -1, -1, 0, p.syntaxError(e) + } + + t := switchRawType(p.s[s]) + if t == _V_NONE { + return -1, -1, 0, ErrNotExist + } + if t == _V_NUMBER { + p.p = 1 + backward(p.s, p.p-1) + } + return s, p.p, int(t), nil +} + +// ValidSyntax check if a json has a valid JSON syntax, +// while not validate UTF-8 charset +func _ValidSyntax(json string) bool { + p := NewParserObj(json) + _, e := p.skip() + if e != 0 { + return false + } + if skipBlank(p.s, p.p) != -int(types.ERR_EOF) { + return false + } + return true +} + +// SkipFast skip a json value in fast-skip algs, +// while not strictly validate JSON syntax and UTF-8 charset. +func _SkipFast(src string, i int) (int, int, error) { + p := NewParserObj(src) + p.p = i + s, e := p.skipFast() + if e != 0 { + return -1, -1, p.ExportError(e) + } + t := switchRawType(p.s[s]) + if t == _V_NONE { + return -1, -1, ErrNotExist + } + if t == _V_NUMBER { + p.p = 1 + backward(p.s, p.p-1) + } + return s, p.p, nil +} diff --git a/vendor/github.com/bytedance/sonic/ast/stubs.go b/vendor/github.com/bytedance/sonic/ast/stubs.go new file mode 100644 index 00000000..9991cc89 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/stubs.go @@ -0,0 +1,31 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + "unsafe" + + "github.com/bytedance/sonic/internal/rt" +) + +//go:nosplit +func mem2ptr(s []byte) unsafe.Pointer { + return (*rt.GoSlice)(unsafe.Pointer(&s)).Ptr +} + +//go:linkname unquoteBytes encoding/json.unquoteBytes +func unquoteBytes(s []byte) (t []byte, ok bool) diff --git a/vendor/github.com/bytedance/sonic/ast/visitor.go b/vendor/github.com/bytedance/sonic/ast/visitor.go new file mode 100644 index 00000000..dc047851 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/ast/visitor.go @@ -0,0 +1,332 @@ +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package ast + +import ( + `encoding/json` + `errors` + + `github.com/bytedance/sonic/internal/native/types` +) + +// Visitor handles the callbacks during preorder traversal of a JSON AST. +// +// According to the JSON RFC8259, a JSON AST can be defined by +// the following rules without separator / whitespace tokens. +// +// JSON-AST = value +// value = false / null / true / object / array / number / string +// object = begin-object [ member *( member ) ] end-object +// member = string value +// array = begin-array [ value *( value ) ] end-array +// +type Visitor interface { + + // OnNull handles a JSON null value. + OnNull() error + + // OnBool handles a JSON true / false value. + OnBool(v bool) error + + // OnString handles a JSON string value. + OnString(v string) error + + // OnInt64 handles a JSON number value with int64 type. + OnInt64(v int64, n json.Number) error + + // OnFloat64 handles a JSON number value with float64 type. + OnFloat64(v float64, n json.Number) error + + // OnObjectBegin handles the beginning of a JSON object value with a + // suggested capacity that can be used to make your custom object container. + // + // After this point the visitor will receive a sequence of callbacks like + // [string, value, string, value, ......, ObjectEnd]. + // + // Note: + // 1. This is a recursive definition which means the value can + // also be a JSON object / array described by a sequence of callbacks. + // 2. The suggested capacity will be 0 if current object is empty. + // 3. Currently sonic use a fixed capacity for non-empty object (keep in + // sync with ast.Node) which might not be very suitable. This may be + // improved in future version. + OnObjectBegin(capacity int) error + + // OnObjectKey handles a JSON object key string in member. + OnObjectKey(key string) error + + // OnObjectEnd handles the ending of a JSON object value. + OnObjectEnd() error + + // OnArrayBegin handles the beginning of a JSON array value with a + // suggested capacity that can be used to make your custom array container. + // + // After this point the visitor will receive a sequence of callbacks like + // [value, value, value, ......, ArrayEnd]. + // + // Note: + // 1. This is a recursive definition which means the value can + // also be a JSON object / array described by a sequence of callbacks. + // 2. The suggested capacity will be 0 if current array is empty. + // 3. Currently sonic use a fixed capacity for non-empty array (keep in + // sync with ast.Node) which might not be very suitable. This may be + // improved in future version. + OnArrayBegin(capacity int) error + + // OnArrayEnd handles the ending of a JSON array value. + OnArrayEnd() error +} + +// VisitorOptions contains all Visitor's options. The default value is an +// empty VisitorOptions{}. +type VisitorOptions struct { + // OnlyNumber indicates parser to directly return number value without + // conversion, then the first argument of OnInt64 / OnFloat64 will always + // be zero. + OnlyNumber bool +} + +var defaultVisitorOptions = &VisitorOptions{} + +// Preorder decodes the whole JSON string and callbacks each AST node to visitor +// during preorder traversal. Any visitor method with an error returned will +// break the traversal and the given error will be directly returned. The opts +// argument can be reused after every call. +func Preorder(str string, visitor Visitor, opts *VisitorOptions) error { + if opts == nil { + opts = defaultVisitorOptions + } + // process VisitorOptions first to guarantee that all options will be + // constant during decoding and make options more readable. + var ( + optDecodeNumber = !opts.OnlyNumber + ) + + tv := &traverser{ + parser: Parser{ + s: str, + noLazy: true, + skipValue: false, + }, + visitor: visitor, + } + + if optDecodeNumber { + tv.parser.decodeNumber(true) + } + + err := tv.decodeValue() + + if optDecodeNumber { + tv.parser.decodeNumber(false) + } + return err +} + +type traverser struct { + parser Parser + visitor Visitor +} + +// NOTE: keep in sync with (*Parser).Parse method. +func (self *traverser) decodeValue() error { + switch val := self.parser.decodeValue(); val.Vt { + case types.V_EOF: + return types.ERR_EOF + case types.V_NULL: + return self.visitor.OnNull() + case types.V_TRUE: + return self.visitor.OnBool(true) + case types.V_FALSE: + return self.visitor.OnBool(false) + case types.V_STRING: + return self.decodeString(val.Iv, val.Ep) + case types.V_DOUBLE: + return self.visitor.OnFloat64(val.Dv, + json.Number(self.parser.s[val.Ep:self.parser.p])) + case types.V_INTEGER: + return self.visitor.OnInt64(val.Iv, + json.Number(self.parser.s[val.Ep:self.parser.p])) + case types.V_ARRAY: + return self.decodeArray() + case types.V_OBJECT: + return self.decodeObject() + default: + return types.ParsingError(-val.Vt) + } +} + +// NOTE: keep in sync with (*Parser).decodeArray method. +func (self *traverser) decodeArray() error { + sp := self.parser.p + ns := len(self.parser.s) + + /* allocate array space and parse every element */ + if err := self.visitor.OnArrayBegin(_DEFAULT_NODE_CAP); err != nil { + if err == VisitOPSkip { + // NOTICE: for user needs to skip entiry object + self.parser.p -= 1 + if _, e := self.parser.skipFast(); e != 0 { + return e + } + return self.visitor.OnArrayEnd() + } + return err + } + + /* check for EOF */ + self.parser.p = self.parser.lspace(sp) + if self.parser.p >= ns { + return types.ERR_EOF + } + + /* check for empty array */ + if self.parser.s[self.parser.p] == ']' { + self.parser.p++ + return self.visitor.OnArrayEnd() + } + + for { + /* decode the value */ + if err := self.decodeValue(); err != nil { + return err + } + self.parser.p = self.parser.lspace(self.parser.p) + + /* check for EOF */ + if self.parser.p >= ns { + return types.ERR_EOF + } + + /* check for the next character */ + switch self.parser.s[self.parser.p] { + case ',': + self.parser.p++ + case ']': + self.parser.p++ + return self.visitor.OnArrayEnd() + default: + return types.ERR_INVALID_CHAR + } + } +} + +// NOTE: keep in sync with (*Parser).decodeObject method. +func (self *traverser) decodeObject() error { + sp := self.parser.p + ns := len(self.parser.s) + + /* allocate object space and decode each pair */ + if err := self.visitor.OnObjectBegin(_DEFAULT_NODE_CAP); err != nil { + if err == VisitOPSkip { + // NOTICE: for user needs to skip entiry object + self.parser.p -= 1 + if _, e := self.parser.skipFast(); e != 0 { + return e + } + return self.visitor.OnObjectEnd() + } + return err + } + + /* check for EOF */ + self.parser.p = self.parser.lspace(sp) + if self.parser.p >= ns { + return types.ERR_EOF + } + + /* check for empty object */ + if self.parser.s[self.parser.p] == '}' { + self.parser.p++ + return self.visitor.OnObjectEnd() + } + + for { + var njs types.JsonState + var err types.ParsingError + + /* decode the key */ + if njs = self.parser.decodeValue(); njs.Vt != types.V_STRING { + return types.ERR_INVALID_CHAR + } + + /* extract the key */ + idx := self.parser.p - 1 + key := self.parser.s[njs.Iv:idx] + + /* check for escape sequence */ + if njs.Ep != -1 { + if key, err = unquote(key); err != 0 { + return err + } + } + + if err := self.visitor.OnObjectKey(key); err != nil { + return err + } + + /* expect a ':' delimiter */ + if err = self.parser.delim(); err != 0 { + return err + } + + /* decode the value */ + if err := self.decodeValue(); err != nil { + return err + } + + self.parser.p = self.parser.lspace(self.parser.p) + + /* check for EOF */ + if self.parser.p >= ns { + return types.ERR_EOF + } + + /* check for the next character */ + switch self.parser.s[self.parser.p] { + case ',': + self.parser.p++ + case '}': + self.parser.p++ + return self.visitor.OnObjectEnd() + default: + return types.ERR_INVALID_CHAR + } + } +} + +// NOTE: keep in sync with (*Parser).decodeString method. +func (self *traverser) decodeString(iv int64, ep int) error { + p := self.parser.p - 1 + s := self.parser.s[iv:p] + + /* fast path: no escape sequence */ + if ep == -1 { + return self.visitor.OnString(s) + } + + /* unquote the string */ + out, err := unquote(s) + if err != 0 { + return err + } + return self.visitor.OnString(out) +} + +// If visitor return this error on `OnObjectBegin()` or `OnArrayBegin()`, +// the transverer will skip entiry object or array +var VisitOPSkip = errors.New("") diff --git a/vendor/github.com/bytedance/sonic/compat.go b/vendor/github.com/bytedance/sonic/compat.go new file mode 100644 index 00000000..b694d7ce --- /dev/null +++ b/vendor/github.com/bytedance/sonic/compat.go @@ -0,0 +1,133 @@ +// +build !amd64,!arm64 go1.25 !go1.17 arm64,!go1.20 + +/* + * Copyright 2021 ByteDance Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package sonic + +import ( + `bytes` + `encoding/json` + `io` + `reflect` + + `github.com/bytedance/sonic/option` +) + +const apiKind = UseStdJSON + +type frozenConfig struct { + Config +} + +// Froze convert the Config to API +func (cfg Config) Froze() API { + api := &frozenConfig{Config: cfg} + return api +} + +func (cfg frozenConfig) marshalOptions(val interface{}, prefix, indent string) ([]byte, error) { + w := bytes.NewBuffer([]byte{}) + enc := json.NewEncoder(w) + enc.SetEscapeHTML(cfg.EscapeHTML) + enc.SetIndent(prefix, indent) + err := enc.Encode(val) + out := w.Bytes() + + // json.Encoder always appends '\n' after encoding, + // which is not same with json.Marshal() + if len(out) > 0 && out[len(out)-1] == '\n' { + out = out[:len(out)-1] + } + return out, err +} + +// Marshal is implemented by sonic +func (cfg frozenConfig) Marshal(val interface{}) ([]byte, error) { + if !cfg.EscapeHTML { + return cfg.marshalOptions(val, "", "") + } + return json.Marshal(val) +} + +// MarshalToString is implemented by sonic +func (cfg frozenConfig) MarshalToString(val interface{}) (string, error) { + out, err := cfg.Marshal(val) + return string(out), err +} + +// MarshalIndent is implemented by sonic +func (cfg frozenConfig) MarshalIndent(val interface{}, prefix, indent string) ([]byte, error) { + if !cfg.EscapeHTML { + return cfg.marshalOptions(val, prefix, indent) + } + return json.MarshalIndent(val, prefix, indent) +} + +// UnmarshalFromString is implemented by sonic +func (cfg frozenConfig) UnmarshalFromString(buf string, val interface{}) error { + r := bytes.NewBufferString(buf) + dec := json.NewDecoder(r) + if cfg.UseNumber { + dec.UseNumber() + } + if cfg.DisallowUnknownFields { + dec.DisallowUnknownFields() + } + return dec.Decode(val) +} + +// Unmarshal is implemented by sonic +func (cfg frozenConfig) Unmarshal(buf []byte, val interface{}) error { + return cfg.UnmarshalFromString(string(buf), val) +} + +// NewEncoder is implemented by sonic +func (cfg frozenConfig) NewEncoder(writer io.Writer) Encoder { + enc := json.NewEncoder(writer) + if !cfg.EscapeHTML { + enc.SetEscapeHTML(cfg.EscapeHTML) + } + return enc +} + +// NewDecoder is implemented by sonic +func (cfg frozenConfig) NewDecoder(reader io.Reader) Decoder { + dec := json.NewDecoder(reader) + if cfg.UseNumber { + dec.UseNumber() + } + if cfg.DisallowUnknownFields { + dec.DisallowUnknownFields() + } + return dec +} + +// Valid is implemented by sonic +func (cfg frozenConfig) Valid(data []byte) bool { + return json.Valid(data) +} + +// Pretouch compiles vt ahead-of-time to avoid JIT compilation on-the-fly, in +// order to reduce the first-hit latency at **amd64** Arch. +// Opts are the compile options, for example, "option.WithCompileRecursiveDepth" is +// a compile option to set the depth of recursive compile for the nested struct type. +// * This is the none implement for !amd64. +// It will be useful for someone who develop with !amd64 arch,like Mac M1. +func Pretouch(vt reflect.Type, opts ...option.CompileOption) error { + return nil +} + diff --git a/vendor/github.com/bytedance/sonic/decoder/decoder_compat.go b/vendor/github.com/bytedance/sonic/decoder/decoder_compat.go new file mode 100644 index 00000000..754e5fbc --- /dev/null +++ b/vendor/github.com/bytedance/sonic/decoder/decoder_compat.go @@ -0,0 +1,201 @@ +//go:build (!amd64 && !arm64) || go1.25 || !go1.17 || (arm64 && !go1.20) +// +build !amd64,!arm64 go1.25 !go1.17 arm64,!go1.20 + +/* +* Copyright 2023 ByteDance Inc. +* +* Licensed under the Apache License, Version 2.0 (the "License"); +* you may not use this file except in compliance with the License. +* You may obtain a copy of the License at +* +* http://www.apache.org/licenses/LICENSE-2.0 +* +* Unless required by applicable law or agreed to in writing, software +* distributed under the License is distributed on an "AS IS" BASIS, +* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +* See the License for the specific language governing permissions and +* limitations under the License. + */ + +package decoder + +import ( + "bytes" + "encoding/json" + "io" + "reflect" + "unsafe" + + "github.com/bytedance/sonic/internal/decoder/consts" + "github.com/bytedance/sonic/internal/native/types" + "github.com/bytedance/sonic/option" + "github.com/bytedance/sonic/internal/compat" +) + +func init() { + compat.Warn("sonic/decoder") +} + +const ( + _F_use_int64 = consts.F_use_int64 + _F_disable_urc = consts.F_disable_unknown + _F_disable_unknown = consts.F_disable_unknown + _F_copy_string = consts.F_copy_string + + _F_use_number = consts.F_use_number + _F_validate_string = consts.F_validate_string + _F_allow_control = consts.F_allow_control + _F_no_validate_json = consts.F_no_validate_json + _F_case_sensitive = consts.F_case_sensitive +) + +type Options uint64 + +const ( + OptionUseInt64 Options = 1 << _F_use_int64 + OptionUseNumber Options = 1 << _F_use_number + OptionUseUnicodeErrors Options = 1 << _F_disable_urc + OptionDisableUnknown Options = 1 << _F_disable_unknown + OptionCopyString Options = 1 << _F_copy_string + OptionValidateString Options = 1 << _F_validate_string + OptionNoValidateJSON Options = 1 << _F_no_validate_json + OptionCaseSensitive Options = 1 << _F_case_sensitive +) + +func (self *Decoder) SetOptions(opts Options) { + if (opts & OptionUseNumber != 0) && (opts & OptionUseInt64 != 0) { + panic("can't set OptionUseInt64 and OptionUseNumber both!") + } + self.f = uint64(opts) +} + + +// Decoder is the decoder context object +type Decoder struct { + i int + f uint64 + s string +} + +// NewDecoder creates a new decoder instance. +func NewDecoder(s string) *Decoder { + return &Decoder{s: s} +} + +// Pos returns the current decoding position. +func (self *Decoder) Pos() int { + return self.i +} + +func (self *Decoder) Reset(s string) { + self.s = s + self.i = 0 + // self.f = 0 +} + +// NOTE: api fallback do nothing +func (self *Decoder) CheckTrailings() error { + pos := self.i + buf := self.s + /* skip all the trailing spaces */ + if pos != len(buf) { + for pos < len(buf) && (types.SPACE_MASK & (1 << buf[pos])) != 0 { + pos++ + } + } + + /* then it must be at EOF */ + if pos == len(buf) { + return nil + } + + /* junk after JSON value */ + return nil +} + + +// Decode parses the JSON-encoded data from current position and stores the result +// in the value pointed to by val. +func (self *Decoder) Decode(val interface{}) error { + r := bytes.NewBufferString(self.s) + dec := json.NewDecoder(r) + if (self.f & uint64(OptionUseNumber)) != 0 { + dec.UseNumber() + } + if (self.f & uint64(OptionDisableUnknown)) != 0 { + dec.DisallowUnknownFields() + } + return dec.Decode(val) +} + +// UseInt64 indicates the Decoder to unmarshal an integer into an interface{} as an +// int64 instead of as a float64. +func (self *Decoder) UseInt64() { + self.f |= 1 << _F_use_int64 + self.f &^= 1 << _F_use_number +} + +// UseNumber indicates the Decoder to unmarshal a number into an interface{} as a +// json.Number instead of as a float64. +func (self *Decoder) UseNumber() { + self.f &^= 1 << _F_use_int64 + self.f |= 1 << _F_use_number +} + +// UseUnicodeErrors indicates the Decoder to return an error when encounter invalid +// UTF-8 escape sequences. +func (self *Decoder) UseUnicodeErrors() { + self.f |= 1 << _F_disable_urc +} + +// DisallowUnknownFields indicates the Decoder to return an error when the destination +// is a struct and the input contains object keys which do not match any +// non-ignored, exported fields in the destination. +func (self *Decoder) DisallowUnknownFields() { + self.f |= 1 << _F_disable_unknown +} + +// CopyString indicates the Decoder to decode string values by copying instead of referring. +func (self *Decoder) CopyString() { + self.f |= 1 << _F_copy_string +} + +// ValidateString causes the Decoder to validate string values when decoding string value +// in JSON. Validation is that, returning error when unescaped control chars(0x00-0x1f) or +// invalid UTF-8 chars in the string value of JSON. +func (self *Decoder) ValidateString() { + self.f |= 1 << _F_validate_string +} + +// Pretouch compiles vt ahead-of-time to avoid JIT compilation on-the-fly, in +// order to reduce the first-hit latency. +// +// Opts are the compile options, for example, "option.WithCompileRecursiveDepth" is +// a compile option to set the depth of recursive compile for the nested struct type. +func Pretouch(vt reflect.Type, opts ...option.CompileOption) error { + return nil +} + +type StreamDecoder = json.Decoder + +// NewStreamDecoder adapts to encoding/json.NewDecoder API. +// +// NewStreamDecoder returns a new decoder that reads from r. +func NewStreamDecoder(r io.Reader) *StreamDecoder { + return json.NewDecoder(r) +} + +// SyntaxError represents json syntax error +type SyntaxError json.SyntaxError + +// Description +func (s SyntaxError) Description() string { + return (*json.SyntaxError)(unsafe.Pointer(&s)).Error() +} +// Error +func (s SyntaxError) Error() string { + return (*json.SyntaxError)(unsafe.Pointer(&s)).Error() +} + +// MismatchTypeError represents mismatching between json and object +type MismatchTypeError json.UnmarshalTypeError diff --git a/vendor/github.com/bytedance/sonic/decoder/decoder_native.go b/vendor/github.com/bytedance/sonic/decoder/decoder_native.go new file mode 100644 index 00000000..563ca944 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/decoder/decoder_native.go @@ -0,0 +1,72 @@ +//go:build (amd64 && go1.17 && !go1.25) || (arm64 && go1.20 && !go1.25) +// +build amd64,go1.17,!go1.25 arm64,go1.20,!go1.25 + + +/* +* Copyright 2023 ByteDance Inc. +* +* Licensed under the Apache License, Version 2.0 (the "License"); +* you may not use this file except in compliance with the License. +* You may obtain a copy of the License at +* +* http://www.apache.org/licenses/LICENSE-2.0 +* +* Unless required by applicable law or agreed to in writing, software +* distributed under the License is distributed on an "AS IS" BASIS, +* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +* See the License for the specific language governing permissions and +* limitations under the License. +*/ + +package decoder + +import ( + `github.com/bytedance/sonic/internal/decoder/api` +) + +// Decoder is the decoder context object +type Decoder = api.Decoder + +// SyntaxError represents json syntax error +type SyntaxError = api.SyntaxError + +// MismatchTypeError represents mismatching between json and object +type MismatchTypeError = api.MismatchTypeError + +// Options for decode. +type Options = api.Options + +const ( + OptionUseInt64 Options = api.OptionUseInt64 + OptionUseNumber Options = api.OptionUseNumber + OptionUseUnicodeErrors Options = api.OptionUseUnicodeErrors + OptionDisableUnknown Options = api.OptionDisableUnknown + OptionCopyString Options = api.OptionCopyString + OptionValidateString Options = api.OptionValidateString + OptionNoValidateJSON Options = api.OptionNoValidateJSON + OptionCaseSensitive Options = api.OptionCaseSensitive +) + +// StreamDecoder is the decoder context object for streaming input. +type StreamDecoder = api.StreamDecoder + +var ( + // NewDecoder creates a new decoder instance. + NewDecoder = api.NewDecoder + + // NewStreamDecoder adapts to encoding/json.NewDecoder API. + // + // NewStreamDecoder returns a new decoder that reads from r. + NewStreamDecoder = api.NewStreamDecoder + + // Pretouch compiles vt ahead-of-time to avoid JIT compilation on-the-fly, in + // order to reduce the first-hit latency. + // + // Opts are the compile options, for example, "option.WithCompileRecursiveDepth" is + // a compile option to set the depth of recursive compile for the nested struct type. + Pretouch = api.Pretouch + + // Skip skips only one json value, and returns first non-blank character position and its ending position if it is valid. + // Otherwise, returns negative error code using start and invalid character position using end + Skip = api.Skip +) diff --git a/vendor/github.com/bytedance/sonic/encoder/encoder_compat.go b/vendor/github.com/bytedance/sonic/encoder/encoder_compat.go new file mode 100644 index 00000000..d48e99b1 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/encoder/encoder_compat.go @@ -0,0 +1,262 @@ +// +build !amd64,!arm64 go1.25 !go1.17 arm64,!go1.20 + +/* +* Copyright 2023 ByteDance Inc. +* +* Licensed under the Apache License, Version 2.0 (the "License"); +* you may not use this file except in compliance with the License. +* You may obtain a copy of the License at +* +* http://www.apache.org/licenses/LICENSE-2.0 +* +* Unless required by applicable law or agreed to in writing, software +* distributed under the License is distributed on an "AS IS" BASIS, +* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +* See the License for the specific language governing permissions and +* limitations under the License. +*/ + +package encoder + +import ( + `io` + `bytes` + `encoding/json` + `reflect` + + `github.com/bytedance/sonic/option` + `github.com/bytedance/sonic/internal/compat` +) + +func init() { + compat.Warn("sonic/encoder") +} + +// EnableFallback indicates if encoder use fallback +const EnableFallback = true + +// Options is a set of encoding options. +type Options uint64 + +const ( + bitSortMapKeys = iota + bitEscapeHTML + bitCompactMarshaler + bitNoQuoteTextMarshaler + bitNoNullSliceOrMap + bitValidateString + bitNoValidateJSONMarshaler + bitNoEncoderNewline + + // used for recursive compile + bitPointerValue = 63 +) + +const ( + // SortMapKeys indicates that the keys of a map needs to be sorted + // before serializing into JSON. + // WARNING: This hurts performance A LOT, USE WITH CARE. + SortMapKeys Options = 1 << bitSortMapKeys + + // EscapeHTML indicates encoder to escape all HTML characters + // after serializing into JSON (see https://pkg.go.dev/encoding/json#HTMLEscape). + // WARNING: This hurts performance A LOT, USE WITH CARE. + EscapeHTML Options = 1 << bitEscapeHTML + + // CompactMarshaler indicates that the output JSON from json.Marshaler + // is always compact and needs no validation + CompactMarshaler Options = 1 << bitCompactMarshaler + + // NoQuoteTextMarshaler indicates that the output text from encoding.TextMarshaler + // is always escaped string and needs no quoting + NoQuoteTextMarshaler Options = 1 << bitNoQuoteTextMarshaler + + // NoNullSliceOrMap indicates all empty Array or Object are encoded as '[]' or '{}', + // instead of 'null' + NoNullSliceOrMap Options = 1 << bitNoNullSliceOrMap + + // ValidateString indicates that encoder should validate the input string + // before encoding it into JSON. + ValidateString Options = 1 << bitValidateString + + // NoValidateJSONMarshaler indicates that the encoder should not validate the output string + // after encoding the JSONMarshaler to JSON. + NoValidateJSONMarshaler Options = 1 << bitNoValidateJSONMarshaler + + // NoEncoderNewline indicates that the encoder should not add a newline after every message + NoEncoderNewline Options = 1 << bitNoEncoderNewline + + // CompatibleWithStd is used to be compatible with std encoder. + CompatibleWithStd Options = SortMapKeys | EscapeHTML | CompactMarshaler +) + +// Encoder represents a specific set of encoder configurations. +type Encoder struct { + Opts Options + prefix string + indent string +} + +// Encode returns the JSON encoding of v. +func (self *Encoder) Encode(v interface{}) ([]byte, error) { + if self.indent != "" || self.prefix != "" { + return EncodeIndented(v, self.prefix, self.indent, self.Opts) + } + return Encode(v, self.Opts) +} + +// SortKeys enables the SortMapKeys option. +func (self *Encoder) SortKeys() *Encoder { + self.Opts |= SortMapKeys + return self +} + +// SetEscapeHTML specifies if option EscapeHTML opens +func (self *Encoder) SetEscapeHTML(f bool) { + if f { + self.Opts |= EscapeHTML + } else { + self.Opts &= ^EscapeHTML + } +} + +// SetValidateString specifies if option ValidateString opens +func (self *Encoder) SetValidateString(f bool) { + if f { + self.Opts |= ValidateString + } else { + self.Opts &= ^ValidateString + } +} + +// SetNoValidateJSONMarshaler specifies if option NoValidateJSONMarshaler opens +func (self *Encoder) SetNoValidateJSONMarshaler(f bool) { + if f { + self.Opts |= NoValidateJSONMarshaler + } else { + self.Opts &= ^NoValidateJSONMarshaler + } +} + +// SetNoEncoderNewline specifies if option NoEncoderNewline opens +func (self *Encoder) SetNoEncoderNewline(f bool) { + if f { + self.Opts |= NoEncoderNewline + } else { + self.Opts &= ^NoEncoderNewline + } +} + +// SetCompactMarshaler specifies if option CompactMarshaler opens +func (self *Encoder) SetCompactMarshaler(f bool) { + if f { + self.Opts |= CompactMarshaler + } else { + self.Opts &= ^CompactMarshaler + } +} + +// SetNoQuoteTextMarshaler specifies if option NoQuoteTextMarshaler opens +func (self *Encoder) SetNoQuoteTextMarshaler(f bool) { + if f { + self.Opts |= NoQuoteTextMarshaler + } else { + self.Opts &= ^NoQuoteTextMarshaler + } +} + +// SetIndent instructs the encoder to format each subsequent encoded +// value as if indented by the package-level function EncodeIndent(). +// Calling SetIndent("", "") disables indentation. +func (enc *Encoder) SetIndent(prefix, indent string) { + enc.prefix = prefix + enc.indent = indent +} + +// Quote returns the JSON-quoted version of s. +func Quote(s string) string { + /* check for empty string */ + if s == "" { + return `""` + } + + out, _ := json.Marshal(s) + return string(out) +} + +// Encode returns the JSON encoding of val, encoded with opts. +func Encode(val interface{}, opts Options) ([]byte, error) { + return json.Marshal(val) +} + +// EncodeInto is like Encode but uses a user-supplied buffer instead of allocating +// a new one. +func EncodeInto(buf *[]byte, val interface{}, opts Options) error { + if buf == nil { + panic("user-supplied buffer buf is nil") + } + w := bytes.NewBuffer(*buf) + enc := json.NewEncoder(w) + enc.SetEscapeHTML((opts & EscapeHTML) != 0) + err := enc.Encode(val) + *buf = w.Bytes() + l := len(*buf) + if l > 0 && (opts & NoEncoderNewline != 0) && (*buf)[l-1] == '\n' { + *buf = (*buf)[:l-1] + } + return err +} + +// HTMLEscape appends to dst the JSON-encoded src with <, >, &, U+2028 and U+2029 +// characters inside string literals changed to \u003c, \u003e, \u0026, \u2028, \u2029 +// so that the JSON will be safe to embed inside HTML - - -

Welcome, Ginner!

- - -`)) - -func main() { - r := gin.Default() - r.Static("/assets", "./assets") - r.SetHTMLTemplate(html) - - r.GET("/", func(c *gin.Context) { - if pusher := c.Writer.Pusher(); pusher != nil { - // use pusher.Push() to do server push - if err := pusher.Push("/assets/app.js", nil); err != nil { - log.Printf("Failed to push: %v", err) - } - } - c.HTML(http.StatusOK, "https", gin.H{ - "status": "success", - }) - }) - - // Listen and Server in https://127.0.0.1:8080 - r.RunTLS(":8080", "./testdata/server.pem", "./testdata/server.key") -} -``` - -### Define format for the log of routes - -The default log of routes is: -``` -[GIN-debug] POST /foo --> main.main.func1 (3 handlers) -[GIN-debug] GET /bar --> main.main.func2 (3 handlers) -[GIN-debug] GET /status --> main.main.func3 (3 handlers) -``` - -If you want to log this information in given format (e.g. JSON, key values or something else), then you can define this format with `gin.DebugPrintRouteFunc`. -In the example below, we log all routes with standard log package but you can use another log tools that suits of your needs. -```go -import ( - "log" - "net/http" - - "github.com/gin-gonic/gin" -) - -func main() { - r := gin.Default() - gin.DebugPrintRouteFunc = func(httpMethod, absolutePath, handlerName string, nuHandlers int) { - log.Printf("endpoint %v %v %v %v\n", httpMethod, absolutePath, handlerName, nuHandlers) - } - - r.POST("/foo", func(c *gin.Context) { - c.JSON(http.StatusOK, "foo") - }) - - r.GET("/bar", func(c *gin.Context) { - c.JSON(http.StatusOK, "bar") - }) - - r.GET("/status", func(c *gin.Context) { - c.JSON(http.StatusOK, "ok") - }) - - // Listen and Server in http://0.0.0.0:8080 - r.Run() -} -``` - -### Set and get a cookie - -```go -import ( - "fmt" - - "github.com/gin-gonic/gin" -) - -func main() { - - router := gin.Default() - - router.GET("/cookie", func(c *gin.Context) { - - cookie, err := c.Cookie("gin_cookie") - - if err != nil { - cookie = "NotSet" - c.SetCookie("gin_cookie", "test", 3600, "/", "localhost", false, true) - } - - fmt.Printf("Cookie value: %s \n", cookie) - }) - - router.Run() -} -``` - -## Don't trust all proxies - -Gin lets you specify which headers to hold the real client IP (if any), -as well as specifying which proxies (or direct clients) you trust to -specify one of these headers. - -Use function `SetTrustedProxies()` on your `gin.Engine` to specify network addresses -or network CIDRs from where clients which their request headers related to client -IP can be trusted. They can be IPv4 addresses, IPv4 CIDRs, IPv6 addresses or -IPv6 CIDRs. - -**Attention:** Gin trust all proxies by default if you don't specify a trusted -proxy using the function above, **this is NOT safe**. At the same time, if you don't -use any proxy, you can disable this feature by using `Engine.SetTrustedProxies(nil)`, -then `Context.ClientIP()` will return the remote address directly to avoid some -unnecessary computation. - -```go -import ( - "fmt" - - "github.com/gin-gonic/gin" -) - -func main() { - - router := gin.Default() - router.SetTrustedProxies([]string{"192.168.1.2"}) - - router.GET("/", func(c *gin.Context) { - // If the client is 192.168.1.2, use the X-Forwarded-For - // header to deduce the original client IP from the trust- - // worthy parts of that header. - // Otherwise, simply return the direct client IP - fmt.Printf("ClientIP: %s\n", c.ClientIP()) - }) - router.Run() -} -``` - -**Notice:** If you are using a CDN service, you can set the `Engine.TrustedPlatform` -to skip TrustedProxies check, it has a higher priority than TrustedProxies. -Look at the example below: -```go -import ( - "fmt" - - "github.com/gin-gonic/gin" -) - -func main() { - - router := gin.Default() - // Use predefined header gin.PlatformXXX - router.TrustedPlatform = gin.PlatformGoogleAppEngine - // Or set your own trusted request header for another trusted proxy service - // Don't set it to any suspect request header, it's unsafe - router.TrustedPlatform = "X-CDN-IP" - - router.GET("/", func(c *gin.Context) { - // If you set TrustedPlatform, ClientIP() will resolve the - // corresponding header and return IP directly - fmt.Printf("ClientIP: %s\n", c.ClientIP()) - }) - router.Run() -} -``` - -## Testing - -The `net/http/httptest` package is preferable way for HTTP testing. - -```go -package main - -import ( - "net/http" - - "github.com/gin-gonic/gin" -) - -func setupRouter() *gin.Engine { - r := gin.Default() - r.GET("/ping", func(c *gin.Context) { - c.String(http.StatusOK, "pong") - }) - return r -} - -func main() { - r := setupRouter() - r.Run(":8080") -} -``` - -Test for code example above: - -```go -package main - -import ( - "net/http" - "net/http/httptest" - "testing" - - "github.com/stretchr/testify/assert" -) - -func TestPingRoute(t *testing.T) { - router := setupRouter() - - w := httptest.NewRecorder() - req, _ := http.NewRequest(http.MethodGet, "/ping", nil) - router.ServeHTTP(w, req) - - assert.Equal(t, http.StatusOK, w.Code) - assert.Equal(t, "pong", w.Body.String()) -} -``` - -## Users - -Awesome project lists using [Gin](https://github.com/gin-gonic/gin) web framework. - -* [gorush](https://github.com/appleboy/gorush): A push notification server written in Go. -* [fnproject](https://github.com/fnproject/fn): The container native, cloud agnostic serverless platform. -* [photoprism](https://github.com/photoprism/photoprism): Personal photo management powered by Go and Google TensorFlow. -* [krakend](https://github.com/devopsfaith/krakend): Ultra performant API Gateway with middlewares. -* [picfit](https://github.com/thoas/picfit): An image resizing server written in Go. -* [brigade](https://github.com/brigadecore/brigade): Event-based Scripting for Kubernetes. -* [dkron](https://github.com/distribworks/dkron): Distributed, fault tolerant job scheduling system. +Gin is the work of hundreds of contributors. We appreciate your help! +Please see [CONTRIBUTING](CONTRIBUTING.md) for details on submitting patches and the contribution workflow. diff --git a/vendor/github.com/gin-gonic/gin/any.go b/vendor/github.com/gin-gonic/gin/any.go deleted file mode 100644 index 42b1ea46..00000000 --- a/vendor/github.com/gin-gonic/gin/any.go +++ /dev/null @@ -1,10 +0,0 @@ -// Copyright 2022 Gin Core Team. All rights reserved. -// Use of this source code is governed by a MIT style -// license that can be found in the LICENSE file. - -//go:build !go1.18 -// +build !go1.18 - -package gin - -type any = interface{} diff --git a/vendor/github.com/gin-gonic/gin/auth.go b/vendor/github.com/gin-gonic/gin/auth.go index 2503c515..5d3222d5 100644 --- a/vendor/github.com/gin-gonic/gin/auth.go +++ b/vendor/github.com/gin-gonic/gin/auth.go @@ -16,6 +16,9 @@ import ( // AuthUserKey is the cookie name for user credential in basic auth. const AuthUserKey = "user" +// AuthProxyUserKey is the cookie name for proxy_user credential in basic auth for proxy. +const AuthProxyUserKey = "proxy_user" + // Accounts defines a key/value for user/pass list of authorized logins. type Accounts map[string]string @@ -89,3 +92,25 @@ func authorizationHeader(user, password string) string { base := user + ":" + password return "Basic " + base64.StdEncoding.EncodeToString(bytesconv.StringToBytes(base)) } + +// BasicAuthForProxy returns a Basic HTTP Proxy-Authorization middleware. +// If the realm is empty, "Proxy Authorization Required" will be used by default. +func BasicAuthForProxy(accounts Accounts, realm string) HandlerFunc { + if realm == "" { + realm = "Proxy Authorization Required" + } + realm = "Basic realm=" + strconv.Quote(realm) + pairs := processAccounts(accounts) + return func(c *Context) { + proxyUser, found := pairs.searchCredential(c.requestHeader("Proxy-Authorization")) + if !found { + // Credentials doesn't match, we return 407 and abort handlers chain. + c.Header("Proxy-Authenticate", realm) + c.AbortWithStatus(http.StatusProxyAuthRequired) + return + } + // The proxy_user credentials was found, set proxy_user's id to key AuthProxyUserKey in this context, the proxy_user's id can be read later using + // c.MustGet(gin.AuthProxyUserKey). + c.Set(AuthProxyUserKey, proxyUser) + } +} diff --git a/vendor/github.com/gin-gonic/gin/binding/any.go b/vendor/github.com/gin-gonic/gin/binding/any.go deleted file mode 100644 index d8251a7c..00000000 --- a/vendor/github.com/gin-gonic/gin/binding/any.go +++ /dev/null @@ -1,10 +0,0 @@ -// Copyright 2022 Gin Core Team. All rights reserved. -// Use of this source code is governed by a MIT style -// license that can be found in the LICENSE file. - -//go:build !go1.18 -// +build !go1.18 - -package binding - -type any = interface{} diff --git a/vendor/github.com/gin-gonic/gin/binding/binding.go b/vendor/github.com/gin-gonic/gin/binding/binding.go index a58924ed..94723879 100644 --- a/vendor/github.com/gin-gonic/gin/binding/binding.go +++ b/vendor/github.com/gin-gonic/gin/binding/binding.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !nomsgpack -// +build !nomsgpack package binding @@ -22,6 +21,7 @@ const ( MIMEMSGPACK = "application/x-msgpack" MIMEMSGPACK2 = "application/msgpack" MIMEYAML = "application/x-yaml" + MIMEYAML2 = "application/yaml" MIMETOML = "application/toml" ) @@ -73,18 +73,18 @@ var Validator StructValidator = &defaultValidator{} // These implement the Binding interface and can be used to bind the data // present in the request to struct instances. var ( - JSON = jsonBinding{} - XML = xmlBinding{} - Form = formBinding{} - Query = queryBinding{} - FormPost = formPostBinding{} - FormMultipart = formMultipartBinding{} - ProtoBuf = protobufBinding{} - MsgPack = msgpackBinding{} - YAML = yamlBinding{} - Uri = uriBinding{} - Header = headerBinding{} - TOML = tomlBinding{} + JSON BindingBody = jsonBinding{} + XML BindingBody = xmlBinding{} + Form Binding = formBinding{} + Query Binding = queryBinding{} + FormPost Binding = formPostBinding{} + FormMultipart Binding = formMultipartBinding{} + ProtoBuf BindingBody = protobufBinding{} + MsgPack BindingBody = msgpackBinding{} + YAML BindingBody = yamlBinding{} + Uri BindingUri = uriBinding{} + Header Binding = headerBinding{} + TOML BindingBody = tomlBinding{} ) // Default returns the appropriate Binding instance based on the HTTP method @@ -103,7 +103,7 @@ func Default(method, contentType string) Binding { return ProtoBuf case MIMEMSGPACK, MIMEMSGPACK2: return MsgPack - case MIMEYAML: + case MIMEYAML, MIMEYAML2: return YAML case MIMETOML: return TOML diff --git a/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go b/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go index 7f6a904a..552a86b2 100644 --- a/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go +++ b/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build nomsgpack -// +build nomsgpack package binding @@ -20,6 +19,7 @@ const ( MIMEMultipartPOSTForm = "multipart/form-data" MIMEPROTOBUF = "application/x-protobuf" MIMEYAML = "application/x-yaml" + MIMEYAML2 = "application/yaml" MIMETOML = "application/toml" ) @@ -97,7 +97,7 @@ func Default(method, contentType string) Binding { return XML case MIMEPROTOBUF: return ProtoBuf - case MIMEYAML: + case MIMEYAML, MIMEYAML2: return YAML case MIMEMultipartPOSTForm: return FormMultipart diff --git a/vendor/github.com/gin-gonic/gin/binding/default_validator.go b/vendor/github.com/gin-gonic/gin/binding/default_validator.go index c03afe75..ac43d7cc 100644 --- a/vendor/github.com/gin-gonic/gin/binding/default_validator.go +++ b/vendor/github.com/gin-gonic/gin/binding/default_validator.go @@ -43,7 +43,7 @@ func (err SliceValidationError) Error() string { } } -var _ StructValidator = &defaultValidator{} +var _ StructValidator = (*defaultValidator)(nil) // ValidateStruct receives any kind of type, but only performed struct or pointer to struct type. func (v *defaultValidator) ValidateStruct(obj any) error { @@ -54,7 +54,10 @@ func (v *defaultValidator) ValidateStruct(obj any) error { value := reflect.ValueOf(obj) switch value.Kind() { case reflect.Ptr: - return v.ValidateStruct(value.Elem().Interface()) + if value.Elem().Kind() != reflect.Struct { + return v.ValidateStruct(value.Elem().Interface()) + } + return v.validateStruct(obj) case reflect.Struct: return v.validateStruct(obj) case reflect.Slice, reflect.Array: diff --git a/vendor/github.com/gin-gonic/gin/binding/form_mapping.go b/vendor/github.com/gin-gonic/gin/binding/form_mapping.go index 98cebfec..db235e56 100644 --- a/vendor/github.com/gin-gonic/gin/binding/form_mapping.go +++ b/vendor/github.com/gin-gonic/gin/binding/form_mapping.go @@ -7,6 +7,7 @@ package binding import ( "errors" "fmt" + "mime/multipart" "reflect" "strconv" "strings" @@ -19,7 +20,7 @@ import ( var ( errUnknownType = errors.New("unknown type") - // ErrConvertMapStringSlice can not covert to map[string][]string + // ErrConvertMapStringSlice can not convert to map[string][]string ErrConvertMapStringSlice = errors.New("can not convert to map slices of strings") // ErrConvertToMapString can not convert to map[string]string @@ -164,6 +165,23 @@ func tryToSetValue(value reflect.Value, field reflect.StructField, setter setter return setter.TrySet(value, field, tagValue, setOpt) } +// BindUnmarshaler is the interface used to wrap the UnmarshalParam method. +type BindUnmarshaler interface { + // UnmarshalParam decodes and assigns a value from an form or query param. + UnmarshalParam(param string) error +} + +// trySetCustom tries to set a custom type value +// If the value implements the BindUnmarshaler interface, it will be used to set the value, we will return `true` +// to skip the default value setting. +func trySetCustom(val string, value reflect.Value) (isSet bool, err error) { + switch v := value.Addr().Interface().(type) { + case BindUnmarshaler: + return true, v.UnmarshalParam(val) + } + return false, nil +} + func setByForm(value reflect.Value, field reflect.StructField, form map[string][]string, tagValue string, opt setOptions) (isSet bool, err error) { vs, ok := form[tagValue] if !ok && !opt.isDefaultExists { @@ -193,6 +211,9 @@ func setByForm(value reflect.Value, field reflect.StructField, form map[string][ if len(vs) > 0 { val = vs[0] } + if ok, err := trySetCustom(val, value); ok { + return ok, err + } return true, setWithProperType(val, value, field) } } @@ -235,10 +256,17 @@ func setWithProperType(val string, value reflect.Value, field reflect.StructFiel switch value.Interface().(type) { case time.Time: return setTimeField(val, field, value) + case multipart.FileHeader: + return nil } return json.Unmarshal(bytesconv.StringToBytes(val), value.Addr().Interface()) case reflect.Map: return json.Unmarshal(bytesconv.StringToBytes(val), value.Addr().Interface()) + case reflect.Ptr: + if !value.Elem().IsValid() { + value.Set(reflect.New(value.Type().Elem())) + } + return setWithProperType(val, value.Elem(), field) default: return errUnknownType } diff --git a/vendor/github.com/gin-gonic/gin/binding/json.go b/vendor/github.com/gin-gonic/gin/binding/json.go index 36eb27a3..e21c2ee3 100644 --- a/vendor/github.com/gin-gonic/gin/binding/json.go +++ b/vendor/github.com/gin-gonic/gin/binding/json.go @@ -15,7 +15,7 @@ import ( // EnableDecoderUseNumber is used to call the UseNumber method on the JSON // Decoder instance. UseNumber causes the Decoder to unmarshal a number into an -// interface{} as a Number instead of as a float64. +// any as a Number instead of as a float64. var EnableDecoderUseNumber = false // EnableDecoderDisallowUnknownFields is used to call the DisallowUnknownFields method diff --git a/vendor/github.com/gin-gonic/gin/binding/msgpack.go b/vendor/github.com/gin-gonic/gin/binding/msgpack.go index d1f035e4..22de9b55 100644 --- a/vendor/github.com/gin-gonic/gin/binding/msgpack.go +++ b/vendor/github.com/gin-gonic/gin/binding/msgpack.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !nomsgpack -// +build !nomsgpack package binding diff --git a/vendor/github.com/gin-gonic/gin/binding/protobuf.go b/vendor/github.com/gin-gonic/gin/binding/protobuf.go index 44f2fdb9..57721fc9 100644 --- a/vendor/github.com/gin-gonic/gin/binding/protobuf.go +++ b/vendor/github.com/gin-gonic/gin/binding/protobuf.go @@ -6,7 +6,7 @@ package binding import ( "errors" - "io/ioutil" + "io" "net/http" "google.golang.org/protobuf/proto" @@ -19,7 +19,7 @@ func (protobufBinding) Name() string { } func (b protobufBinding) Bind(req *http.Request, obj any) error { - buf, err := ioutil.ReadAll(req.Body) + buf, err := io.ReadAll(req.Body) if err != nil { return err } diff --git a/vendor/github.com/gin-gonic/gin/binding/toml.go b/vendor/github.com/gin-gonic/gin/binding/toml.go index a6b8a90a..a66b93aa 100644 --- a/vendor/github.com/gin-gonic/gin/binding/toml.go +++ b/vendor/github.com/gin-gonic/gin/binding/toml.go @@ -18,14 +18,6 @@ func (tomlBinding) Name() string { return "toml" } -func decodeToml(r io.Reader, obj any) error { - decoder := toml.NewDecoder(r) - if err := decoder.Decode(obj); err != nil { - return err - } - return decoder.Decode(obj) -} - func (tomlBinding) Bind(req *http.Request, obj any) error { return decodeToml(req.Body, obj) } @@ -33,3 +25,11 @@ func (tomlBinding) Bind(req *http.Request, obj any) error { func (tomlBinding) BindBody(body []byte, obj any) error { return decodeToml(bytes.NewReader(body), obj) } + +func decodeToml(r io.Reader, obj any) error { + decoder := toml.NewDecoder(r) + if err := decoder.Decode(obj); err != nil { + return err + } + return decoder.Decode(obj) +} diff --git a/vendor/github.com/gin-gonic/gin/binding/yaml.go b/vendor/github.com/gin-gonic/gin/binding/yaml.go index b0d36a35..2535f8c3 100644 --- a/vendor/github.com/gin-gonic/gin/binding/yaml.go +++ b/vendor/github.com/gin-gonic/gin/binding/yaml.go @@ -9,7 +9,7 @@ import ( "io" "net/http" - "gopkg.in/yaml.v2" + "gopkg.in/yaml.v3" ) type yamlBinding struct{} diff --git a/vendor/github.com/gin-gonic/gin/codecov.yml b/vendor/github.com/gin-gonic/gin/codecov.yml index c9c9a522..47782e50 100644 --- a/vendor/github.com/gin-gonic/gin/codecov.yml +++ b/vendor/github.com/gin-gonic/gin/codecov.yml @@ -1,5 +1,13 @@ coverage: - notify: - gitter: + require_ci_to_pass: true + + status: + project: default: - url: https://webhooks.gitter.im/e/d90dcdeeab2f1e357165 + target: 99% + threshold: 99% + + patch: + default: + target: 99% + threshold: 95% \ No newline at end of file diff --git a/vendor/github.com/gin-gonic/gin/context.go b/vendor/github.com/gin-gonic/gin/context.go index b1ad95e6..391adafe 100644 --- a/vendor/github.com/gin-gonic/gin/context.go +++ b/vendor/github.com/gin-gonic/gin/context.go @@ -7,7 +7,6 @@ package gin import ( "errors" "io" - "io/ioutil" "log" "math" "mime/multipart" @@ -15,6 +14,7 @@ import ( "net/http" "net/url" "os" + "path/filepath" "strings" "sync" "time" @@ -43,6 +43,10 @@ const BodyBytesKey = "_gin-gonic/gin/bodybyteskey" // ContextKey is the key that a Context returns itself for. const ContextKey = "_gin-gonic/gin/contextkey" +type ContextKeyType int + +const ContextRequestKey ContextKeyType = 0 + // abortIndex represents a typical value used in abort functions. const abortIndex int8 = math.MaxInt8 >> 1 @@ -113,20 +117,27 @@ func (c *Context) Copy() *Context { cp := Context{ writermem: c.writermem, Request: c.Request, - Params: c.Params, engine: c.engine, } + cp.writermem.ResponseWriter = nil cp.Writer = &cp.writermem cp.index = abortIndex cp.handlers = nil - cp.Keys = map[string]any{} - for k, v := range c.Keys { + cp.fullPath = c.fullPath + + cKeys := c.Keys + cp.Keys = make(map[string]any, len(cKeys)) + c.mu.RLock() + for k, v := range cKeys { cp.Keys[k] = v } - paramCopy := make([]Param, len(cp.Params)) - copy(paramCopy, cp.Params) - cp.Params = paramCopy + c.mu.RUnlock() + + cParams := c.Params + cp.Params = make([]Param, len(cParams)) + copy(cp.Params, cParams) + return &cp } @@ -153,9 +164,10 @@ func (c *Context) Handler() HandlerFunc { // FullPath returns a matched route full path. For not found routes // returns an empty string. -// router.GET("/user/:id", func(c *gin.Context) { -// c.FullPath() == "/user/:id" // true -// }) +// +// router.GET("/user/:id", func(c *gin.Context) { +// c.FullPath() == "/user/:id" // true +// }) func (c *Context) FullPath() string { return c.fullPath } @@ -247,20 +259,20 @@ func (c *Context) Error(err error) *Error { // It also lazy initializes c.Keys if it was not used previously. func (c *Context) Set(key string, value any) { c.mu.Lock() + defer c.mu.Unlock() if c.Keys == nil { c.Keys = make(map[string]any) } c.Keys[key] = value - c.mu.Unlock() } // Get returns the value for the given key, ie: (value, true). // If the value does not exist it returns (nil, false) func (c *Context) Get(key string) (value any, exists bool) { c.mu.RLock() + defer c.mu.RUnlock() value, exists = c.Keys[key] - c.mu.RUnlock() return } @@ -382,10 +394,13 @@ func (c *Context) GetStringMapStringSlice(key string) (smss map[string][]string) // Param returns the value of the URL param. // It is a shortcut for c.Params.ByName(key) -// router.GET("/user/:id", func(c *gin.Context) { -// // a GET request to /user/john -// id := c.Param("id") // id == "john" -// }) +// +// router.GET("/user/:id", func(c *gin.Context) { +// // a GET request to /user/john +// id := c.Param("id") // id == "john" +// // a GET request to /user/john/ +// id := c.Param("id") // id == "/john/" +// }) func (c *Context) Param(key string) string { return c.Params.ByName(key) } @@ -402,11 +417,12 @@ func (c *Context) AddParam(key, value string) { // Query returns the keyed url query value if it exists, // otherwise it returns an empty string `("")`. // It is shortcut for `c.Request.URL.Query().Get(key)` -// GET /path?id=1234&name=Manu&value= -// c.Query("id") == "1234" -// c.Query("name") == "Manu" -// c.Query("value") == "" -// c.Query("wtf") == "" +// +// GET /path?id=1234&name=Manu&value= +// c.Query("id") == "1234" +// c.Query("name") == "Manu" +// c.Query("value") == "" +// c.Query("wtf") == "" func (c *Context) Query(key string) (value string) { value, _ = c.GetQuery(key) return @@ -415,10 +431,11 @@ func (c *Context) Query(key string) (value string) { // DefaultQuery returns the keyed url query value if it exists, // otherwise it returns the specified defaultValue string. // See: Query() and GetQuery() for further information. -// GET /?name=Manu&lastname= -// c.DefaultQuery("name", "unknown") == "Manu" -// c.DefaultQuery("id", "none") == "none" -// c.DefaultQuery("lastname", "none") == "" +// +// GET /?name=Manu&lastname= +// c.DefaultQuery("name", "unknown") == "Manu" +// c.DefaultQuery("id", "none") == "none" +// c.DefaultQuery("lastname", "none") == "" func (c *Context) DefaultQuery(key, defaultValue string) string { if value, ok := c.GetQuery(key); ok { return value @@ -430,10 +447,11 @@ func (c *Context) DefaultQuery(key, defaultValue string) string { // if it exists `(value, true)` (even when the value is an empty string), // otherwise it returns `("", false)`. // It is shortcut for `c.Request.URL.Query().Get(key)` -// GET /?name=Manu&lastname= -// ("Manu", true) == c.GetQuery("name") -// ("", false) == c.GetQuery("id") -// ("", true) == c.GetQuery("lastname") +// +// GET /?name=Manu&lastname= +// ("Manu", true) == c.GetQuery("name") +// ("", false) == c.GetQuery("id") +// ("", true) == c.GetQuery("lastname") func (c *Context) GetQuery(key string) (string, bool) { if values, ok := c.GetQueryArray(key); ok { return values[0], ok @@ -500,9 +518,10 @@ func (c *Context) DefaultPostForm(key, defaultValue string) string { // form or multipart form when it exists `(value, true)` (even when the value is an empty string), // otherwise it returns ("", false). // For example, during a PATCH request to update the user's email: -// email=mail@example.com --> ("mail@example.com", true) := GetPostForm("email") // set email to "mail@example.com" -// email= --> ("", true) := GetPostForm("email") // set email to "" -// --> ("", false) := GetPostForm("email") // do nothing with email +// +// email=mail@example.com --> ("mail@example.com", true) := GetPostForm("email") // set email to "mail@example.com" +// email= --> ("", true) := GetPostForm("email") // set email to "" +// --> ("", false) := GetPostForm("email") // do nothing with email func (c *Context) GetPostForm(key string) (string, bool) { if values, ok := c.GetPostFormArray(key); ok { return values[0], ok @@ -551,7 +570,7 @@ func (c *Context) GetPostFormMap(key string) (map[string]string, bool) { return c.get(c.formCache, key) } -// get is an internal method and returns a map which satisfy conditions. +// get is an internal method and returns a map which satisfies conditions. func (c *Context) get(m map[string][]string, key string) (map[string]string, bool) { dicts := make(map[string]string) exist := false @@ -595,6 +614,10 @@ func (c *Context) SaveUploadedFile(file *multipart.FileHeader, dst string) error } defer src.Close() + if err = os.MkdirAll(filepath.Dir(dst), 0750); err != nil { + return err + } + out, err := os.Create(dst) if err != nil { return err @@ -607,8 +630,10 @@ func (c *Context) SaveUploadedFile(file *multipart.FileHeader, dst string) error // Bind checks the Method and Content-Type to select a binding engine automatically, // Depending on the "Content-Type" header different bindings are used, for example: -// "application/json" --> JSON binding -// "application/xml" --> XML binding +// +// "application/json" --> JSON binding +// "application/xml" --> XML binding +// // It parses the request's body as JSON if Content-Type == "application/json" using JSON or XML as a JSON input. // It decodes the json payload into the struct specified as a pointer. // It writes a 400 error and sets Content-Type header "text/plain" in the response if input is not valid. @@ -638,7 +663,7 @@ func (c *Context) BindYAML(obj any) error { } // BindTOML is a shortcut for c.MustBindWith(obj, binding.TOML). -func (c *Context) BindTOML(obj interface{}) error { +func (c *Context) BindTOML(obj any) error { return c.MustBindWith(obj, binding.TOML) } @@ -651,7 +676,7 @@ func (c *Context) BindHeader(obj any) error { // It will abort the request with HTTP 400 if any error occurs. func (c *Context) BindUri(obj any) error { if err := c.ShouldBindUri(obj); err != nil { - c.AbortWithError(http.StatusBadRequest, err).SetType(ErrorTypeBind) // nolint: errcheck + c.AbortWithError(http.StatusBadRequest, err).SetType(ErrorTypeBind) //nolint: errcheck return err } return nil @@ -662,7 +687,7 @@ func (c *Context) BindUri(obj any) error { // See the binding package. func (c *Context) MustBindWith(obj any, b binding.Binding) error { if err := c.ShouldBindWith(obj, b); err != nil { - c.AbortWithError(http.StatusBadRequest, err).SetType(ErrorTypeBind) // nolint: errcheck + c.AbortWithError(http.StatusBadRequest, err).SetType(ErrorTypeBind) //nolint: errcheck return err } return nil @@ -670,8 +695,10 @@ func (c *Context) MustBindWith(obj any, b binding.Binding) error { // ShouldBind checks the Method and Content-Type to select a binding engine automatically, // Depending on the "Content-Type" header different bindings are used, for example: -// "application/json" --> JSON binding -// "application/xml" --> XML binding +// +// "application/json" --> JSON binding +// "application/xml" --> XML binding +// // It parses the request's body as JSON if Content-Type == "application/json" using JSON or XML as a JSON input. // It decodes the json payload into the struct specified as a pointer. // Like c.Bind() but this method does not set the response status code to 400 or abort if input is not valid. @@ -701,7 +728,7 @@ func (c *Context) ShouldBindYAML(obj any) error { } // ShouldBindTOML is a shortcut for c.ShouldBindWith(obj, binding.TOML). -func (c *Context) ShouldBindTOML(obj interface{}) error { +func (c *Context) ShouldBindTOML(obj any) error { return c.ShouldBindWith(obj, binding.TOML) } @@ -712,7 +739,7 @@ func (c *Context) ShouldBindHeader(obj any) error { // ShouldBindUri binds the passed struct pointer using the specified binding engine. func (c *Context) ShouldBindUri(obj any) error { - m := make(map[string][]string) + m := make(map[string][]string, len(c.Params)) for _, v := range c.Params { m[v.Key] = []string{v.Value} } @@ -738,7 +765,7 @@ func (c *Context) ShouldBindBodyWith(obj any, bb binding.BindingBody) (err error } } if body == nil { - body, err = ioutil.ReadAll(c.Request.Body) + body, err = io.ReadAll(c.Request.Body) if err != nil { return err } @@ -747,8 +774,28 @@ func (c *Context) ShouldBindBodyWith(obj any, bb binding.BindingBody) (err error return bb.BindBody(body, obj) } +// ShouldBindBodyWithJSON is a shortcut for c.ShouldBindBodyWith(obj, binding.JSON). +func (c *Context) ShouldBindBodyWithJSON(obj any) error { + return c.ShouldBindBodyWith(obj, binding.JSON) +} + +// ShouldBindBodyWithXML is a shortcut for c.ShouldBindBodyWith(obj, binding.XML). +func (c *Context) ShouldBindBodyWithXML(obj any) error { + return c.ShouldBindBodyWith(obj, binding.XML) +} + +// ShouldBindBodyWithYAML is a shortcut for c.ShouldBindBodyWith(obj, binding.YAML). +func (c *Context) ShouldBindBodyWithYAML(obj any) error { + return c.ShouldBindBodyWith(obj, binding.YAML) +} + +// ShouldBindBodyWithTOML is a shortcut for c.ShouldBindBodyWith(obj, binding.TOML). +func (c *Context) ShouldBindBodyWithTOML(obj any) error { + return c.ShouldBindBodyWith(obj, binding.TOML) +} + // ClientIP implements one best effort algorithm to return the real client IP. -// It called c.RemoteIP() under the hood, to check if the remote IP is a trusted proxy or not. +// It calls c.RemoteIP() under the hood, to check if the remote IP is a trusted proxy or not. // If it is it will then try to parse the headers defined in Engine.RemoteIPHeaders (defaulting to [X-Forwarded-For, X-Real-Ip]). // If the headers are not syntactically valid OR the remote IP does not correspond to a trusted proxy, // the remote IP (coming from Request.RemoteAddr) is returned. @@ -857,7 +904,10 @@ func (c *Context) GetHeader(key string) string { // GetRawData returns stream data. func (c *Context) GetRawData() ([]byte, error) { - return ioutil.ReadAll(c.Request.Body) + if c.Request.Body == nil { + return nil, errors.New("cannot read nil body") + } + return io.ReadAll(c.Request.Body) } // SetSameSite with cookie @@ -908,7 +958,9 @@ func (c *Context) Render(code int, r render.Render) { } if err := r.Render(c.Writer); err != nil { - panic(err) + // Pushing error to c.Errors + _ = c.Error(err) + c.Abort() } } @@ -977,7 +1029,7 @@ func (c *Context) YAML(code int, obj any) { } // TOML serializes the given struct as TOML into the response body. -func (c *Context) TOML(code int, obj interface{}) { +func (c *Context) TOML(code int, obj any) { c.Render(code, render.TOML{Data: obj}) } @@ -1034,11 +1086,17 @@ func (c *Context) FileFromFS(filepath string, fs http.FileSystem) { http.FileServer(fs).ServeHTTP(c.Writer, c.Request) } +var quoteEscaper = strings.NewReplacer("\\", "\\\\", `"`, "\\\"") + +func escapeQuotes(s string) string { + return quoteEscaper.Replace(s) +} + // FileAttachment writes the specified file into the body stream in an efficient way // On the client side, the file will typically be downloaded with the given filename func (c *Context) FileAttachment(filepath, filename string) { if isASCII(filename) { - c.Writer.Header().Set("Content-Disposition", `attachment; filename="`+filename+`"`) + c.Writer.Header().Set("Content-Disposition", `attachment; filename="`+escapeQuotes(filename)+`"`) } else { c.Writer.Header().Set("Content-Disposition", `attachment; filename*=UTF-8''`+url.QueryEscape(filename)) } @@ -1112,7 +1170,7 @@ func (c *Context) Negotiate(code int, config Negotiate) { c.TOML(code, data) default: - c.AbortWithError(http.StatusNotAcceptable, errors.New("the accepted formats are not offered by the server")) // nolint: errcheck + c.AbortWithError(http.StatusNotAcceptable, errors.New("the accepted formats are not offered by the server")) //nolint: errcheck } } @@ -1131,7 +1189,7 @@ func (c *Context) NegotiateFormat(offered ...string) string { // According to RFC 2616 and RFC 2396, non-ASCII characters are not allowed in headers, // therefore we can just iterate over the string without casting it into []rune i := 0 - for ; i < len(accepted); i++ { + for ; i < len(accepted) && i < len(offer); i++ { if accepted[i] == '*' || offer[i] == '*' { return offer } @@ -1156,9 +1214,16 @@ func (c *Context) SetAccepted(formats ...string) { /***** GOLANG.ORG/X/NET/CONTEXT *****/ /************************************/ +// hasRequestContext returns whether c.Request has Context and fallback. +func (c *Context) hasRequestContext() bool { + hasFallback := c.engine != nil && c.engine.ContextWithFallback + hasRequestContext := c.Request != nil && c.Request.Context() != nil + return hasFallback && hasRequestContext +} + // Deadline returns that there is no deadline (ok==false) when c.Request has no Context. func (c *Context) Deadline() (deadline time.Time, ok bool) { - if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + if !c.hasRequestContext() { return } return c.Request.Context().Deadline() @@ -1166,7 +1231,7 @@ func (c *Context) Deadline() (deadline time.Time, ok bool) { // Done returns nil (chan which will wait forever) when c.Request has no Context. func (c *Context) Done() <-chan struct{} { - if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + if !c.hasRequestContext() { return nil } return c.Request.Context().Done() @@ -1174,7 +1239,7 @@ func (c *Context) Done() <-chan struct{} { // Err returns nil when c.Request has no Context. func (c *Context) Err() error { - if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + if !c.hasRequestContext() { return nil } return c.Request.Context().Err() @@ -1184,7 +1249,7 @@ func (c *Context) Err() error { // if no value is associated with key. Successive calls to Value with // the same key returns the same result. func (c *Context) Value(key any) any { - if key == 0 { + if key == ContextRequestKey { return c.Request } if key == ContextKey { @@ -1195,7 +1260,7 @@ func (c *Context) Value(key any) any { return val } } - if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + if !c.hasRequestContext() { return nil } return c.Request.Context().Value(key) diff --git a/vendor/github.com/gin-gonic/gin/context_appengine.go b/vendor/github.com/gin-gonic/gin/context_appengine.go index 931313f6..96b339c4 100644 --- a/vendor/github.com/gin-gonic/gin/context_appengine.go +++ b/vendor/github.com/gin-gonic/gin/context_appengine.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build appengine -// +build appengine package gin diff --git a/vendor/github.com/gin-gonic/gin/debug.go b/vendor/github.com/gin-gonic/gin/debug.go index 25fd7c87..1761fe32 100644 --- a/vendor/github.com/gin-gonic/gin/debug.go +++ b/vendor/github.com/gin-gonic/gin/debug.go @@ -12,7 +12,7 @@ import ( "strings" ) -const ginSupportMinGoVer = 14 +const ginSupportMinGoVer = 18 // IsDebugging returns true if the framework is running in debug mode. // Use SetMode(gin.ReleaseMode) to disable debug mode. @@ -23,6 +23,9 @@ func IsDebugging() bool { // DebugPrintRouteFunc indicates debug log output format. var DebugPrintRouteFunc func(httpMethod, absolutePath, handlerName string, nuHandlers int) +// DebugPrintFunc indicates debug log output format. +var DebugPrintFunc func(format string, values ...interface{}) + func debugPrintRoute(httpMethod, absolutePath string, handlers HandlersChain) { if IsDebugging() { nuHandlers := len(handlers) @@ -48,12 +51,19 @@ func debugPrintLoadTemplate(tmpl *template.Template) { } func debugPrint(format string, values ...any) { - if IsDebugging() { - if !strings.HasSuffix(format, "\n") { - format += "\n" - } - fmt.Fprintf(DefaultWriter, "[GIN-debug] "+format, values...) + if !IsDebugging() { + return + } + + if DebugPrintFunc != nil { + DebugPrintFunc(format, values...) + return + } + + if !strings.HasSuffix(format, "\n") { + format += "\n" } + fmt.Fprintf(DefaultWriter, "[GIN-debug] "+format, values...) } func getMinVer(v string) (uint64, error) { @@ -66,8 +76,8 @@ func getMinVer(v string) (uint64, error) { } func debugPrintWARNINGDefault() { - if v, e := getMinVer(runtime.Version()); e == nil && v <= ginSupportMinGoVer { - debugPrint(`[WARNING] Now Gin requires Go 1.14+. + if v, e := getMinVer(runtime.Version()); e == nil && v < ginSupportMinGoVer { + debugPrint(`[WARNING] Now Gin requires Go 1.18+. `) } diff --git a/vendor/github.com/gin-gonic/gin/deprecated.go b/vendor/github.com/gin-gonic/gin/deprecated.go index fdad8554..b4c6cd88 100644 --- a/vendor/github.com/gin-gonic/gin/deprecated.go +++ b/vendor/github.com/gin-gonic/gin/deprecated.go @@ -12,8 +12,10 @@ import ( // BindWith binds the passed struct pointer using the specified binding engine. // See the binding package. +// +// Deprecated: Use MustBindWith or ShouldBindWith. func (c *Context) BindWith(obj any, b binding.Binding) error { - log.Println(`BindWith(\"interface{}, binding.Binding\") error is going to + log.Println(`BindWith(\"any, binding.Binding\") error is going to be deprecated, please check issue #662 and either use MustBindWith() if you want HTTP 400 to be automatically returned if any error occur, or use ShouldBindWith() if you need to manage the error.`) diff --git a/vendor/github.com/gin-gonic/gin/errors.go b/vendor/github.com/gin-gonic/gin/errors.go index 2853ce8e..06b53c28 100644 --- a/vendor/github.com/gin-gonic/gin/errors.go +++ b/vendor/github.com/gin-gonic/gin/errors.go @@ -39,7 +39,7 @@ type Error struct { type errorMsgs []*Error -var _ error = &Error{} +var _ error = (*Error)(nil) // SetType sets the error's type. func (msg *Error) SetType(flags ErrorType) *Error { @@ -124,10 +124,11 @@ func (a errorMsgs) Last() *Error { // Errors returns an array with all the error messages. // Example: -// c.Error(errors.New("first")) -// c.Error(errors.New("second")) -// c.Error(errors.New("third")) -// c.Errors.Errors() // == []string{"first", "second", "third"} +// +// c.Error(errors.New("first")) +// c.Error(errors.New("second")) +// c.Error(errors.New("third")) +// c.Errors.Errors() // == []string{"first", "second", "third"} func (a errorMsgs) Errors() []string { if len(a) == 0 { return nil diff --git a/vendor/github.com/gin-gonic/gin/fs.go b/vendor/github.com/gin-gonic/gin/fs.go index 64274735..f17d7434 100644 --- a/vendor/github.com/gin-gonic/gin/fs.go +++ b/vendor/github.com/gin-gonic/gin/fs.go @@ -39,7 +39,7 @@ func (fs onlyFilesFS) Open(name string) (http.File, error) { } // Readdir overrides the http.File default implementation. -func (f neuteredReaddirFile) Readdir(count int) ([]os.FileInfo, error) { +func (f neuteredReaddirFile) Readdir(_ int) ([]os.FileInfo, error) { // this disables directory listing return nil, nil } diff --git a/vendor/github.com/gin-gonic/gin/gin.go b/vendor/github.com/gin-gonic/gin/gin.go index f9324299..1633fe13 100644 --- a/vendor/github.com/gin-gonic/gin/gin.go +++ b/vendor/github.com/gin-gonic/gin/gin.go @@ -11,6 +11,7 @@ import ( "net/http" "os" "path" + "regexp" "strings" "sync" @@ -40,9 +41,15 @@ var defaultTrustedCIDRs = []*net.IPNet{ }, } +var regSafePrefix = regexp.MustCompile("[^a-zA-Z0-9/-]+") +var regRemoveRepeatedChar = regexp.MustCompile("/{2,}") + // HandlerFunc defines the handler used by gin middleware as return value. type HandlerFunc func(*Context) +// OptionFunc defines the function to change the default configuration +type OptionFunc func(*Engine) + // HandlersChain defines a HandlerFunc slice. type HandlersChain []HandlerFunc @@ -73,6 +80,8 @@ const ( // PlatformCloudflare when using Cloudflare's CDN. Trust CF-Connecting-IP for determining // the client's IP PlatformCloudflare = "CF-Connecting-IP" + // PlatformFlyIO when running on Fly.io. Trust Fly-Client-IP for determining the client's IP + PlatformFlyIO = "Fly-Client-IP" ) // Engine is the framework's instance, it contains the muxer, middleware and configuration settings. @@ -166,7 +175,7 @@ type Engine struct { trustedCIDRs []*net.IPNet } -var _ IRouter = &Engine{} +var _ IRouter = (*Engine)(nil) // New returns a new blank Engine instance without any middleware attached. // By default, the configuration is: @@ -176,7 +185,7 @@ var _ IRouter = &Engine{} // - ForwardedByClientIP: true // - UseRawPath: false // - UnescapePathValues: true -func New() *Engine { +func New(opts ...OptionFunc) *Engine { debugPrintWARNINGNew() engine := &Engine{ RouterGroup: RouterGroup{ @@ -203,17 +212,17 @@ func New() *Engine { } engine.RouterGroup.engine = engine engine.pool.New = func() any { - return engine.allocateContext() + return engine.allocateContext(engine.maxParams) } - return engine + return engine.With(opts...) } // Default returns an Engine instance with the Logger and Recovery middleware already attached. -func Default() *Engine { +func Default(opts ...OptionFunc) *Engine { debugPrintWARNINGDefault() engine := New() engine.Use(Logger(), Recovery()) - return engine + return engine.With(opts...) } func (engine *Engine) Handler() http.Handler { @@ -225,8 +234,8 @@ func (engine *Engine) Handler() http.Handler { return h2c.NewHandler(engine, h2s) } -func (engine *Engine) allocateContext() *Context { - v := make(Params, 0, engine.maxParams) +func (engine *Engine) allocateContext(maxParams uint16) *Context { + v := make(Params, 0, maxParams) skippedNodes := make([]skippedNode, 0, engine.maxSections) return &Context{engine: engine, params: &v, skippedNodes: &skippedNodes} } @@ -307,6 +316,15 @@ func (engine *Engine) Use(middleware ...HandlerFunc) IRoutes { return engine } +// With returns a new Engine instance with the provided options. +func (engine *Engine) With(opts ...OptionFunc) *Engine { + for _, opt := range opts { + opt(engine) + } + + return engine +} + func (engine *Engine) rebuild404Handlers() { engine.allNoRoute = engine.combineHandlers(engine.noRoute) } @@ -330,7 +348,6 @@ func (engine *Engine) addRoute(method, path string, handlers HandlersChain) { } root.addRoute(path, handlers) - // Update maxParams if paramsCount := countParams(path); paramsCount > engine.maxParams { engine.maxParams = paramsCount } @@ -511,7 +528,7 @@ func (engine *Engine) RunUnix(file string) (err error) { if engine.isUnsafeTrustedProxies() { debugPrint("[WARNING] You trusted all proxies, this is NOT safe. We recommend you to set a value.\n" + - "Please check https://pkg.go.dev/github.com/gin-gonic/gin#readme-don-t-trust-all-proxies for details.") + "Please check https://github.com/gin-gonic/gin/blob/master/docs/doc.md#dont-trust-all-proxies for details.") } listener, err := net.Listen("unix", file) @@ -534,7 +551,7 @@ func (engine *Engine) RunFd(fd int) (err error) { if engine.isUnsafeTrustedProxies() { debugPrint("[WARNING] You trusted all proxies, this is NOT safe. We recommend you to set a value.\n" + - "Please check https://pkg.go.dev/github.com/gin-gonic/gin#readme-don-t-trust-all-proxies for details.") + "Please check https://github.com/gin-gonic/gin/blob/master/docs/doc.md#dont-trust-all-proxies for details.") } f := os.NewFile(uintptr(fd), fmt.Sprintf("fd@%d", fd)) @@ -555,7 +572,7 @@ func (engine *Engine) RunListener(listener net.Listener) (err error) { if engine.isUnsafeTrustedProxies() { debugPrint("[WARNING] You trusted all proxies, this is NOT safe. We recommend you to set a value.\n" + - "Please check https://pkg.go.dev/github.com/gin-gonic/gin#readme-don-t-trust-all-proxies for details.") + "Please check https://github.com/gin-gonic/gin/blob/master/docs/doc.md#dont-trust-all-proxies for details.") } err = http.Serve(listener, engine.Handler()) @@ -630,17 +647,25 @@ func (engine *Engine) handleHTTPRequest(c *Context) { } if engine.HandleMethodNotAllowed { + // According to RFC 7231 section 6.5.5, MUST generate an Allow header field in response + // containing a list of the target resource's currently supported methods. + allowed := make([]string, 0, len(t)-1) for _, tree := range engine.trees { if tree.method == httpMethod { continue } if value := tree.root.getValue(rPath, nil, c.skippedNodes, unescape); value.handlers != nil { - c.handlers = engine.allNoMethod - serveError(c, http.StatusMethodNotAllowed, default405Body) - return + allowed = append(allowed, tree.method) } } + if len(allowed) > 0 { + c.handlers = engine.allNoMethod + c.writermem.Header().Set("Allow", strings.Join(allowed, ", ")) + serveError(c, http.StatusMethodNotAllowed, default405Body) + return + } } + c.handlers = engine.allNoRoute serveError(c, http.StatusNotFound, default404Body) } @@ -668,6 +693,9 @@ func redirectTrailingSlash(c *Context) { req := c.Request p := req.URL.Path if prefix := path.Clean(c.Request.Header.Get("X-Forwarded-Prefix")); prefix != "." { + prefix = regSafePrefix.ReplaceAllString(prefix, "") + prefix = regRemoveRepeatedChar.ReplaceAllString(prefix, "/") + p = prefix + "/" + req.URL.Path } req.URL.Path = p + "/" diff --git a/vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv.go b/vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv_1.19.go similarity index 96% rename from vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv.go rename to vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv_1.19.go index 86e4c4d4..669c9c91 100644 --- a/vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv.go +++ b/vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv_1.19.go @@ -2,6 +2,8 @@ // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. +//go:build !go1.20 + package bytesconv import ( diff --git a/vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv_1.20.go b/vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv_1.20.go new file mode 100644 index 00000000..5b6040a6 --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/internal/bytesconv/bytesconv_1.20.go @@ -0,0 +1,23 @@ +// Copyright 2023 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +//go:build go1.20 + +package bytesconv + +import ( + "unsafe" +) + +// StringToBytes converts string to byte slice without a memory allocation. +// For more details, see https://github.com/golang/go/issues/53003#issuecomment-1140276077. +func StringToBytes(s string) []byte { + return unsafe.Slice(unsafe.StringData(s), len(s)) +} + +// BytesToString converts byte slice to string without a memory allocation. +// For more details, see https://github.com/golang/go/issues/53003#issuecomment-1140276077. +func BytesToString(b []byte) string { + return unsafe.String(unsafe.SliceData(b), len(b)) +} diff --git a/vendor/github.com/gin-gonic/gin/internal/json/go_json.go b/vendor/github.com/gin-gonic/gin/internal/json/go_json.go index 23f71726..47c35598 100644 --- a/vendor/github.com/gin-gonic/gin/internal/json/go_json.go +++ b/vendor/github.com/gin-gonic/gin/internal/json/go_json.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go_json -// +build go_json package json diff --git a/vendor/github.com/gin-gonic/gin/internal/json/json.go b/vendor/github.com/gin-gonic/gin/internal/json/json.go index a26d7db2..c7ee83eb 100644 --- a/vendor/github.com/gin-gonic/gin/internal/json/json.go +++ b/vendor/github.com/gin-gonic/gin/internal/json/json.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. -//go:build !jsoniter && !go_json -// +build !jsoniter,!go_json +//go:build !jsoniter && !go_json && !(sonic && avx && (linux || windows || darwin) && amd64) package json diff --git a/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go b/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go index 853b1a90..45ed16ba 100644 --- a/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go +++ b/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build jsoniter -// +build jsoniter package json diff --git a/vendor/github.com/gin-gonic/gin/internal/json/sonic.go b/vendor/github.com/gin-gonic/gin/internal/json/sonic.go new file mode 100644 index 00000000..529e16d0 --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/internal/json/sonic.go @@ -0,0 +1,23 @@ +// Copyright 2022 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +//go:build sonic && avx && (linux || windows || darwin) && amd64 + +package json + +import "github.com/bytedance/sonic" + +var ( + json = sonic.ConfigStd + // Marshal is exported by gin/json package. + Marshal = json.Marshal + // Unmarshal is exported by gin/json package. + Unmarshal = json.Unmarshal + // MarshalIndent is exported by gin/json package. + MarshalIndent = json.MarshalIndent + // NewDecoder is exported by gin/json package. + NewDecoder = json.NewDecoder + // NewEncoder is exported by gin/json package. + NewEncoder = json.NewEncoder +) diff --git a/vendor/github.com/gin-gonic/gin/logger.go b/vendor/github.com/gin-gonic/gin/logger.go index cd1e7fa6..db2c6832 100644 --- a/vendor/github.com/gin-gonic/gin/logger.go +++ b/vendor/github.com/gin-gonic/gin/logger.go @@ -47,8 +47,15 @@ type LoggerConfig struct { // SkipPaths is an url path array which logs are not written. // Optional. SkipPaths []string + + // Skip is a Skipper that indicates which logs should not be written. + // Optional. + Skip Skipper } +// Skipper is a function to skip logs based on provided Context +type Skipper func(c *Context) bool + // LogFormatter gives the signature of the formatter function passed to LoggerWithFormatter type LogFormatter func(params LogFormatterParams) string @@ -83,6 +90,8 @@ func (p *LogFormatterParams) StatusCodeColor() string { code := p.StatusCode switch { + case code >= http.StatusContinue && code < http.StatusOK: + return white case code >= http.StatusOK && code < http.StatusMultipleChoices: return green case code >= http.StatusMultipleChoices && code < http.StatusBadRequest: @@ -239,32 +248,34 @@ func LoggerWithConfig(conf LoggerConfig) HandlerFunc { // Process request c.Next() - // Log only when path is not being skipped - if _, ok := skip[path]; !ok { - param := LogFormatterParams{ - Request: c.Request, - isTerm: isTerm, - Keys: c.Keys, - } - - // Stop timer - param.TimeStamp = time.Now() - param.Latency = param.TimeStamp.Sub(start) + // Log only when it is not being skipped + if _, ok := skip[path]; ok || (conf.Skip != nil && conf.Skip(c)) { + return + } - param.ClientIP = c.ClientIP() - param.Method = c.Request.Method - param.StatusCode = c.Writer.Status() - param.ErrorMessage = c.Errors.ByType(ErrorTypePrivate).String() + param := LogFormatterParams{ + Request: c.Request, + isTerm: isTerm, + Keys: c.Keys, + } - param.BodySize = c.Writer.Size() + // Stop timer + param.TimeStamp = time.Now() + param.Latency = param.TimeStamp.Sub(start) - if raw != "" { - path = path + "?" + raw - } + param.ClientIP = c.ClientIP() + param.Method = c.Request.Method + param.StatusCode = c.Writer.Status() + param.ErrorMessage = c.Errors.ByType(ErrorTypePrivate).String() - param.Path = path + param.BodySize = c.Writer.Size() - fmt.Fprint(out, formatter(param)) + if raw != "" { + path = path + "?" + raw } + + param.Path = path + + fmt.Fprint(out, formatter(param)) } } diff --git a/vendor/github.com/gin-gonic/gin/mode.go b/vendor/github.com/gin-gonic/gin/mode.go index 545fdaaf..fd26d907 100644 --- a/vendor/github.com/gin-gonic/gin/mode.go +++ b/vendor/github.com/gin-gonic/gin/mode.go @@ -35,8 +35,9 @@ const ( // Note that both Logger and Recovery provides custom ways to configure their // output io.Writer. // To support coloring in Windows use: -// import "github.com/mattn/go-colorable" -// gin.DefaultWriter = colorable.NewColorableStdout() +// +// import "github.com/mattn/go-colorable" +// gin.DefaultWriter = colorable.NewColorableStdout() var DefaultWriter io.Writer = os.Stdout // DefaultErrorWriter is the default io.Writer used by Gin to debug errors diff --git a/vendor/github.com/gin-gonic/gin/path.go b/vendor/github.com/gin-gonic/gin/path.go index d42d6b9d..82438c13 100644 --- a/vendor/github.com/gin-gonic/gin/path.go +++ b/vendor/github.com/gin-gonic/gin/path.go @@ -10,12 +10,12 @@ package gin // // The following rules are applied iteratively until no further processing can // be done: -// 1. Replace multiple slashes with a single slash. -// 2. Eliminate each . path name element (the current directory). -// 3. Eliminate each inner .. path name element (the parent directory) -// along with the non-.. element that precedes it. -// 4. Eliminate .. elements that begin a rooted path: -// that is, replace "/.." by "/" at the beginning of a path. +// 1. Replace multiple slashes with a single slash. +// 2. Eliminate each . path name element (the current directory). +// 3. Eliminate each inner .. path name element (the parent directory) +// along with the non-.. element that precedes it. +// 4. Eliminate .. elements that begin a rooted path: +// that is, replace "/.." by "/" at the beginning of a path. // // If the result of this process is an empty string, "/" is returned. func cleanPath(p string) string { diff --git a/vendor/github.com/gin-gonic/gin/recovery.go b/vendor/github.com/gin-gonic/gin/recovery.go index abb64510..515f9d2a 100644 --- a/vendor/github.com/gin-gonic/gin/recovery.go +++ b/vendor/github.com/gin-gonic/gin/recovery.go @@ -9,7 +9,6 @@ import ( "errors" "fmt" "io" - "io/ioutil" "log" "net" "net/http" @@ -63,7 +62,9 @@ func CustomRecoveryWithWriter(out io.Writer, handle RecoveryFunc) HandlerFunc { if ne, ok := err.(*net.OpError); ok { var se *os.SyscallError if errors.As(ne, &se) { - if strings.Contains(strings.ToLower(se.Error()), "broken pipe") || strings.Contains(strings.ToLower(se.Error()), "connection reset by peer") { + seStr := strings.ToLower(se.Error()) + if strings.Contains(seStr, "broken pipe") || + strings.Contains(seStr, "connection reset by peer") { brokenPipe = true } } @@ -91,7 +92,7 @@ func CustomRecoveryWithWriter(out io.Writer, handle RecoveryFunc) HandlerFunc { } if brokenPipe { // If the connection is dead, we can't write a status to it. - c.Error(err.(error)) // nolint: errcheck + c.Error(err.(error)) //nolint: errcheck c.Abort() } else { handle(c, err) @@ -102,7 +103,7 @@ func CustomRecoveryWithWriter(out io.Writer, handle RecoveryFunc) HandlerFunc { } } -func defaultHandleRecovery(c *Context, err any) { +func defaultHandleRecovery(c *Context, _ any) { c.AbortWithStatus(http.StatusInternalServerError) } @@ -121,7 +122,7 @@ func stack(skip int) []byte { // Print this much at least. If we can't find the source, it won't show. fmt.Fprintf(buf, "%s:%d (0x%x)\n", file, line, pc) if file != lastFile { - data, err := ioutil.ReadFile(file) + data, err := os.ReadFile(file) if err != nil { continue } @@ -163,7 +164,7 @@ func function(pc uintptr) []byte { if period := bytes.Index(name, dot); period >= 0 { name = name[period+1:] } - name = bytes.Replace(name, centerDot, dot, -1) + name = bytes.ReplaceAll(name, centerDot, dot) return name } diff --git a/vendor/github.com/gin-gonic/gin/render/any.go b/vendor/github.com/gin-gonic/gin/render/any.go deleted file mode 100644 index b19ad45d..00000000 --- a/vendor/github.com/gin-gonic/gin/render/any.go +++ /dev/null @@ -1,10 +0,0 @@ -// Copyright 2021 Gin Core Team. All rights reserved. -// Use of this source code is governed by a MIT style -// license that can be found in the LICENSE file. - -//go:build !go1.18 -// +build !go1.18 - -package render - -type any = interface{} diff --git a/vendor/github.com/gin-gonic/gin/render/json.go b/vendor/github.com/gin-gonic/gin/render/json.go index af678e80..fc8dea45 100644 --- a/vendor/github.com/gin-gonic/gin/render/json.go +++ b/vendor/github.com/gin-gonic/gin/render/json.go @@ -53,11 +53,8 @@ var ( ) // Render (JSON) writes data with custom ContentType. -func (r JSON) Render(w http.ResponseWriter) (err error) { - if err = WriteJSON(w, r.Data); err != nil { - panic(err) - } - return +func (r JSON) Render(w http.ResponseWriter) error { + return WriteJSON(w, r.Data) } // WriteContentType (JSON) writes JSON ContentType. diff --git a/vendor/github.com/gin-gonic/gin/render/msgpack.go b/vendor/github.com/gin-gonic/gin/render/msgpack.go index e0f30f7a..d1d8e84b 100644 --- a/vendor/github.com/gin-gonic/gin/render/msgpack.go +++ b/vendor/github.com/gin-gonic/gin/render/msgpack.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !nomsgpack -// +build !nomsgpack package render diff --git a/vendor/github.com/gin-gonic/gin/render/render.go b/vendor/github.com/gin-gonic/gin/render/render.go index 7955000c..4bdcfa23 100644 --- a/vendor/github.com/gin-gonic/gin/render/render.go +++ b/vendor/github.com/gin-gonic/gin/render/render.go @@ -15,22 +15,22 @@ type Render interface { } var ( - _ Render = JSON{} - _ Render = IndentedJSON{} - _ Render = SecureJSON{} - _ Render = JsonpJSON{} - _ Render = XML{} - _ Render = String{} - _ Render = Redirect{} - _ Render = Data{} - _ Render = HTML{} - _ HTMLRender = HTMLDebug{} - _ HTMLRender = HTMLProduction{} - _ Render = YAML{} - _ Render = Reader{} - _ Render = AsciiJSON{} - _ Render = ProtoBuf{} - _ Render = TOML{} + _ Render = (*JSON)(nil) + _ Render = (*IndentedJSON)(nil) + _ Render = (*SecureJSON)(nil) + _ Render = (*JsonpJSON)(nil) + _ Render = (*XML)(nil) + _ Render = (*String)(nil) + _ Render = (*Redirect)(nil) + _ Render = (*Data)(nil) + _ Render = (*HTML)(nil) + _ HTMLRender = (*HTMLDebug)(nil) + _ HTMLRender = (*HTMLProduction)(nil) + _ Render = (*YAML)(nil) + _ Render = (*Reader)(nil) + _ Render = (*AsciiJSON)(nil) + _ Render = (*ProtoBuf)(nil) + _ Render = (*TOML)(nil) ) func writeContentType(w http.ResponseWriter, value []string) { diff --git a/vendor/github.com/gin-gonic/gin/render/yaml.go b/vendor/github.com/gin-gonic/gin/render/yaml.go index 4f0ac01f..042bb821 100644 --- a/vendor/github.com/gin-gonic/gin/render/yaml.go +++ b/vendor/github.com/gin-gonic/gin/render/yaml.go @@ -7,7 +7,7 @@ package render import ( "net/http" - "gopkg.in/yaml.v2" + "gopkg.in/yaml.v3" ) // YAML contains the given interface object. @@ -15,7 +15,7 @@ type YAML struct { Data any } -var yamlContentType = []string{"application/x-yaml; charset=utf-8"} +var yamlContentType = []string{"application/yaml; charset=utf-8"} // Render (YAML) marshals the given interface object and writes data with custom ContentType. func (r YAML) Render(w http.ResponseWriter) error { diff --git a/vendor/github.com/gin-gonic/gin/response_writer.go b/vendor/github.com/gin-gonic/gin/response_writer.go index 77c7ed8f..753a0b09 100644 --- a/vendor/github.com/gin-gonic/gin/response_writer.go +++ b/vendor/github.com/gin-gonic/gin/response_writer.go @@ -49,7 +49,11 @@ type responseWriter struct { status int } -var _ ResponseWriter = &responseWriter{} +var _ ResponseWriter = (*responseWriter)(nil) + +func (w *responseWriter) Unwrap() http.ResponseWriter { + return w.ResponseWriter +} func (w *responseWriter) reset(writer http.ResponseWriter) { w.ResponseWriter = writer @@ -61,6 +65,7 @@ func (w *responseWriter) WriteHeader(code int) { if code > 0 && w.status != code { if w.Written() { debugPrint("[WARNING] Headers were already written. Wanted to override status code %d with %d", w.status, code) + return } w.status = code } diff --git a/vendor/github.com/gin-gonic/gin/routergroup.go b/vendor/github.com/gin-gonic/gin/routergroup.go index 3c082d93..c833fe8f 100644 --- a/vendor/github.com/gin-gonic/gin/routergroup.go +++ b/vendor/github.com/gin-gonic/gin/routergroup.go @@ -42,6 +42,7 @@ type IRoutes interface { PUT(string, ...HandlerFunc) IRoutes OPTIONS(string, ...HandlerFunc) IRoutes HEAD(string, ...HandlerFunc) IRoutes + Match([]string, string, ...HandlerFunc) IRoutes StaticFile(string, string) IRoutes StaticFileFS(string, string, http.FileSystem) IRoutes @@ -58,7 +59,7 @@ type RouterGroup struct { root bool } -var _ IRouter = &RouterGroup{} +var _ IRouter = (*RouterGroup)(nil) // Use adds middleware to the group, see example code in GitHub. func (group *RouterGroup) Use(middleware ...HandlerFunc) IRoutes { @@ -106,37 +107,37 @@ func (group *RouterGroup) Handle(httpMethod, relativePath string, handlers ...Ha return group.handle(httpMethod, relativePath, handlers) } -// POST is a shortcut for router.Handle("POST", path, handle). +// POST is a shortcut for router.Handle("POST", path, handlers). func (group *RouterGroup) POST(relativePath string, handlers ...HandlerFunc) IRoutes { return group.handle(http.MethodPost, relativePath, handlers) } -// GET is a shortcut for router.Handle("GET", path, handle). +// GET is a shortcut for router.Handle("GET", path, handlers). func (group *RouterGroup) GET(relativePath string, handlers ...HandlerFunc) IRoutes { return group.handle(http.MethodGet, relativePath, handlers) } -// DELETE is a shortcut for router.Handle("DELETE", path, handle). +// DELETE is a shortcut for router.Handle("DELETE", path, handlers). func (group *RouterGroup) DELETE(relativePath string, handlers ...HandlerFunc) IRoutes { return group.handle(http.MethodDelete, relativePath, handlers) } -// PATCH is a shortcut for router.Handle("PATCH", path, handle). +// PATCH is a shortcut for router.Handle("PATCH", path, handlers). func (group *RouterGroup) PATCH(relativePath string, handlers ...HandlerFunc) IRoutes { return group.handle(http.MethodPatch, relativePath, handlers) } -// PUT is a shortcut for router.Handle("PUT", path, handle). +// PUT is a shortcut for router.Handle("PUT", path, handlers). func (group *RouterGroup) PUT(relativePath string, handlers ...HandlerFunc) IRoutes { return group.handle(http.MethodPut, relativePath, handlers) } -// OPTIONS is a shortcut for router.Handle("OPTIONS", path, handle). +// OPTIONS is a shortcut for router.Handle("OPTIONS", path, handlers). func (group *RouterGroup) OPTIONS(relativePath string, handlers ...HandlerFunc) IRoutes { return group.handle(http.MethodOptions, relativePath, handlers) } -// HEAD is a shortcut for router.Handle("HEAD", path, handle). +// HEAD is a shortcut for router.Handle("HEAD", path, handlers). func (group *RouterGroup) HEAD(relativePath string, handlers ...HandlerFunc) IRoutes { return group.handle(http.MethodHead, relativePath, handlers) } @@ -151,6 +152,15 @@ func (group *RouterGroup) Any(relativePath string, handlers ...HandlerFunc) IRou return group.returnObj() } +// Match registers a route that matches the specified methods that you declared. +func (group *RouterGroup) Match(methods []string, relativePath string, handlers ...HandlerFunc) IRoutes { + for _, method := range methods { + group.handle(method, relativePath, handlers) + } + + return group.returnObj() +} + // StaticFile registers a single route in order to serve a single file of the local filesystem. // router.StaticFile("favicon.ico", "./resources/favicon.ico") func (group *RouterGroup) StaticFile(relativePath, filepath string) IRoutes { @@ -161,7 +171,7 @@ func (group *RouterGroup) StaticFile(relativePath, filepath string) IRoutes { // StaticFileFS works just like `StaticFile` but a custom `http.FileSystem` can be used instead.. // router.StaticFileFS("favicon.ico", "./resources/favicon.ico", Dir{".", false}) -// Gin by default user: gin.Dir() +// Gin by default uses: gin.Dir() func (group *RouterGroup) StaticFileFS(relativePath, filepath string, fs http.FileSystem) IRoutes { return group.staticFileHandler(relativePath, func(c *Context) { c.FileFromFS(filepath, fs) @@ -182,13 +192,14 @@ func (group *RouterGroup) staticFileHandler(relativePath string, handler Handler // of the Router's NotFound handler. // To use the operating system's file system implementation, // use : -// router.Static("/static", "/var/www") +// +// router.Static("/static", "/var/www") func (group *RouterGroup) Static(relativePath, root string) IRoutes { return group.StaticFS(relativePath, Dir(root, false)) } // StaticFS works just like `Static()` but a custom `http.FileSystem` can be used instead. -// Gin by default user: gin.Dir() +// Gin by default uses: gin.Dir() func (group *RouterGroup) StaticFS(relativePath string, fs http.FileSystem) IRoutes { if strings.Contains(relativePath, ":") || strings.Contains(relativePath, "*") { panic("URL parameters can not be used when serving a static folder") diff --git a/vendor/github.com/gin-gonic/gin/test_helpers.go b/vendor/github.com/gin-gonic/gin/test_helpers.go index b3be93b4..7508c5c9 100644 --- a/vendor/github.com/gin-gonic/gin/test_helpers.go +++ b/vendor/github.com/gin-gonic/gin/test_helpers.go @@ -9,7 +9,15 @@ import "net/http" // CreateTestContext returns a fresh engine and context for testing purposes func CreateTestContext(w http.ResponseWriter) (c *Context, r *Engine) { r = New() - c = r.allocateContext() + c = r.allocateContext(0) + c.reset() + c.writermem.reset(w) + return +} + +// CreateTestContextOnly returns a fresh context base on the engine for testing purposes +func CreateTestContextOnly(w http.ResponseWriter, r *Engine) (c *Context) { + c = r.allocateContext(r.maxParams) c.reset() c.writermem.reset(w) return diff --git a/vendor/github.com/gin-gonic/gin/tree.go b/vendor/github.com/gin-gonic/gin/tree.go index 88100eec..878023d1 100644 --- a/vendor/github.com/gin-gonic/gin/tree.go +++ b/vendor/github.com/gin-gonic/gin/tree.go @@ -107,7 +107,8 @@ func countSections(path string) uint16 { type nodeType uint8 const ( - root nodeType = iota + 1 + static nodeType = iota + root param catchAll ) @@ -173,6 +174,7 @@ walk: child := node{ path: n.path[i:], wildChild: n.wildChild, + nType: static, indices: n.indices, children: n.children, handlers: n.handlers, @@ -349,7 +351,10 @@ func (n *node) insertChild(path string, fullPath string, handlers HandlersChain) } if len(n.path) > 0 && n.path[len(n.path)-1] == '/' { - pathSeg := strings.SplitN(n.children[0].path, "/", 2)[0] + pathSeg := "" + if len(n.children) != 0 { + pathSeg = strings.SplitN(n.children[0].path, "/", 2)[0] + } panic("catch-all wildcard '" + path + "' in new path '" + fullPath + "' conflicts with existing path segment '" + pathSeg + @@ -455,11 +460,11 @@ walk: // Outer loop for walking the tree if !n.wildChild { // If the path at the end of the loop is not equal to '/' and the current node has no child nodes - // the current node needs to roll back to last vaild skippedNode + // the current node needs to roll back to last valid skippedNode if path != "/" { - for l := len(*skippedNodes); l > 0; { - skippedNode := (*skippedNodes)[l-1] - *skippedNodes = (*skippedNodes)[:l-1] + for length := len(*skippedNodes); length > 0; length-- { + skippedNode := (*skippedNodes)[length-1] + *skippedNodes = (*skippedNodes)[:length-1] if strings.HasSuffix(skippedNode.path, path) { path = skippedNode.path n = skippedNode.node @@ -476,7 +481,7 @@ walk: // Outer loop for walking the tree // We can recommend to redirect to the same URL without a // trailing slash if a leaf exists for that path. value.tsr = path == "/" && n.handlers != nil - return + return value } // Handle wildcard child, which is always at the end of the array @@ -495,7 +500,14 @@ walk: // Outer loop for walking the tree } // Save param value - if params != nil && cap(*params) > 0 { + if params != nil { + // Preallocate capacity if necessary + if cap(*params) < int(globalParamsCount) { + newParams := make(Params, len(*params), globalParamsCount) + copy(newParams, *params) + *params = newParams + } + if value.params == nil { value.params = params } @@ -524,12 +536,12 @@ walk: // Outer loop for walking the tree // ... but we can't value.tsr = len(path) == end+1 - return + return value } if value.handlers = n.handlers; value.handlers != nil { value.fullPath = n.fullPath - return + return value } if len(n.children) == 1 { // No handle found. Check if a handle for this path + a @@ -537,11 +549,18 @@ walk: // Outer loop for walking the tree n = n.children[0] value.tsr = (n.path == "/" && n.handlers != nil) || (n.path == "" && n.indices == "/") } - return + return value case catchAll: // Save param value if params != nil { + // Preallocate capacity if necessary + if cap(*params) < int(globalParamsCount) { + newParams := make(Params, len(*params), globalParamsCount) + copy(newParams, *params) + *params = newParams + } + if value.params == nil { value.params = params } @@ -562,7 +581,7 @@ walk: // Outer loop for walking the tree value.handlers = n.handlers value.fullPath = n.fullPath - return + return value default: panic("invalid node type") @@ -572,11 +591,11 @@ walk: // Outer loop for walking the tree if path == prefix { // If the current path does not equal '/' and the node does not have a registered handle and the most recently matched node has a child node - // the current node needs to roll back to last vaild skippedNode + // the current node needs to roll back to last valid skippedNode if n.handlers == nil && path != "/" { - for l := len(*skippedNodes); l > 0; { - skippedNode := (*skippedNodes)[l-1] - *skippedNodes = (*skippedNodes)[:l-1] + for length := len(*skippedNodes); length > 0; length-- { + skippedNode := (*skippedNodes)[length-1] + *skippedNodes = (*skippedNodes)[:length-1] if strings.HasSuffix(skippedNode.path, path) { path = skippedNode.path n = skippedNode.node @@ -593,7 +612,7 @@ walk: // Outer loop for walking the tree // Check if this node has a handle registered. if value.handlers = n.handlers; value.handlers != nil { value.fullPath = n.fullPath - return + return value } // If there is no handle for this route, but this route has a @@ -601,7 +620,12 @@ walk: // Outer loop for walking the tree // additional trailing slash if path == "/" && n.wildChild && n.nType != root { value.tsr = true - return + return value + } + + if path == "/" && n.nType == static { + value.tsr = true + return value } // No handle found. Check if a handle for this path + a @@ -611,11 +635,11 @@ walk: // Outer loop for walking the tree n = n.children[i] value.tsr = (len(n.path) == 1 && n.handlers != nil) || (n.nType == catchAll && n.children[0].handlers != nil) - return + return value } } - return + return value } // Nothing found. We can recommend to redirect to the same URL with an @@ -626,9 +650,9 @@ walk: // Outer loop for walking the tree // roll back to last valid skippedNode if !value.tsr && path != "/" { - for l := len(*skippedNodes); l > 0; { - skippedNode := (*skippedNodes)[l-1] - *skippedNodes = (*skippedNodes)[:l-1] + for length := len(*skippedNodes); length > 0; length-- { + skippedNode := (*skippedNodes)[length-1] + *skippedNodes = (*skippedNodes)[:length-1] if strings.HasSuffix(skippedNode.path, path) { path = skippedNode.path n = skippedNode.node @@ -641,7 +665,7 @@ walk: // Outer loop for walking the tree } } - return + return value } } diff --git a/vendor/github.com/gin-gonic/gin/utils.go b/vendor/github.com/gin-gonic/gin/utils.go index 4021a2ab..47106a7a 100644 --- a/vendor/github.com/gin-gonic/gin/utils.go +++ b/vendor/github.com/gin-gonic/gin/utils.go @@ -50,7 +50,7 @@ func WrapH(h http.Handler) HandlerFunc { } } -// H is a shortcut for map[string]interface{} +// H is a shortcut for map[string]any type H map[string]any // MarshalXML allows type H to be used with xml.Marshal. diff --git a/vendor/github.com/gin-gonic/gin/version.go b/vendor/github.com/gin-gonic/gin/version.go index 632ca7d1..93ad9654 100644 --- a/vendor/github.com/gin-gonic/gin/version.go +++ b/vendor/github.com/gin-gonic/gin/version.go @@ -5,4 +5,4 @@ package gin // Version is the current gin framework's version. -const Version = "v1.8.1" +const Version = "v1.10.0" diff --git a/vendor/github.com/go-playground/locales/README.md b/vendor/github.com/go-playground/locales/README.md index 5b0694fd..7b6be2c6 100644 --- a/vendor/github.com/go-playground/locales/README.md +++ b/vendor/github.com/go-playground/locales/README.md @@ -1,10 +1,8 @@ ## locales -![Project status](https://img.shields.io/badge/version-0.14.0-green.svg) +![Project status](https://img.shields.io/badge/version-0.14.1-green.svg) [![Build Status](https://travis-ci.org/go-playground/locales.svg?branch=master)](https://travis-ci.org/go-playground/locales) -[![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/locales)](https://goreportcard.com/report/github.com/go-playground/locales) [![GoDoc](https://godoc.org/github.com/go-playground/locales?status.svg)](https://godoc.org/github.com/go-playground/locales) ![License](https://img.shields.io/dub/l/vibe-d.svg) -[![Gitter](https://badges.gitter.im/go-playground/locales.svg)](https://gitter.im/go-playground/locales?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge) Locales is a set of locales generated from the [Unicode CLDR Project](http://cldr.unicode.org/) which can be used independently or within an i18n package; these were built for use with, but not exclusive to, [Universal Translator](https://github.com/go-playground/universal-translator). diff --git a/vendor/github.com/go-playground/universal-translator/README.md b/vendor/github.com/go-playground/universal-translator/README.md index 46dec6d2..d9b66547 100644 --- a/vendor/github.com/go-playground/universal-translator/README.md +++ b/vendor/github.com/go-playground/universal-translator/README.md @@ -1,11 +1,9 @@ ## universal-translator -![Project status](https://img.shields.io/badge/version-0.18.0-green.svg) -[![Build Status](https://travis-ci.org/go-playground/universal-translator.svg?branch=master)](https://travis-ci.org/go-playground/universal-translator) +![Project status](https://img.shields.io/badge/version-0.18.1-green.svg) [![Coverage Status](https://coveralls.io/repos/github/go-playground/universal-translator/badge.svg)](https://coveralls.io/github/go-playground/universal-translator) [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/universal-translator)](https://goreportcard.com/report/github.com/go-playground/universal-translator) [![GoDoc](https://godoc.org/github.com/go-playground/universal-translator?status.svg)](https://godoc.org/github.com/go-playground/universal-translator) ![License](https://img.shields.io/dub/l/vibe-d.svg) -[![Gitter](https://badges.gitter.im/go-playground/universal-translator.svg)](https://gitter.im/go-playground/universal-translator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge) Universal Translator is an i18n Translator for Go/Golang using CLDR data + pluralization rules diff --git a/vendor/github.com/go-playground/universal-translator/import_export.go b/vendor/github.com/go-playground/universal-translator/import_export.go index 1216f192..87a1b465 100644 --- a/vendor/github.com/go-playground/universal-translator/import_export.go +++ b/vendor/github.com/go-playground/universal-translator/import_export.go @@ -3,7 +3,6 @@ package ut import ( "encoding/json" "fmt" - "io/ioutil" "os" "path/filepath" @@ -41,7 +40,6 @@ const ( func (t *UniversalTranslator) Export(format ImportExportFormat, dirname string) error { _, err := os.Stat(dirname) - fmt.Println(dirname, err, os.IsNotExist(err)) if err != nil { if !os.IsNotExist(err) { @@ -138,7 +136,7 @@ func (t *UniversalTranslator) Export(format ImportExportFormat, dirname string) return err } - err = ioutil.WriteFile(filepath.Join(dirname, fmt.Sprintf("%s%s", locale.Locale(), ext)), b, 0644) + err = os.WriteFile(filepath.Join(dirname, fmt.Sprintf("%s%s", locale.Locale(), ext)), b, 0644) if err != nil { return err } @@ -200,7 +198,7 @@ func (t *UniversalTranslator) Import(format ImportExportFormat, dirnameOrFilenam // NOTE: generally used when assets have been embedded into the binary and are already in memory. func (t *UniversalTranslator) ImportByReader(format ImportExportFormat, reader io.Reader) error { - b, err := ioutil.ReadAll(reader) + b, err := io.ReadAll(reader) if err != nil { return err } diff --git a/vendor/github.com/go-playground/validator/v10/.gitignore b/vendor/github.com/go-playground/validator/v10/.gitignore index 6e43fac0..6305e529 100644 --- a/vendor/github.com/go-playground/validator/v10/.gitignore +++ b/vendor/github.com/go-playground/validator/v10/.gitignore @@ -26,5 +26,7 @@ _testmain.go *.test *.out *.txt +/**/*.DS_Store cover.html README.html +.idea diff --git a/vendor/github.com/go-playground/validator/v10/.golangci.yaml b/vendor/github.com/go-playground/validator/v10/.golangci.yaml new file mode 100644 index 00000000..eab557ee --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/.golangci.yaml @@ -0,0 +1,102 @@ +version: "2" +linters: + default: all + disable: + - asasalint + - asciicheck + - bidichk + - bodyclose + - canonicalheader + - containedctx + - contextcheck + - copyloopvar + - cyclop + - decorder + - depguard + - dogsled + - dupl + - dupword + - durationcheck + - err113 + - errcheck + - errchkjson + - errname + - errorlint + - exhaustive + - exhaustruct + - exptostd + - fatcontext + - forbidigo + - forcetypeassert + - funlen + - ginkgolinter + - gocheckcompilerdirectives + - gochecknoglobals + - gochecknoinits + - gochecksumtype + - gocognit + - goconst + - gocritic + - gocyclo + - godot + - godox + - goheader + - gomoddirectives + - gomodguard + - goprintffuncname + - gosec + - gosmopolitan + - govet + - grouper + - iface + - importas + - inamedparam + - ineffassign + - interfacebloat + - intrange + - ireturn + - lll + - loggercheck + - maintidx + - makezero + - mirror + - misspell + - mnd + - musttag + - nakedret + - nestif + - nilerr + - nilnesserr + - nilnil + - nlreturn + - noctx + - nolintlint + - nonamedreturns + - nosprintfhostport + - paralleltest + - perfsprint + - prealloc + - predeclared + - promlinter + - protogetter + - reassign + - recvcheck + - revive + - rowserrcheck + - sloglint + - spancheck + - sqlclosecheck + - staticcheck + - tagalign + - tagliatelle + - testableexamples + - testifylint + - testpackage + - thelper + - tparallel + - unparam + - varnamelen + - whitespace + - wrapcheck + - wsl + - zerologlint \ No newline at end of file diff --git a/vendor/github.com/go-playground/validator/v10/Makefile b/vendor/github.com/go-playground/validator/v10/Makefile index ec3455bd..e7caab7f 100644 --- a/vendor/github.com/go-playground/validator/v10/Makefile +++ b/vendor/github.com/go-playground/validator/v10/Makefile @@ -1,9 +1,9 @@ -GOCMD=GO111MODULE=on go +GOCMD=go linters-install: @golangci-lint --version >/dev/null 2>&1 || { \ echo "installing linting tools..."; \ - curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.41.1; \ + curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v2.0.2; \ } lint: linters-install @@ -13,6 +13,6 @@ test: $(GOCMD) test -cover -race ./... bench: - $(GOCMD) test -bench=. -benchmem ./... + $(GOCMD) test -run=NONE -bench=. -benchmem ./... -.PHONY: test lint linters-install \ No newline at end of file +.PHONY: test lint linters-install diff --git a/vendor/github.com/go-playground/validator/v10/README.md b/vendor/github.com/go-playground/validator/v10/README.md index 5c42ee4f..368b966a 100644 --- a/vendor/github.com/go-playground/validator/v10/README.md +++ b/vendor/github.com/go-playground/validator/v10/README.md @@ -1,8 +1,7 @@ Package validator ================= -[![Join the chat at https://gitter.im/go-playground/validator](https://badges.gitter.im/Join%20Chat.svg)](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) -![Project status](https://img.shields.io/badge/version-10.10.0-green.svg) -[![Build Status](https://travis-ci.org/go-playground/validator.svg?branch=master)](https://travis-ci.org/go-playground/validator) +![Project status](https://img.shields.io/badge/version-10.25.0-green.svg) +[![Build Status](https://github.com/go-playground/validator/actions/workflows/workflow.yml/badge.svg)](https://github.com/go-playground/validator/actions) [![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=master&service=github)](https://coveralls.io/github/go-playground/validator?branch=master) [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/validator)](https://goreportcard.com/report/github.com/go-playground/validator) [![GoDoc](https://godoc.org/github.com/go-playground/validator?status.svg)](https://pkg.go.dev/github.com/go-playground/validator/v10) @@ -22,6 +21,11 @@ It has the following **unique** features: - Customizable i18n aware error messages. - Default validator for the [gin](https://github.com/gin-gonic/gin) web framework; upgrading from v8 to v9 in gin see [here](https://github.com/go-playground/validator/tree/master/_examples/gin-upgrading-overriding) +A Call for Maintainers +---------------------- + +Please read the discussiong started [here](https://github.com/go-playground/validator/discussions/1330) if you are interested in contributing/helping maintain this package. + Installation ------------ @@ -67,14 +71,20 @@ Please see https://pkg.go.dev/github.com/go-playground/validator/v10 for detaile Baked-in Validations ------ +### Special Notes: +- If new to using validator it is highly recommended to initialize it using the `WithRequiredStructEnabled` option which is opt-in to new behaviour that will become the default behaviour in v11+. See documentation for more details. +```go +validate := validator.New(validator.WithRequiredStructEnabled()) +``` + ### Fields: | Tag | Description | | - | - | | eqcsfield | Field Equals Another Field (relative)| | eqfield | Field Equals Another Field | -| fieldcontains | NOT DOCUMENTED IN doc.go | -| fieldexcludes | NOT DOCUMENTED IN doc.go | +| fieldcontains | Check the indicated characters are present in the Field | +| fieldexcludes | Check the indicated characters are not present in the field | | gtcsfield | Field Greater Than Another Relative Field | | gtecsfield | Field Greater Than or Equal To Another Relative Field | | gtefield | Field Greater Than or Equal To Another Field | @@ -114,6 +124,7 @@ Baked-in Validations | unix_addr | Unix domain socket end point Address | | uri | URI String | | url | URL String | +| http_url | HTTP URL String | | url_encoded | URL Encoded | | urn_rfc2141 | Urn RFC 2141 String | @@ -130,14 +141,14 @@ Baked-in Validations | contains | Contains | | containsany | Contains Any | | containsrune | Contains Rune | -| endsnotwith | Ends With | +| endsnotwith | Ends Not With | | endswith | Ends With | | excludes | Excludes | | excludesall | Excludes All | | excludesrune | Excludes Rune | | lowercase | Lowercase | | multibyte | Multi-Byte Characters | -| number | NOT DOCUMENTED IN doc.go | +| number | Number | | numeric | Numeric | | printascii | Printable ASCII | | startsnotwith | Starts Not With | @@ -149,12 +160,19 @@ Baked-in Validations | - | - | | base64 | Base64 String | | base64url | Base64URL String | +| base64rawurl | Base64RawURL String | | bic | Business Identifier Code (ISO 9362) | | bcp47_language_tag | Language tag (BCP 47) | | btc_addr | Bitcoin Address | | btc_addr_bech32 | Bitcoin Bech32 Address (segwit) | +| credit_card | Credit Card Number | +| mongodb | MongoDB ObjectID | +| mongodb_connection_string | MongoDB Connection String | +| cron | Cron | +| spicedb | SpiceDb ObjectID/Permission/Type | | datetime | Datetime | | e164 | e164 formatted phone number | +| ein | U.S. Employeer Identification Number | | email | E-mail String | eth_addr | Ethereum Address | | hexadecimal | Hexadecimal String | @@ -166,6 +184,7 @@ Baked-in Validations | isbn | International Standard Book Number | | isbn10 | International Standard Book Number 10 | | isbn13 | International Standard Book Number 13 | +| issn | International Standard Serial Number | | iso3166_1_alpha2 | Two-letter country code (ISO 3166-1 alpha-2) | | iso3166_1_alpha3 | Three-letter country code (ISO 3166-1 alpha-3) | | iso3166_1_alpha_numeric | Numeric country code (ISO 3166-1 numeric) | @@ -175,6 +194,7 @@ Baked-in Validations | jwt | JSON Web Token (JWT) | | latitude | Latitude | | longitude | Longitude | +| luhn_checksum | Luhn Algorithm Checksum (for strings and (u)int) | | postcode_iso3166_alpha2 | Postcode | | postcode_iso3166_alpha2_field | Postcode | | rgb | RGB String | @@ -189,24 +209,40 @@ Baked-in Validations | uuid5 | Universally Unique Identifier UUID v5 | | uuid5_rfc4122 | Universally Unique Identifier UUID v5 RFC4122 | | uuid_rfc4122 | Universally Unique Identifier UUID RFC4122 | +| md4 | MD4 hash | +| md5 | MD5 hash | +| sha256 | SHA256 hash | +| sha384 | SHA384 hash | +| sha512 | SHA512 hash | +| ripemd128 | RIPEMD-128 hash | +| ripemd128 | RIPEMD-160 hash | +| tiger128 | TIGER128 hash | +| tiger160 | TIGER160 hash | +| tiger192 | TIGER192 hash | | semver | Semantic Versioning 2.0.0 | | ulid | Universally Unique Lexicographically Sortable Identifier ULID | +| cve | Common Vulnerabilities and Exposures Identifier (CVE id) | ### Comparisons: | Tag | Description | | - | - | | eq | Equals | +| eq_ignore_case | Equals ignoring case | | gt | Greater than| | gte | Greater than or equal | | lt | Less Than | | lte | Less Than or Equal | | ne | Not Equal | +| ne_ignore_case | Not Equal ignoring case | ### Other: | Tag | Description | | - | - | -| dir | Directory | -| file | File path | +| dir | Existing Directory | +| dirpath | Directory Path | +| file | Existing File | +| filepath | File Path | +| image | Image | | isdefault | Is Default | | len | Length | | max | Maximum | @@ -219,6 +255,8 @@ Baked-in Validations | required_with_all | Required With All | | required_without | Required Without | | required_without_all | Required Without All | +| excluded_if | Excluded If | +| excluded_unless | Excluded Unless | | excluded_with | Excluded With | | excluded_with_all | Excluded With All | | excluded_without | Excluded Without | @@ -233,73 +271,75 @@ Baked-in Validations Benchmarks ------ -###### Run on MacBook Pro (15-inch, 2017) go version go1.10.2 darwin/amd64 +###### Run on MacBook Pro Max M3 ```go +go version go1.23.3 darwin/arm64 goos: darwin -goarch: amd64 -pkg: github.com/go-playground/validator -BenchmarkFieldSuccess-8 20000000 83.6 ns/op 0 B/op 0 allocs/op -BenchmarkFieldSuccessParallel-8 50000000 26.8 ns/op 0 B/op 0 allocs/op -BenchmarkFieldFailure-8 5000000 291 ns/op 208 B/op 4 allocs/op -BenchmarkFieldFailureParallel-8 20000000 107 ns/op 208 B/op 4 allocs/op -BenchmarkFieldArrayDiveSuccess-8 2000000 623 ns/op 201 B/op 11 allocs/op -BenchmarkFieldArrayDiveSuccessParallel-8 10000000 237 ns/op 201 B/op 11 allocs/op -BenchmarkFieldArrayDiveFailure-8 2000000 859 ns/op 412 B/op 16 allocs/op -BenchmarkFieldArrayDiveFailureParallel-8 5000000 335 ns/op 413 B/op 16 allocs/op -BenchmarkFieldMapDiveSuccess-8 1000000 1292 ns/op 432 B/op 18 allocs/op -BenchmarkFieldMapDiveSuccessParallel-8 3000000 467 ns/op 432 B/op 18 allocs/op -BenchmarkFieldMapDiveFailure-8 1000000 1082 ns/op 512 B/op 16 allocs/op -BenchmarkFieldMapDiveFailureParallel-8 5000000 425 ns/op 512 B/op 16 allocs/op -BenchmarkFieldMapDiveWithKeysSuccess-8 1000000 1539 ns/op 480 B/op 21 allocs/op -BenchmarkFieldMapDiveWithKeysSuccessParallel-8 3000000 613 ns/op 480 B/op 21 allocs/op -BenchmarkFieldMapDiveWithKeysFailure-8 1000000 1413 ns/op 721 B/op 21 allocs/op -BenchmarkFieldMapDiveWithKeysFailureParallel-8 3000000 575 ns/op 721 B/op 21 allocs/op -BenchmarkFieldCustomTypeSuccess-8 10000000 216 ns/op 32 B/op 2 allocs/op -BenchmarkFieldCustomTypeSuccessParallel-8 20000000 82.2 ns/op 32 B/op 2 allocs/op -BenchmarkFieldCustomTypeFailure-8 5000000 274 ns/op 208 B/op 4 allocs/op -BenchmarkFieldCustomTypeFailureParallel-8 20000000 116 ns/op 208 B/op 4 allocs/op -BenchmarkFieldOrTagSuccess-8 2000000 740 ns/op 16 B/op 1 allocs/op -BenchmarkFieldOrTagSuccessParallel-8 3000000 474 ns/op 16 B/op 1 allocs/op -BenchmarkFieldOrTagFailure-8 3000000 471 ns/op 224 B/op 5 allocs/op -BenchmarkFieldOrTagFailureParallel-8 3000000 414 ns/op 224 B/op 5 allocs/op -BenchmarkStructLevelValidationSuccess-8 10000000 213 ns/op 32 B/op 2 allocs/op -BenchmarkStructLevelValidationSuccessParallel-8 20000000 91.8 ns/op 32 B/op 2 allocs/op -BenchmarkStructLevelValidationFailure-8 3000000 473 ns/op 304 B/op 8 allocs/op -BenchmarkStructLevelValidationFailureParallel-8 10000000 234 ns/op 304 B/op 8 allocs/op -BenchmarkStructSimpleCustomTypeSuccess-8 5000000 385 ns/op 32 B/op 2 allocs/op -BenchmarkStructSimpleCustomTypeSuccessParallel-8 10000000 161 ns/op 32 B/op 2 allocs/op -BenchmarkStructSimpleCustomTypeFailure-8 2000000 640 ns/op 424 B/op 9 allocs/op -BenchmarkStructSimpleCustomTypeFailureParallel-8 5000000 318 ns/op 440 B/op 10 allocs/op -BenchmarkStructFilteredSuccess-8 2000000 597 ns/op 288 B/op 9 allocs/op -BenchmarkStructFilteredSuccessParallel-8 10000000 266 ns/op 288 B/op 9 allocs/op -BenchmarkStructFilteredFailure-8 3000000 454 ns/op 256 B/op 7 allocs/op -BenchmarkStructFilteredFailureParallel-8 10000000 214 ns/op 256 B/op 7 allocs/op -BenchmarkStructPartialSuccess-8 3000000 502 ns/op 256 B/op 6 allocs/op -BenchmarkStructPartialSuccessParallel-8 10000000 225 ns/op 256 B/op 6 allocs/op -BenchmarkStructPartialFailure-8 2000000 702 ns/op 480 B/op 11 allocs/op -BenchmarkStructPartialFailureParallel-8 5000000 329 ns/op 480 B/op 11 allocs/op -BenchmarkStructExceptSuccess-8 2000000 793 ns/op 496 B/op 12 allocs/op -BenchmarkStructExceptSuccessParallel-8 10000000 193 ns/op 240 B/op 5 allocs/op -BenchmarkStructExceptFailure-8 2000000 639 ns/op 464 B/op 10 allocs/op -BenchmarkStructExceptFailureParallel-8 5000000 300 ns/op 464 B/op 10 allocs/op -BenchmarkStructSimpleCrossFieldSuccess-8 3000000 417 ns/op 72 B/op 3 allocs/op -BenchmarkStructSimpleCrossFieldSuccessParallel-8 10000000 163 ns/op 72 B/op 3 allocs/op -BenchmarkStructSimpleCrossFieldFailure-8 2000000 645 ns/op 304 B/op 8 allocs/op -BenchmarkStructSimpleCrossFieldFailureParallel-8 5000000 285 ns/op 304 B/op 8 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldSuccess-8 3000000 588 ns/op 80 B/op 4 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldSuccessParallel-8 10000000 221 ns/op 80 B/op 4 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldFailure-8 2000000 868 ns/op 320 B/op 9 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldFailureParallel-8 5000000 337 ns/op 320 B/op 9 allocs/op -BenchmarkStructSimpleSuccess-8 5000000 260 ns/op 0 B/op 0 allocs/op -BenchmarkStructSimpleSuccessParallel-8 20000000 90.6 ns/op 0 B/op 0 allocs/op -BenchmarkStructSimpleFailure-8 2000000 619 ns/op 424 B/op 9 allocs/op -BenchmarkStructSimpleFailureParallel-8 5000000 296 ns/op 424 B/op 9 allocs/op -BenchmarkStructComplexSuccess-8 1000000 1454 ns/op 128 B/op 8 allocs/op -BenchmarkStructComplexSuccessParallel-8 3000000 579 ns/op 128 B/op 8 allocs/op -BenchmarkStructComplexFailure-8 300000 4140 ns/op 3041 B/op 53 allocs/op -BenchmarkStructComplexFailureParallel-8 1000000 2127 ns/op 3041 B/op 53 allocs/op -BenchmarkOneof-8 10000000 140 ns/op 0 B/op 0 allocs/op -BenchmarkOneofParallel-8 20000000 70.1 ns/op 0 B/op 0 allocs/op +goarch: arm64 +cpu: Apple M3 Max +pkg: github.com/go-playground/validator/v10 +BenchmarkFieldSuccess-16 42461943 27.88 ns/op 0 B/op 0 allocs/op +BenchmarkFieldSuccessParallel-16 486632887 2.289 ns/op 0 B/op 0 allocs/op +BenchmarkFieldFailure-16 9566167 121.3 ns/op 200 B/op 4 allocs/op +BenchmarkFieldFailureParallel-16 17551471 83.68 ns/op 200 B/op 4 allocs/op +BenchmarkFieldArrayDiveSuccess-16 7602306 155.6 ns/op 97 B/op 5 allocs/op +BenchmarkFieldArrayDiveSuccessParallel-16 20664610 59.80 ns/op 97 B/op 5 allocs/op +BenchmarkFieldArrayDiveFailure-16 4659756 252.9 ns/op 301 B/op 10 allocs/op +BenchmarkFieldArrayDiveFailureParallel-16 8010116 152.9 ns/op 301 B/op 10 allocs/op +BenchmarkFieldMapDiveSuccess-16 2834575 421.2 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveSuccessParallel-16 7179700 171.8 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveFailure-16 3081728 384.4 ns/op 376 B/op 13 allocs/op +BenchmarkFieldMapDiveFailureParallel-16 6058137 204.0 ns/op 377 B/op 13 allocs/op +BenchmarkFieldMapDiveWithKeysSuccess-16 2544975 464.8 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveWithKeysSuccessParallel-16 6661954 181.4 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveWithKeysFailure-16 2435484 490.7 ns/op 553 B/op 16 allocs/op +BenchmarkFieldMapDiveWithKeysFailureParallel-16 4249617 282.0 ns/op 554 B/op 16 allocs/op +BenchmarkFieldCustomTypeSuccess-16 14943525 77.35 ns/op 32 B/op 2 allocs/op +BenchmarkFieldCustomTypeSuccessParallel-16 64051954 20.61 ns/op 32 B/op 2 allocs/op +BenchmarkFieldCustomTypeFailure-16 10721384 107.1 ns/op 184 B/op 3 allocs/op +BenchmarkFieldCustomTypeFailureParallel-16 18714495 69.77 ns/op 184 B/op 3 allocs/op +BenchmarkFieldOrTagSuccess-16 4063124 294.3 ns/op 16 B/op 1 allocs/op +BenchmarkFieldOrTagSuccessParallel-16 31903756 41.22 ns/op 18 B/op 1 allocs/op +BenchmarkFieldOrTagFailure-16 7748558 146.8 ns/op 216 B/op 5 allocs/op +BenchmarkFieldOrTagFailureParallel-16 13139854 92.05 ns/op 216 B/op 5 allocs/op +BenchmarkStructLevelValidationSuccess-16 16808389 70.25 ns/op 16 B/op 1 allocs/op +BenchmarkStructLevelValidationSuccessParallel-16 90686955 14.47 ns/op 16 B/op 1 allocs/op +BenchmarkStructLevelValidationFailure-16 5818791 200.2 ns/op 264 B/op 7 allocs/op +BenchmarkStructLevelValidationFailureParallel-16 11115874 107.5 ns/op 264 B/op 7 allocs/op +BenchmarkStructSimpleCustomTypeSuccess-16 7764956 151.9 ns/op 32 B/op 2 allocs/op +BenchmarkStructSimpleCustomTypeSuccessParallel-16 52316265 30.37 ns/op 32 B/op 2 allocs/op +BenchmarkStructSimpleCustomTypeFailure-16 4195429 277.2 ns/op 416 B/op 9 allocs/op +BenchmarkStructSimpleCustomTypeFailureParallel-16 7305661 164.6 ns/op 432 B/op 10 allocs/op +BenchmarkStructFilteredSuccess-16 6312625 186.1 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredSuccessParallel-16 13684459 93.42 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredFailure-16 6751482 171.2 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredFailureParallel-16 14146070 86.93 ns/op 216 B/op 5 allocs/op +BenchmarkStructPartialSuccess-16 6544448 177.3 ns/op 224 B/op 4 allocs/op +BenchmarkStructPartialSuccessParallel-16 13951946 88.73 ns/op 224 B/op 4 allocs/op +BenchmarkStructPartialFailure-16 4075833 287.5 ns/op 440 B/op 9 allocs/op +BenchmarkStructPartialFailureParallel-16 7490805 161.3 ns/op 440 B/op 9 allocs/op +BenchmarkStructExceptSuccess-16 4107187 281.4 ns/op 424 B/op 8 allocs/op +BenchmarkStructExceptSuccessParallel-16 15979173 80.86 ns/op 208 B/op 3 allocs/op +BenchmarkStructExceptFailure-16 4434372 264.3 ns/op 424 B/op 8 allocs/op +BenchmarkStructExceptFailureParallel-16 8081367 154.1 ns/op 424 B/op 8 allocs/op +BenchmarkStructSimpleCrossFieldSuccess-16 6459542 183.4 ns/op 56 B/op 3 allocs/op +BenchmarkStructSimpleCrossFieldSuccessParallel-16 41013781 37.95 ns/op 56 B/op 3 allocs/op +BenchmarkStructSimpleCrossFieldFailure-16 4034998 292.1 ns/op 272 B/op 8 allocs/op +BenchmarkStructSimpleCrossFieldFailureParallel-16 11348446 115.3 ns/op 272 B/op 8 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldSuccess-16 4448528 267.7 ns/op 64 B/op 4 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldSuccessParallel-16 26813619 48.33 ns/op 64 B/op 4 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldFailure-16 3090646 384.5 ns/op 288 B/op 9 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldFailureParallel-16 9870906 129.5 ns/op 288 B/op 9 allocs/op +BenchmarkStructSimpleSuccess-16 10675562 109.5 ns/op 0 B/op 0 allocs/op +BenchmarkStructSimpleSuccessParallel-16 131159784 8.932 ns/op 0 B/op 0 allocs/op +BenchmarkStructSimpleFailure-16 4094979 286.6 ns/op 416 B/op 9 allocs/op +BenchmarkStructSimpleFailureParallel-16 7606663 157.9 ns/op 416 B/op 9 allocs/op +BenchmarkStructComplexSuccess-16 2073470 576.0 ns/op 224 B/op 5 allocs/op +BenchmarkStructComplexSuccessParallel-16 7821831 161.3 ns/op 224 B/op 5 allocs/op +BenchmarkStructComplexFailure-16 576358 2001 ns/op 3042 B/op 48 allocs/op +BenchmarkStructComplexFailureParallel-16 1000000 1171 ns/op 3041 B/op 48 allocs/op +BenchmarkOneof-16 22503973 52.82 ns/op 0 B/op 0 allocs/op +BenchmarkOneofParallel-16 8538474 140.4 ns/op 0 B/op 0 allocs/op ``` Complementary Software @@ -315,6 +355,20 @@ How to Contribute Make a pull request... +Maintenance and support for SDK major versions +---------------------------------------------- + +See prior discussion [here](https://github.com/go-playground/validator/discussions/1342) for more details. + +This package is aligned with the [Go release policy](https://go.dev/doc/devel/release) in that support is guaranteed for +the two most recent major versions. + +This does not mean the package will not work with older versions of Go, only that we reserve the right to increase the +MSGV(Minimum Supported Go Version) when the need arises to address Security issues/patches, OS issues & support or newly +introduced functionality that would greatly benefit the maintenance and/or usage of this package. + +If and when the MSGV is increased it will be done so in a minimum of a `Minor` release bump. + License ------- Distributed under MIT License, please see license file within the code for more details. diff --git a/vendor/github.com/go-playground/validator/v10/baked_in.go b/vendor/github.com/go-playground/validator/v10/baked_in.go index 7868b66f..5332cf3f 100644 --- a/vendor/github.com/go-playground/validator/v10/baked_in.go +++ b/vendor/github.com/go-playground/validator/v10/baked_in.go @@ -7,19 +7,23 @@ import ( "encoding/hex" "encoding/json" "fmt" + "io/fs" "net" + "net/mail" "net/url" "os" "reflect" "strconv" "strings" "sync" + "syscall" "time" "unicode/utf8" "golang.org/x/crypto/sha3" "golang.org/x/text/language" + "github.com/gabriel-vasile/mimetype" urn "github.com/leodido/go-urn" ) @@ -31,7 +35,7 @@ type Func func(fl FieldLevel) bool // validation needs. The return value should be true when validation succeeds. type FuncCtx func(ctx context.Context, fl FieldLevel) bool -// wrapFunc wraps noramal Func makes it compatible with FuncCtx +// wrapFunc wraps normal Func makes it compatible with FuncCtx func wrapFunc(fn Func) FuncCtx { if fn == nil { return nil // be sure not to wrap a bad function. @@ -47,7 +51,9 @@ var ( keysTag: {}, endKeysTag: {}, structOnlyTag: {}, + omitzero: {}, omitempty: {}, + omitnil: {}, skipValidationTag: {}, utf8HexComma: {}, utf8Pipe: {}, @@ -60,8 +66,9 @@ var ( // defines a common or complex set of validation(s) to simplify // adding validation to structs. bakedInAliases = map[string]string{ - "iscolor": "hexcolor|rgb|rgba|hsl|hsla", - "country_code": "iso3166_1_alpha2|iso3166_1_alpha3|iso3166_1_alpha_numeric", + "iscolor": "hexcolor|rgb|rgba|hsl|hsla", + "country_code": "iso3166_1_alpha2|iso3166_1_alpha3|iso3166_1_alpha_numeric", + "eu_country_code": "iso3166_1_alpha2_eu|iso3166_1_alpha3_eu|iso3166_1_alpha_numeric_eu", } // bakedInValidators is the default map of ValidationFunc @@ -71,10 +78,13 @@ var ( "required": hasValue, "required_if": requiredIf, "required_unless": requiredUnless, + "skip_unless": skipUnless, "required_with": requiredWith, "required_with_all": requiredWithAll, "required_without": requiredWithout, "required_without_all": requiredWithoutAll, + "excluded_if": excludedIf, + "excluded_unless": excludedUnless, "excluded_with": excludedWith, "excluded_with_all": excludedWithAll, "excluded_without": excludedWithout, @@ -84,7 +94,9 @@ var ( "min": hasMinOf, "max": hasMaxOf, "eq": isEq, + "eq_ignore_case": isEqIgnoreCase, "ne": isNe, + "ne_ignore_case": isNeIgnoreCase, "lt": isLt, "lte": isLte, "gt": isGt, @@ -119,11 +131,15 @@ var ( "e164": isE164, "email": isEmail, "url": isURL, + "http_url": isHttpURL, "uri": isURI, "urn_rfc2141": isUrnRFC2141, // RFC 2141 "file": isFile, + "filepath": isFilePath, + "base32": isBase32, "base64": isBase64, "base64url": isBase64URL, + "base64rawurl": isBase64RawURL, "contains": contains, "containsany": containsAny, "containsrune": containsRune, @@ -134,10 +150,13 @@ var ( "endswith": endsWith, "startsnotwith": startsNotWith, "endsnotwith": endsNotWith, + "image": isImage, "isbn": isISBN, "isbn10": isISBN10, "isbn13": isISBN13, + "issn": isISSN, "eth_addr": isEthereumAddress, + "eth_addr_checksum": isEthereumAddressChecksum, "btc_addr": isBitcoinAddress, "btc_addr_bech32": isBitcoinBech32Address, "uuid": isUUID, @@ -149,6 +168,16 @@ var ( "uuid4_rfc4122": isUUID4RFC4122, "uuid5_rfc4122": isUUID5RFC4122, "ulid": isULID, + "md4": isMD4, + "md5": isMD5, + "sha256": isSHA256, + "sha384": isSHA384, + "sha512": isSHA512, + "ripemd128": isRIPEMD128, + "ripemd160": isRIPEMD160, + "tiger128": isTIGER128, + "tiger160": isTIGER160, + "tiger192": isTIGER192, "ascii": isASCII, "printascii": isPrintableASCII, "multibyte": hasMultiByteCharacter, @@ -178,20 +207,26 @@ var ( "fqdn": isFQDN, "unique": isUnique, "oneof": isOneOf, + "oneofci": isOneOfCI, "html": isHTML, "html_encoded": isHTMLEncoded, "url_encoded": isURLEncoded, "dir": isDir, + "dirpath": isDirPath, "json": isJSON, "jwt": isJWT, "hostname_port": isHostnamePort, + "port": isPort, "lowercase": isLowercase, "uppercase": isUppercase, "datetime": isDatetime, "timezone": isTimeZone, "iso3166_1_alpha2": isIso3166Alpha2, + "iso3166_1_alpha2_eu": isIso3166Alpha2EU, "iso3166_1_alpha3": isIso3166Alpha3, + "iso3166_1_alpha3_eu": isIso3166Alpha3EU, "iso3166_1_alpha_numeric": isIso3166AlphaNumeric, + "iso3166_1_alpha_numeric_eu": isIso3166AlphaNumericEU, "iso3166_2": isIso31662, "iso4217": isIso4217, "iso4217_numeric": isIso4217Numeric, @@ -201,11 +236,21 @@ var ( "bic": isIsoBicFormat, "semver": isSemverFormat, "dns_rfc1035_label": isDnsRFC1035LabelFormat, + "credit_card": isCreditCard, + "cve": isCveFormat, + "luhn_checksum": hasLuhnChecksum, + "mongodb": isMongoDBObjectId, + "mongodb_connection_string": isMongoDBConnectionString, + "cron": isCron, + "spicedb": isSpiceDB, + "ein": isEIN, } ) -var oneofValsCache = map[string][]string{} -var oneofValsCacheRWLock = sync.RWMutex{} +var ( + oneofValsCache = map[string][]string{} + oneofValsCacheRWLock = sync.RWMutex{} +) func parseOneOfParam2(s string) []string { oneofValsCacheRWLock.RLock() @@ -213,9 +258,9 @@ func parseOneOfParam2(s string) []string { oneofValsCacheRWLock.RUnlock() if !ok { oneofValsCacheRWLock.Lock() - vals = splitParamsRegex.FindAllString(s, -1) + vals = splitParamsRegex().FindAllString(s, -1) for i := 0; i < len(vals); i++ { - vals[i] = strings.Replace(vals[i], "'", "", -1) + vals[i] = strings.ReplaceAll(vals[i], "'", "") } oneofValsCache[s] = vals oneofValsCacheRWLock.Unlock() @@ -224,15 +269,15 @@ func parseOneOfParam2(s string) []string { } func isURLEncoded(fl FieldLevel) bool { - return uRLEncodedRegex.MatchString(fl.Field().String()) + return uRLEncodedRegex().MatchString(fl.Field().String()) } func isHTMLEncoded(fl FieldLevel) bool { - return hTMLEncodedRegex.MatchString(fl.Field().String()) + return hTMLEncodedRegex().MatchString(fl.Field().String()) } func isHTML(fl FieldLevel) bool { - return hTMLRegex.MatchString(fl.Field().String()) + return hTMLRegex().MatchString(fl.Field().String()) } func isOneOf(fl FieldLevel) bool { @@ -259,9 +304,25 @@ func isOneOf(fl FieldLevel) bool { return false } +// isOneOfCI is the validation function for validating if the current field's value is one of the provided string values (case insensitive). +func isOneOfCI(fl FieldLevel) bool { + vals := parseOneOfParam2(fl.Param()) + field := fl.Field() + + if field.Kind() != reflect.String { + panic(fmt.Sprintf("Bad field type %T", field.Interface())) + } + v := field.String() + for _, val := range vals { + if strings.EqualFold(val, v) { + return true + } + } + return false +} + // isUnique is the validation function for validating if each array|slice|map value is unique func isUnique(fl FieldLevel) bool { - field := fl.Field() param := fl.Param() v := reflect.ValueOf(struct{}{}) @@ -293,25 +354,48 @@ func isUnique(fl FieldLevel) bool { } m := reflect.MakeMap(reflect.MapOf(sfTyp, v.Type())) + var fieldlen int for i := 0; i < field.Len(); i++ { - m.SetMapIndex(reflect.Indirect(reflect.Indirect(field.Index(i)).FieldByName(param)), v) + key := reflect.Indirect(reflect.Indirect(field.Index(i)).FieldByName(param)) + if key.IsValid() { + fieldlen++ + m.SetMapIndex(key, v) + } } - return field.Len() == m.Len() + return fieldlen == m.Len() case reflect.Map: - m := reflect.MakeMap(reflect.MapOf(field.Type().Elem(), v.Type())) + var m reflect.Value + if field.Type().Elem().Kind() == reflect.Ptr { + m = reflect.MakeMap(reflect.MapOf(field.Type().Elem().Elem(), v.Type())) + } else { + m = reflect.MakeMap(reflect.MapOf(field.Type().Elem(), v.Type())) + } for _, k := range field.MapKeys() { - m.SetMapIndex(field.MapIndex(k), v) + m.SetMapIndex(reflect.Indirect(field.MapIndex(k)), v) } + return field.Len() == m.Len() default: + if parent := fl.Parent(); parent.Kind() == reflect.Struct { + uniqueField := parent.FieldByName(param) + if uniqueField == reflect.ValueOf(nil) { + panic(fmt.Sprintf("Bad field name provided %s", param)) + } + + if uniqueField.Kind() != field.Kind() { + panic(fmt.Sprintf("Bad field type %T:%T", field.Interface(), uniqueField.Interface())) + } + + return field.Interface() != uniqueField.Interface() + } + panic(fmt.Sprintf("Bad field type %T", field.Interface())) } } // isMAC is the validation function for validating if the field's value is a valid MAC address. func isMAC(fl FieldLevel) bool { - _, err := net.ParseMAC(fl.Field().String()) return err == nil @@ -319,15 +403,13 @@ func isMAC(fl FieldLevel) bool { // isCIDRv4 is the validation function for validating if the field's value is a valid v4 CIDR address. func isCIDRv4(fl FieldLevel) bool { + ip, net, err := net.ParseCIDR(fl.Field().String()) - ip, _, err := net.ParseCIDR(fl.Field().String()) - - return err == nil && ip.To4() != nil + return err == nil && ip.To4() != nil && net.IP.Equal(ip) } // isCIDRv6 is the validation function for validating if the field's value is a valid v6 CIDR address. func isCIDRv6(fl FieldLevel) bool { - ip, _, err := net.ParseCIDR(fl.Field().String()) return err == nil && ip.To4() == nil @@ -335,7 +417,6 @@ func isCIDRv6(fl FieldLevel) bool { // isCIDR is the validation function for validating if the field's value is a valid v4 or v6 CIDR address. func isCIDR(fl FieldLevel) bool { - _, _, err := net.ParseCIDR(fl.Field().String()) return err == nil @@ -343,7 +424,6 @@ func isCIDR(fl FieldLevel) bool { // isIPv4 is the validation function for validating if a value is a valid v4 IP address. func isIPv4(fl FieldLevel) bool { - ip := net.ParseIP(fl.Field().String()) return ip != nil && ip.To4() != nil @@ -351,7 +431,6 @@ func isIPv4(fl FieldLevel) bool { // isIPv6 is the validation function for validating if the field's value is a valid v6 IP address. func isIPv6(fl FieldLevel) bool { - ip := net.ParseIP(fl.Field().String()) return ip != nil && ip.To4() == nil @@ -359,7 +438,6 @@ func isIPv6(fl FieldLevel) bool { // isIP is the validation function for validating if the field's value is a valid v4 or v6 IP address. func isIP(fl FieldLevel) bool { - ip := net.ParseIP(fl.Field().String()) return ip != nil @@ -367,14 +445,13 @@ func isIP(fl FieldLevel) bool { // isSSN is the validation function for validating if the field's value is a valid SSN. func isSSN(fl FieldLevel) bool { - field := fl.Field() if field.Len() != 11 { return false } - return sSNRegex.MatchString(field.String()) + return sSNRegex().MatchString(field.String()) } // isLongitude is the validation function for validating if the field's value is a valid longitude coordinate. @@ -397,7 +474,7 @@ func isLongitude(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } - return longitudeRegex.MatchString(v) + return longitudeRegex().MatchString(v) } // isLatitude is the validation function for validating if the field's value is a valid latitude coordinate. @@ -420,90 +497,138 @@ func isLatitude(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } - return latitudeRegex.MatchString(v) + return latitudeRegex().MatchString(v) } // isDataURI is the validation function for validating if the field's value is a valid data URI. func isDataURI(fl FieldLevel) bool { - uri := strings.SplitN(fl.Field().String(), ",", 2) if len(uri) != 2 { return false } - if !dataURIRegex.MatchString(uri[0]) { + if !dataURIRegex().MatchString(uri[0]) { return false } - return base64Regex.MatchString(uri[1]) + return base64Regex().MatchString(uri[1]) } // hasMultiByteCharacter is the validation function for validating if the field's value has a multi byte character. func hasMultiByteCharacter(fl FieldLevel) bool { - field := fl.Field() if field.Len() == 0 { return true } - return multibyteRegex.MatchString(field.String()) + return multibyteRegex().MatchString(field.String()) } // isPrintableASCII is the validation function for validating if the field's value is a valid printable ASCII character. func isPrintableASCII(fl FieldLevel) bool { - return printableASCIIRegex.MatchString(fl.Field().String()) + return printableASCIIRegex().MatchString(fl.Field().String()) } // isASCII is the validation function for validating if the field's value is a valid ASCII character. func isASCII(fl FieldLevel) bool { - return aSCIIRegex.MatchString(fl.Field().String()) + return aSCIIRegex().MatchString(fl.Field().String()) } // isUUID5 is the validation function for validating if the field's value is a valid v5 UUID. func isUUID5(fl FieldLevel) bool { - return uUID5Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID5Regex, fl) } // isUUID4 is the validation function for validating if the field's value is a valid v4 UUID. func isUUID4(fl FieldLevel) bool { - return uUID4Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID4Regex, fl) } // isUUID3 is the validation function for validating if the field's value is a valid v3 UUID. func isUUID3(fl FieldLevel) bool { - return uUID3Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID3Regex, fl) } // isUUID is the validation function for validating if the field's value is a valid UUID of any version. func isUUID(fl FieldLevel) bool { - return uUIDRegex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUIDRegex, fl) } // isUUID5RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v5 UUID. func isUUID5RFC4122(fl FieldLevel) bool { - return uUID5RFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID5RFC4122Regex, fl) } // isUUID4RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v4 UUID. func isUUID4RFC4122(fl FieldLevel) bool { - return uUID4RFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID4RFC4122Regex, fl) } // isUUID3RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v3 UUID. func isUUID3RFC4122(fl FieldLevel) bool { - return uUID3RFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID3RFC4122Regex, fl) } // isUUIDRFC4122 is the validation function for validating if the field's value is a valid RFC4122 UUID of any version. func isUUIDRFC4122(fl FieldLevel) bool { - return uUIDRFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUIDRFC4122Regex, fl) } // isULID is the validation function for validating if the field's value is a valid ULID. func isULID(fl FieldLevel) bool { - return uLIDRegex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uLIDRegex, fl) +} + +// isMD4 is the validation function for validating if the field's value is a valid MD4. +func isMD4(fl FieldLevel) bool { + return md4Regex().MatchString(fl.Field().String()) +} + +// isMD5 is the validation function for validating if the field's value is a valid MD5. +func isMD5(fl FieldLevel) bool { + return md5Regex().MatchString(fl.Field().String()) +} + +// isSHA256 is the validation function for validating if the field's value is a valid SHA256. +func isSHA256(fl FieldLevel) bool { + return sha256Regex().MatchString(fl.Field().String()) +} + +// isSHA384 is the validation function for validating if the field's value is a valid SHA384. +func isSHA384(fl FieldLevel) bool { + return sha384Regex().MatchString(fl.Field().String()) +} + +// isSHA512 is the validation function for validating if the field's value is a valid SHA512. +func isSHA512(fl FieldLevel) bool { + return sha512Regex().MatchString(fl.Field().String()) +} + +// isRIPEMD128 is the validation function for validating if the field's value is a valid PIPEMD128. +func isRIPEMD128(fl FieldLevel) bool { + return ripemd128Regex().MatchString(fl.Field().String()) +} + +// isRIPEMD160 is the validation function for validating if the field's value is a valid PIPEMD160. +func isRIPEMD160(fl FieldLevel) bool { + return ripemd160Regex().MatchString(fl.Field().String()) +} + +// isTIGER128 is the validation function for validating if the field's value is a valid TIGER128. +func isTIGER128(fl FieldLevel) bool { + return tiger128Regex().MatchString(fl.Field().String()) +} + +// isTIGER160 is the validation function for validating if the field's value is a valid TIGER160. +func isTIGER160(fl FieldLevel) bool { + return tiger160Regex().MatchString(fl.Field().String()) +} + +// isTIGER192 is the validation function for validating if the field's value is a valid isTIGER192. +func isTIGER192(fl FieldLevel) bool { + return tiger192Regex().MatchString(fl.Field().String()) } // isISBN is the validation function for validating if the field's value is a valid v10 or v13 ISBN. @@ -513,10 +638,9 @@ func isISBN(fl FieldLevel) bool { // isISBN13 is the validation function for validating if the field's value is a valid v13 ISBN. func isISBN13(fl FieldLevel) bool { - s := strings.Replace(strings.Replace(fl.Field().String(), "-", "", 4), " ", "", 4) - if !iSBN13Regex.MatchString(s) { + if !iSBN13Regex().MatchString(s) { return false } @@ -534,10 +658,9 @@ func isISBN13(fl FieldLevel) bool { // isISBN10 is the validation function for validating if the field's value is a valid v10 ISBN. func isISBN10(fl FieldLevel) bool { - s := strings.Replace(strings.Replace(fl.Field().String(), "-", "", 3), " ", "", 3) - if !iSBN10Regex.MatchString(s) { + if !iSBN10Regex().MatchString(s) { return false } @@ -557,18 +680,46 @@ func isISBN10(fl FieldLevel) bool { return checksum%11 == 0 } -// isEthereumAddress is the validation function for validating if the field's value is a valid Ethereum address. -func isEthereumAddress(fl FieldLevel) bool { - address := fl.Field().String() +// isISSN is the validation function for validating if the field's value is a valid ISSN. +func isISSN(fl FieldLevel) bool { + s := fl.Field().String() - if !ethAddressRegex.MatchString(address) { + if !iSSNRegex().MatchString(s) { return false } + s = strings.ReplaceAll(s, "-", "") - if ethAddressRegexUpper.MatchString(address) || ethAddressRegexLower.MatchString(address) { - return true + pos := 8 + checksum := 0 + + for i := 0; i < 7; i++ { + checksum += pos * int(s[i]-'0') + pos-- + } + + if s[7] == 'X' { + checksum += 10 + } else { + checksum += int(s[7] - '0') } + return checksum%11 == 0 +} + +// isEthereumAddress is the validation function for validating if the field's value is a valid Ethereum address. +func isEthereumAddress(fl FieldLevel) bool { + address := fl.Field().String() + + return ethAddressRegex().MatchString(address) +} + +// isEthereumAddressChecksum is the validation function for validating if the field's value is a valid checksummed Ethereum address. +func isEthereumAddressChecksum(fl FieldLevel) bool { + address := fl.Field().String() + + if !ethAddressRegex().MatchString(address) { + return false + } // Checksum validation. Reference: https://github.com/ethereum/EIPs/blob/master/EIPS/eip-55.md address = address[2:] // Skip "0x" prefix. h := sha3.NewLegacyKeccak256() @@ -592,7 +743,7 @@ func isEthereumAddress(fl FieldLevel) bool { func isBitcoinAddress(fl FieldLevel) bool { address := fl.Field().String() - if !btcAddressRegex.MatchString(address) { + if !btcAddressRegex().MatchString(address) { return false } @@ -629,7 +780,7 @@ func isBitcoinAddress(fl FieldLevel) bool { func isBitcoinBech32Address(fl FieldLevel) bool { address := fl.Field().String() - if !btcLowerAddressRegexBech32.MatchString(address) && !btcUpperAddressRegexBech32.MatchString(address) { + if !btcLowerAddressRegexBech32().MatchString(address) && !btcUpperAddressRegexBech32().MatchString(address) { return false } @@ -722,7 +873,6 @@ func excludes(fl FieldLevel) bool { // containsRune is the validation function for validating that the field's value contains the rune specified within the param. func containsRune(fl FieldLevel) bool { - r, _ := utf8.DecodeRuneInString(fl.Param()) return strings.ContainsRune(fl.Field().String(), r) @@ -785,7 +935,6 @@ func fieldExcludes(fl FieldLevel) bool { // isNeField is the validation function for validating if the current field's value is not equal to the field specified by the param's value. func isNeField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -816,12 +965,7 @@ func isNeField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != currentField.Type() { - return true - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { t := currentField.Interface().(time.Time) fieldTime := field.Interface().(time.Time) @@ -829,6 +973,10 @@ func isNeField(fl FieldLevel) bool { return !fieldTime.Equal(t) } + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return true + } } // default reflect.String: @@ -840,9 +988,14 @@ func isNe(fl FieldLevel) bool { return !isEq(fl) } +// isNeIgnoreCase is the validation function for validating that the field's string value does not equal the +// provided param value. The comparison is case-insensitive +func isNeIgnoreCase(fl FieldLevel) bool { + return !isEqIgnoreCase(fl) +} + // isLteCrossStructField is the validation function for validating if the current field's value is less than or equal to the field, within a separate struct, specified by the param's value. func isLteCrossStructField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -869,18 +1022,18 @@ func isLteCrossStructField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != topField.Type() { - return false - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { - fieldTime := field.Interface().(time.Time) - topTime := topField.Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) + topTime := topField.Convert(timeType).Interface().(time.Time) return fieldTime.Before(topTime) || fieldTime.Equal(topTime) } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } } // default reflect.String: @@ -890,7 +1043,6 @@ func isLteCrossStructField(fl FieldLevel) bool { // isLtCrossStructField is the validation function for validating if the current field's value is less than the field, within a separate struct, specified by the param's value. // NOTE: This is exposed for use within your own custom functions and not intended to be called directly. func isLtCrossStructField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -917,18 +1069,18 @@ func isLtCrossStructField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != topField.Type() { - return false - } + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { - if fieldType == timeType { - - fieldTime := field.Interface().(time.Time) - topTime := topField.Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) + topTime := topField.Convert(timeType).Interface().(time.Time) return fieldTime.Before(topTime) } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } } // default reflect.String: @@ -937,7 +1089,6 @@ func isLtCrossStructField(fl FieldLevel) bool { // isGteCrossStructField is the validation function for validating if the current field's value is greater than or equal to the field, within a separate struct, specified by the param's value. func isGteCrossStructField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -964,18 +1115,18 @@ func isGteCrossStructField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != topField.Type() { - return false - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { - fieldTime := field.Interface().(time.Time) - topTime := topField.Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) + topTime := topField.Convert(timeType).Interface().(time.Time) return fieldTime.After(topTime) || fieldTime.Equal(topTime) } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } } // default reflect.String: @@ -984,7 +1135,6 @@ func isGteCrossStructField(fl FieldLevel) bool { // isGtCrossStructField is the validation function for validating if the current field's value is greater than the field, within a separate struct, specified by the param's value. func isGtCrossStructField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1011,18 +1161,18 @@ func isGtCrossStructField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != topField.Type() { - return false - } + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { - if fieldType == timeType { - - fieldTime := field.Interface().(time.Time) - topTime := topField.Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) + topTime := topField.Convert(timeType).Interface().(time.Time) return fieldTime.After(topTime) } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } } // default reflect.String: @@ -1031,7 +1181,6 @@ func isGtCrossStructField(fl FieldLevel) bool { // isNeCrossStructField is the validation function for validating that the current field's value is not equal to the field, within a separate struct, specified by the param's value. func isNeCrossStructField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1061,18 +1210,18 @@ func isNeCrossStructField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != topField.Type() { - return true - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { - t := field.Interface().(time.Time) - fieldTime := topField.Interface().(time.Time) + t := field.Convert(timeType).Interface().(time.Time) + fieldTime := topField.Convert(timeType).Interface().(time.Time) return !fieldTime.Equal(t) } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return true + } } // default reflect.String: @@ -1081,7 +1230,6 @@ func isNeCrossStructField(fl FieldLevel) bool { // isEqCrossStructField is the validation function for validating that the current field's value is equal to the field, within a separate struct, specified by the param's value. func isEqCrossStructField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1111,18 +1259,18 @@ func isEqCrossStructField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != topField.Type() { - return false - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { - t := field.Interface().(time.Time) - fieldTime := topField.Interface().(time.Time) + t := field.Convert(timeType).Interface().(time.Time) + fieldTime := topField.Convert(timeType).Interface().(time.Time) return fieldTime.Equal(t) } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } } // default reflect.String: @@ -1131,7 +1279,6 @@ func isEqCrossStructField(fl FieldLevel) bool { // isEqField is the validation function for validating if the current field's value is equal to the field specified by the param's value. func isEqField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1161,19 +1308,18 @@ func isEqField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != currentField.Type() { - return false - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { - t := currentField.Interface().(time.Time) - fieldTime := field.Interface().(time.Time) + t := currentField.Convert(timeType).Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) return fieldTime.Equal(t) } + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } } // default reflect.String: @@ -1182,7 +1328,6 @@ func isEqField(fl FieldLevel) bool { // isEq is the validation function for validating if the current field's value is equal to the param's value. func isEq(fl FieldLevel) bool { - field := fl.Field() param := fl.Param() @@ -1206,8 +1351,13 @@ func isEq(fl FieldLevel) bool { return field.Uint() == p - case reflect.Float32, reflect.Float64: - p := asFloat(param) + case reflect.Float32: + p := asFloat32(param) + + return field.Float() == p + + case reflect.Float64: + p := asFloat64(param) return field.Float() == p @@ -1220,12 +1370,28 @@ func isEq(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } +// isEqIgnoreCase is the validation function for validating if the current field's string value is +// equal to the param's value. +// The comparison is case-insensitive. +func isEqIgnoreCase(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + return strings.EqualFold(field.String(), param) + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + // isPostcodeByIso3166Alpha2 validates by value which is country code in iso 3166 alpha 2 // example: `postcode_iso3166_alpha2=US` func isPostcodeByIso3166Alpha2(fl FieldLevel) bool { field := fl.Field() param := fl.Param() + postcodeRegexInit.Do(initPostcodes) reg, found := postCodeRegexDict[param] if !found { return false @@ -1234,7 +1400,7 @@ func isPostcodeByIso3166Alpha2(fl FieldLevel) bool { return reg.MatchString(field.String()) } -// isPostcodeByIso3166Alpha2 validates by field which represents for a value of country code in iso 3166 alpha 2 +// isPostcodeByIso3166Alpha2Field validates by field which represents for a value of country code in iso 3166 alpha 2 // example: `postcode_iso3166_alpha2_field=CountryCode` func isPostcodeByIso3166Alpha2Field(fl FieldLevel) bool { field := fl.Field() @@ -1253,6 +1419,7 @@ func isPostcodeByIso3166Alpha2Field(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", currentField.Interface())) } + postcodeRegexInit.Do(initPostcodes) reg, found := postCodeRegexDict[currentField.String()] if !found { return false @@ -1261,23 +1428,31 @@ func isPostcodeByIso3166Alpha2Field(fl FieldLevel) bool { return reg.MatchString(field.String()) } +// isBase32 is the validation function for validating if the current field's value is a valid base 32. +func isBase32(fl FieldLevel) bool { + return base32Regex().MatchString(fl.Field().String()) +} + // isBase64 is the validation function for validating if the current field's value is a valid base 64. func isBase64(fl FieldLevel) bool { - return base64Regex.MatchString(fl.Field().String()) + return base64Regex().MatchString(fl.Field().String()) } // isBase64URL is the validation function for validating if the current field's value is a valid base64 URL safe string. func isBase64URL(fl FieldLevel) bool { - return base64URLRegex.MatchString(fl.Field().String()) + return base64URLRegex().MatchString(fl.Field().String()) +} + +// isBase64RawURL is the validation function for validating if the current field's value is a valid base64 URL safe string without '=' padding. +func isBase64RawURL(fl FieldLevel) bool { + return base64RawURLRegex().MatchString(fl.Field().String()) } // isURI is the validation function for validating if the current field's value is a valid URI. func isURI(fl FieldLevel) bool { - field := fl.Field() switch field.Kind() { - case reflect.String: s := field.String() @@ -1300,46 +1475,75 @@ func isURI(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } +// isFileURL is the helper function for validating if the `path` valid file URL as per RFC8089 +func isFileURL(path string) bool { + if !strings.HasPrefix(path, "file:/") { + return false + } + _, err := url.ParseRequestURI(path) + return err == nil +} + // isURL is the validation function for validating if the current field's value is a valid URL. func isURL(fl FieldLevel) bool { - field := fl.Field() switch field.Kind() { - case reflect.String: - var i int - s := field.String() - - // checks needed as of Go 1.6 because of change https://github.com/golang/go/commit/617c93ce740c3c3cc28cdd1a0d712be183d0b328#diff-6c2d018290e298803c0c9419d8739885L195 - // emulate browser and strip the '#' suffix prior to validation. see issue-#237 - if i = strings.Index(s, "#"); i > -1 { - s = s[:i] - } + s := strings.ToLower(field.String()) if len(s) == 0 { return false } - url, err := url.ParseRequestURI(s) + if isFileURL(s) { + return true + } + url, err := url.Parse(s) if err != nil || url.Scheme == "" { return false } + if url.Host == "" && url.Fragment == "" && url.Opaque == "" { + return false + } + return true } panic(fmt.Sprintf("Bad field type %T", field.Interface())) } +// isHttpURL is the validation function for validating if the current field's value is a valid HTTP(s) URL. +func isHttpURL(fl FieldLevel) bool { + if !isURL(fl) { + return false + } + + field := fl.Field() + switch field.Kind() { + case reflect.String: + + s := strings.ToLower(field.String()) + + url, err := url.Parse(s) + if err != nil || url.Host == "" { + return false + } + + return url.Scheme == "http" || url.Scheme == "https" + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + // isUrnRFC2141 is the validation function for validating if the current field's value is a valid URN as per RFC 2141. func isUrnRFC2141(fl FieldLevel) bool { field := fl.Field() switch field.Kind() { - case reflect.String: str := field.String() @@ -1352,7 +1556,7 @@ func isUrnRFC2141(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } -// isFile is the validation function for validating if the current field's value is a valid file path. +// isFile is the validation function for validating if the current field's value is a valid existing file path. func isFile(fl FieldLevel) bool { field := fl.Field() @@ -1369,44 +1573,164 @@ func isFile(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } -// isE164 is the validation function for validating if the current field's value is a valid e.164 formatted phone number. -func isE164(fl FieldLevel) bool { - return e164Regex.MatchString(fl.Field().String()) -} +// isImage is the validation function for validating if the current field's value contains the path to a valid image file +func isImage(fl FieldLevel) bool { + mimetypes := map[string]bool{ + "image/bmp": true, + "image/cis-cod": true, + "image/gif": true, + "image/ief": true, + "image/jpeg": true, + "image/jp2": true, + "image/jpx": true, + "image/jpm": true, + "image/pipeg": true, + "image/png": true, + "image/svg+xml": true, + "image/tiff": true, + "image/webp": true, + "image/x-cmu-raster": true, + "image/x-cmx": true, + "image/x-icon": true, + "image/x-portable-anymap": true, + "image/x-portable-bitmap": true, + "image/x-portable-graymap": true, + "image/x-portable-pixmap": true, + "image/x-rgb": true, + "image/x-xbitmap": true, + "image/x-xpixmap": true, + "image/x-xwindowdump": true, + } + field := fl.Field() -// isEmail is the validation function for validating if the current field's value is a valid email address. -func isEmail(fl FieldLevel) bool { - return emailRegex.MatchString(fl.Field().String()) -} + switch field.Kind() { + case reflect.String: + filePath := field.String() + fileInfo, err := os.Stat(filePath) + if err != nil { + return false + } -// isHSLA is the validation function for validating if the current field's value is a valid HSLA color. -func isHSLA(fl FieldLevel) bool { - return hslaRegex.MatchString(fl.Field().String()) -} + if fileInfo.IsDir() { + return false + } -// isHSL is the validation function for validating if the current field's value is a valid HSL color. -func isHSL(fl FieldLevel) bool { - return hslRegex.MatchString(fl.Field().String()) -} + file, err := os.Open(filePath) + if err != nil { + return false + } + defer func() { + _ = file.Close() + }() -// isRGBA is the validation function for validating if the current field's value is a valid RGBA color. + mime, err := mimetype.DetectReader(file) + if err != nil { + return false + } + + if _, ok := mimetypes[mime.String()]; ok { + return true + } + } + return false +} + +// isFilePath is the validation function for validating if the current field's value is a valid file path. +func isFilePath(fl FieldLevel) bool { + var exists bool + var err error + + field := fl.Field() + + // Not valid if it is a directory. + if isDir(fl) { + return false + } + // If it exists, it obviously is valid. + // This is done first to avoid code duplication and unnecessary additional logic. + if exists = isFile(fl); exists { + return true + } + + // It does not exist but may still be a valid filepath. + switch field.Kind() { + case reflect.String: + // Every OS allows for whitespace, but none + // let you use a file with no filename (to my knowledge). + // Unless you're dealing with raw inodes, but I digress. + if strings.TrimSpace(field.String()) == "" { + return false + } + // We make sure it isn't a directory. + if strings.HasSuffix(field.String(), string(os.PathSeparator)) { + return false + } + if _, err = os.Stat(field.String()); err != nil { + switch t := err.(type) { + case *fs.PathError: + if t.Err == syscall.EINVAL { + // It's definitely an invalid character in the filepath. + return false + } + // It could be a permission error, a does-not-exist error, etc. + // Out-of-scope for this validation, though. + return true + default: + // Something went *seriously* wrong. + /* + Per https://pkg.go.dev/os#Stat: + "If there is an error, it will be of type *PathError." + */ + panic(err) + } + } + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + +// isE164 is the validation function for validating if the current field's value is a valid e.164 formatted phone number. +func isE164(fl FieldLevel) bool { + return e164Regex().MatchString(fl.Field().String()) +} + +// isEmail is the validation function for validating if the current field's value is a valid email address. +func isEmail(fl FieldLevel) bool { + _, err := mail.ParseAddress(fl.Field().String()) + if err != nil { + return false + } + return emailRegex().MatchString(fl.Field().String()) +} + +// isHSLA is the validation function for validating if the current field's value is a valid HSLA color. +func isHSLA(fl FieldLevel) bool { + return hslaRegex().MatchString(fl.Field().String()) +} + +// isHSL is the validation function for validating if the current field's value is a valid HSL color. +func isHSL(fl FieldLevel) bool { + return hslRegex().MatchString(fl.Field().String()) +} + +// isRGBA is the validation function for validating if the current field's value is a valid RGBA color. func isRGBA(fl FieldLevel) bool { - return rgbaRegex.MatchString(fl.Field().String()) + return rgbaRegex().MatchString(fl.Field().String()) } // isRGB is the validation function for validating if the current field's value is a valid RGB color. func isRGB(fl FieldLevel) bool { - return rgbRegex.MatchString(fl.Field().String()) + return rgbRegex().MatchString(fl.Field().String()) } // isHEXColor is the validation function for validating if the current field's value is a valid HEX color. func isHEXColor(fl FieldLevel) bool { - return hexColorRegex.MatchString(fl.Field().String()) + return hexColorRegex().MatchString(fl.Field().String()) } // isHexadecimal is the validation function for validating if the current field's value is a valid hexadecimal. func isHexadecimal(fl FieldLevel) bool { - return hexadecimalRegex.MatchString(fl.Field().String()) + return hexadecimalRegex().MatchString(fl.Field().String()) } // isNumber is the validation function for validating if the current field's value is a valid number. @@ -1415,7 +1739,7 @@ func isNumber(fl FieldLevel) bool { case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, reflect.Float32, reflect.Float64: return true default: - return numberRegex.MatchString(fl.Field().String()) + return numberRegex().MatchString(fl.Field().String()) } } @@ -1425,34 +1749,39 @@ func isNumeric(fl FieldLevel) bool { case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, reflect.Float32, reflect.Float64: return true default: - return numericRegex.MatchString(fl.Field().String()) + return numericRegex().MatchString(fl.Field().String()) } } // isAlphanum is the validation function for validating if the current field's value is a valid alphanumeric value. func isAlphanum(fl FieldLevel) bool { - return alphaNumericRegex.MatchString(fl.Field().String()) + return alphaNumericRegex().MatchString(fl.Field().String()) } // isAlpha is the validation function for validating if the current field's value is a valid alpha value. func isAlpha(fl FieldLevel) bool { - return alphaRegex.MatchString(fl.Field().String()) + return alphaRegex().MatchString(fl.Field().String()) } // isAlphanumUnicode is the validation function for validating if the current field's value is a valid alphanumeric unicode value. func isAlphanumUnicode(fl FieldLevel) bool { - return alphaUnicodeNumericRegex.MatchString(fl.Field().String()) + return alphaUnicodeNumericRegex().MatchString(fl.Field().String()) } // isAlphaUnicode is the validation function for validating if the current field's value is a valid alpha unicode value. func isAlphaUnicode(fl FieldLevel) bool { - return alphaUnicodeRegex.MatchString(fl.Field().String()) + return alphaUnicodeRegex().MatchString(fl.Field().String()) } -// isBoolean is the validation function for validating if the current field's value can be safely converted to a boolean. +// isBoolean is the validation function for validating if the current field's value is a valid boolean value or can be safely converted to a boolean value. func isBoolean(fl FieldLevel) bool { - _, err := strconv.ParseBool(fl.Field().String()) - return err == nil + switch fl.Field().Kind() { + case reflect.Bool: + return true + default: + _, err := strconv.ParseBool(fl.Field().String()) + return err == nil + } } // isDefault is the opposite of required aka hasValue @@ -1470,11 +1799,25 @@ func hasValue(fl FieldLevel) bool { if fl.(*validate).fldIsPointer && field.Interface() != nil { return true } - return field.IsValid() && field.Interface() != reflect.Zero(field.Type()).Interface() + return field.IsValid() && !field.IsZero() } } -// requireCheckField is a func for check field kind +// hasNotZeroValue is the validation function for validating if the current field's value is not the zero value for its type. +func hasNotZeroValue(fl FieldLevel) bool { + field := fl.Field() + switch field.Kind() { + case reflect.Slice, reflect.Map, reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: + return !field.IsNil() + default: + if fl.(*validate).fldIsPointer && field.Interface() != nil { + return !field.IsZero() + } + return field.IsValid() && !field.IsZero() + } +} + +// requireCheckFieldKind is a func for check field kind func requireCheckFieldKind(fl FieldLevel, param string, defaultNotFoundValue bool) bool { field := fl.Field() kind := field.Kind() @@ -1494,12 +1837,14 @@ func requireCheckFieldKind(fl FieldLevel, param string, defaultNotFoundValue boo if nullable && field.Interface() != nil { return false } - return field.IsValid() && field.Interface() == reflect.Zero(field.Type()).Interface() + return field.IsValid() && field.IsZero() } } // requireCheckFieldValue is a func for check field value -func requireCheckFieldValue(fl FieldLevel, param string, value string, defaultNotFoundValue bool) bool { +func requireCheckFieldValue( + fl FieldLevel, param string, value string, defaultNotFoundValue bool, +) bool { field, kind, _, found := fl.GetStructFieldOKAdvanced2(fl.Parent(), param) if !found { return defaultNotFoundValue @@ -1513,14 +1858,24 @@ func requireCheckFieldValue(fl FieldLevel, param string, value string, defaultNo case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: return field.Uint() == asUint(value) - case reflect.Float32, reflect.Float64: - return field.Float() == asFloat(value) + case reflect.Float32: + return field.Float() == asFloat32(value) + + case reflect.Float64: + return field.Float() == asFloat64(value) case reflect.Slice, reflect.Map, reflect.Array: return int64(field.Len()) == asInt(value) case reflect.Bool: - return field.Bool() == asBool(value) + return field.Bool() == (value == "true") + + case reflect.Ptr: + if field.IsNil() { + return value == "nil" + } + // Handle non-nil pointers + return requireCheckFieldValue(fl, param, value, defaultNotFoundValue) } // default reflect.String: @@ -1542,6 +1897,22 @@ func requiredIf(fl FieldLevel) bool { return hasValue(fl) } +// excludedIf is the validation function +// The field under validation must not be present or is empty only if all the other specified fields are equal to the value following with the specified field. +func excludedIf(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for excluded_if %s", fl.FieldName())) + } + + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return !hasValue(fl) +} + // requiredUnless is the validation function // The field under validation must be present and not empty only unless all the other specified fields are equal to the value following with the specified field. func requiredUnless(fl FieldLevel) bool { @@ -1558,6 +1929,36 @@ func requiredUnless(fl FieldLevel) bool { return hasValue(fl) } +// skipUnless is the validation function +// The field under validation must be present and not empty only unless all the other specified fields are equal to the value following with the specified field. +func skipUnless(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for skip_unless %s", fl.FieldName())) + } + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return hasValue(fl) +} + +// excludedUnless is the validation function +// The field under validation must not be present or is empty unless all the other specified fields are equal to the value following with the specified field. +func excludedUnless(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for excluded_unless %s", fl.FieldName())) + } + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return !hasValue(fl) + } + } + return true +} + // excludedWith is the validation function // The field under validation must not be present or is empty if any of the other specified fields are present. func excludedWith(fl FieldLevel) bool { @@ -1650,7 +2051,6 @@ func requiredWithoutAll(fl FieldLevel) bool { // isGteField is the validation function for validating if the current field's value is greater than or equal to the field specified by the param's value. func isGteField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1677,18 +2077,18 @@ func isGteField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != currentField.Type() { - return false - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { - t := currentField.Interface().(time.Time) - fieldTime := field.Interface().(time.Time) + t := currentField.Convert(timeType).Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) return fieldTime.After(t) || fieldTime.Equal(t) } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } } // default reflect.String @@ -1697,7 +2097,6 @@ func isGteField(fl FieldLevel) bool { // isGtField is the validation function for validating if the current field's value is greater than the field specified by the param's value. func isGtField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1724,18 +2123,18 @@ func isGtField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != currentField.Type() { - return false - } - - if fieldType == timeType { + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { - t := currentField.Interface().(time.Time) - fieldTime := field.Interface().(time.Time) + t := currentField.Convert(timeType).Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) return fieldTime.After(t) } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } } // default reflect.String @@ -1744,7 +2143,6 @@ func isGtField(fl FieldLevel) bool { // isGte is the validation function for validating if the current field's value is greater than or equal to the param's value. func isGte(fl FieldLevel) bool { - field := fl.Field() param := fl.Param() @@ -1770,17 +2168,22 @@ func isGte(fl FieldLevel) bool { return field.Uint() >= p - case reflect.Float32, reflect.Float64: - p := asFloat(param) + case reflect.Float32: + p := asFloat32(param) + + return field.Float() >= p + + case reflect.Float64: + p := asFloat64(param) return field.Float() >= p case reflect.Struct: - if field.Type() == timeType { + if field.Type().ConvertibleTo(timeType) { now := time.Now().UTC() - t := field.Interface().(time.Time) + t := field.Convert(timeType).Interface().(time.Time) return t.After(now) || t.Equal(now) } @@ -1791,7 +2194,6 @@ func isGte(fl FieldLevel) bool { // isGt is the validation function for validating if the current field's value is greater than the param's value. func isGt(fl FieldLevel) bool { - field := fl.Field() param := fl.Param() @@ -1817,15 +2219,20 @@ func isGt(fl FieldLevel) bool { return field.Uint() > p - case reflect.Float32, reflect.Float64: - p := asFloat(param) + case reflect.Float32: + p := asFloat32(param) + + return field.Float() > p + + case reflect.Float64: + p := asFloat64(param) return field.Float() > p - case reflect.Struct: - if field.Type() == timeType { + case reflect.Struct: - return field.Interface().(time.Time).After(time.Now().UTC()) + if field.Type().ConvertibleTo(timeType) { + return field.Convert(timeType).Interface().(time.Time).After(time.Now().UTC()) } } @@ -1834,7 +2241,6 @@ func isGt(fl FieldLevel) bool { // hasLengthOf is the validation function for validating if the current field's value is equal to the param's value. func hasLengthOf(fl FieldLevel) bool { - field := fl.Field() param := fl.Param() @@ -1860,8 +2266,13 @@ func hasLengthOf(fl FieldLevel) bool { return field.Uint() == p - case reflect.Float32, reflect.Float64: - p := asFloat(param) + case reflect.Float32: + p := asFloat32(param) + + return field.Float() == p + + case reflect.Float64: + p := asFloat64(param) return field.Float() == p } @@ -1876,7 +2287,6 @@ func hasMinOf(fl FieldLevel) bool { // isLteField is the validation function for validating if the current field's value is less than or equal to the field specified by the param's value. func isLteField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1903,18 +2313,18 @@ func isLteField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != currentField.Type() { - return false - } + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { - if fieldType == timeType { - - t := currentField.Interface().(time.Time) - fieldTime := field.Interface().(time.Time) + t := currentField.Convert(timeType).Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) return fieldTime.Before(t) || fieldTime.Equal(t) } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } } // default reflect.String @@ -1923,7 +2333,6 @@ func isLteField(fl FieldLevel) bool { // isLtField is the validation function for validating if the current field's value is less than the field specified by the param's value. func isLtField(fl FieldLevel) bool { - field := fl.Field() kind := field.Kind() @@ -1950,18 +2359,18 @@ func isLtField(fl FieldLevel) bool { fieldType := field.Type() - // Not Same underlying type i.e. struct and time - if fieldType != currentField.Type() { - return false - } + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { - if fieldType == timeType { - - t := currentField.Interface().(time.Time) - fieldTime := field.Interface().(time.Time) + t := currentField.Convert(timeType).Interface().(time.Time) + fieldTime := field.Convert(timeType).Interface().(time.Time) return fieldTime.Before(t) } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } } // default reflect.String @@ -1970,7 +2379,6 @@ func isLtField(fl FieldLevel) bool { // isLte is the validation function for validating if the current field's value is less than or equal to the param's value. func isLte(fl FieldLevel) bool { - field := fl.Field() param := fl.Param() @@ -1996,17 +2404,22 @@ func isLte(fl FieldLevel) bool { return field.Uint() <= p - case reflect.Float32, reflect.Float64: - p := asFloat(param) + case reflect.Float32: + p := asFloat32(param) + + return field.Float() <= p + + case reflect.Float64: + p := asFloat64(param) return field.Float() <= p case reflect.Struct: - if field.Type() == timeType { + if field.Type().ConvertibleTo(timeType) { now := time.Now().UTC() - t := field.Interface().(time.Time) + t := field.Convert(timeType).Interface().(time.Time) return t.Before(now) || t.Equal(now) } @@ -2017,7 +2430,6 @@ func isLte(fl FieldLevel) bool { // isLt is the validation function for validating if the current field's value is less than the param's value. func isLt(fl FieldLevel) bool { - field := fl.Field() param := fl.Param() @@ -2043,16 +2455,20 @@ func isLt(fl FieldLevel) bool { return field.Uint() < p - case reflect.Float32, reflect.Float64: - p := asFloat(param) + case reflect.Float32: + p := asFloat32(param) return field.Float() < p - case reflect.Struct: + case reflect.Float64: + p := asFloat64(param) - if field.Type() == timeType { + return field.Float() < p + + case reflect.Struct: - return field.Interface().(time.Time).Before(time.Now().UTC()) + if field.Type().ConvertibleTo(timeType) { + return field.Convert(timeType).Interface().(time.Time).Before(time.Now().UTC()) } } @@ -2066,7 +2482,6 @@ func hasMaxOf(fl FieldLevel) bool { // isTCP4AddrResolvable is the validation function for validating if the field's value is a resolvable tcp4 address. func isTCP4AddrResolvable(fl FieldLevel) bool { - if !isIP4Addr(fl) { return false } @@ -2077,7 +2492,6 @@ func isTCP4AddrResolvable(fl FieldLevel) bool { // isTCP6AddrResolvable is the validation function for validating if the field's value is a resolvable tcp6 address. func isTCP6AddrResolvable(fl FieldLevel) bool { - if !isIP6Addr(fl) { return false } @@ -2089,7 +2503,6 @@ func isTCP6AddrResolvable(fl FieldLevel) bool { // isTCPAddrResolvable is the validation function for validating if the field's value is a resolvable tcp address. func isTCPAddrResolvable(fl FieldLevel) bool { - if !isIP4Addr(fl) && !isIP6Addr(fl) { return false } @@ -2101,7 +2514,6 @@ func isTCPAddrResolvable(fl FieldLevel) bool { // isUDP4AddrResolvable is the validation function for validating if the field's value is a resolvable udp4 address. func isUDP4AddrResolvable(fl FieldLevel) bool { - if !isIP4Addr(fl) { return false } @@ -2113,7 +2525,6 @@ func isUDP4AddrResolvable(fl FieldLevel) bool { // isUDP6AddrResolvable is the validation function for validating if the field's value is a resolvable udp6 address. func isUDP6AddrResolvable(fl FieldLevel) bool { - if !isIP6Addr(fl) { return false } @@ -2125,7 +2536,6 @@ func isUDP6AddrResolvable(fl FieldLevel) bool { // isUDPAddrResolvable is the validation function for validating if the field's value is a resolvable udp address. func isUDPAddrResolvable(fl FieldLevel) bool { - if !isIP4Addr(fl) && !isIP6Addr(fl) { return false } @@ -2137,7 +2547,6 @@ func isUDPAddrResolvable(fl FieldLevel) bool { // isIP4AddrResolvable is the validation function for validating if the field's value is a resolvable ip4 address. func isIP4AddrResolvable(fl FieldLevel) bool { - if !isIPv4(fl) { return false } @@ -2149,7 +2558,6 @@ func isIP4AddrResolvable(fl FieldLevel) bool { // isIP6AddrResolvable is the validation function for validating if the field's value is a resolvable ip6 address. func isIP6AddrResolvable(fl FieldLevel) bool { - if !isIPv6(fl) { return false } @@ -2161,7 +2569,6 @@ func isIP6AddrResolvable(fl FieldLevel) bool { // isIPAddrResolvable is the validation function for validating if the field's value is a resolvable ip address. func isIPAddrResolvable(fl FieldLevel) bool { - if !isIP(fl) { return false } @@ -2173,14 +2580,12 @@ func isIPAddrResolvable(fl FieldLevel) bool { // isUnixAddrResolvable is the validation function for validating if the field's value is a resolvable unix address. func isUnixAddrResolvable(fl FieldLevel) bool { - _, err := net.ResolveUnixAddr("unix", fl.Field().String()) return err == nil } func isIP4Addr(fl FieldLevel) bool { - val := fl.Field().String() if idx := strings.LastIndex(val, ":"); idx != -1 { @@ -2193,7 +2598,6 @@ func isIP4Addr(fl FieldLevel) bool { } func isIP6Addr(fl FieldLevel) bool { - val := fl.Field().String() if idx := strings.LastIndex(val, ":"); idx != -1 { @@ -2208,11 +2612,11 @@ func isIP6Addr(fl FieldLevel) bool { } func isHostnameRFC952(fl FieldLevel) bool { - return hostnameRegexRFC952.MatchString(fl.Field().String()) + return hostnameRegexRFC952().MatchString(fl.Field().String()) } func isHostnameRFC1123(fl FieldLevel) bool { - return hostnameRegexRFC1123.MatchString(fl.Field().String()) + return hostnameRegexRFC1123().MatchString(fl.Field().String()) } func isFQDN(fl FieldLevel) bool { @@ -2222,10 +2626,10 @@ func isFQDN(fl FieldLevel) bool { return false } - return fqdnRegexRFC1123.MatchString(val) + return fqdnRegexRFC1123().MatchString(val) } -// isDir is the validation function for validating if the current field's value is a valid directory. +// isDir is the validation function for validating if the current field's value is a valid existing directory. func isDir(fl FieldLevel) bool { field := fl.Field() @@ -2241,13 +2645,78 @@ func isDir(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } +// isDirPath is the validation function for validating if the current field's value is a valid directory. +func isDirPath(fl FieldLevel) bool { + var exists bool + var err error + + field := fl.Field() + + // If it exists, it obviously is valid. + // This is done first to avoid code duplication and unnecessary additional logic. + if exists = isDir(fl); exists { + return true + } + + // It does not exist but may still be a valid path. + switch field.Kind() { + case reflect.String: + // Every OS allows for whitespace, but none + // let you use a dir with no name (to my knowledge). + // Unless you're dealing with raw inodes, but I digress. + if strings.TrimSpace(field.String()) == "" { + return false + } + if _, err = os.Stat(field.String()); err != nil { + switch t := err.(type) { + case *fs.PathError: + if t.Err == syscall.EINVAL { + // It's definitely an invalid character in the path. + return false + } + // It could be a permission error, a does-not-exist error, etc. + // Out-of-scope for this validation, though. + // Lastly, we make sure it is a directory. + if strings.HasSuffix(field.String(), string(os.PathSeparator)) { + return true + } else { + return false + } + default: + // Something went *seriously* wrong. + /* + Per https://pkg.go.dev/os#Stat: + "If there is an error, it will be of type *PathError." + */ + panic(err) + } + } + // We repeat the check here to make sure it is an explicit directory in case the above os.Stat didn't trigger an error. + if strings.HasSuffix(field.String(), string(os.PathSeparator)) { + return true + } else { + return false + } + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + // isJSON is the validation function for validating if the current field's value is a valid json string. func isJSON(fl FieldLevel) bool { field := fl.Field() - if field.Kind() == reflect.String { + switch field.Kind() { + case reflect.String: val := field.String() return json.Valid([]byte(val)) + case reflect.Slice: + fieldType := field.Type() + + if fieldType.ConvertibleTo(byteSliceType) { + b := field.Convert(byteSliceType).Interface().([]byte) + return json.Valid(b) + } } panic(fmt.Sprintf("Bad field type %T", field.Interface())) @@ -2255,7 +2724,7 @@ func isJSON(fl FieldLevel) bool { // isJWT is the validation function for validating if the current field's value is a valid JWT string. func isJWT(fl FieldLevel) bool { - return jWTRegex.MatchString(fl.Field().String()) + return jWTRegex().MatchString(fl.Field().String()) } // isHostnamePort validates a : combination for fields typically used for socket address. @@ -2266,17 +2735,26 @@ func isHostnamePort(fl FieldLevel) bool { return false } // Port must be a iny <= 65535. - if portNum, err := strconv.ParseInt(port, 10, 32); err != nil || portNum > 65535 || portNum < 1 { + if portNum, err := strconv.ParseInt( + port, 10, 32, + ); err != nil || portNum > 65535 || portNum < 1 { return false } // If host is specified, it should match a DNS name if host != "" { - return hostnameRegexRFC1123.MatchString(host) + return hostnameRegexRFC1123().MatchString(host) } return true } +// IsPort validates if the current field's value represents a valid port +func isPort(fl FieldLevel) bool { + val := fl.Field().Uint() + + return val >= 1 && val <= 65535 +} + // isLowercase is the validation function for validating if the current field's value is a lowercase string. func isLowercase(fl FieldLevel) bool { field := fl.Field() @@ -2343,17 +2821,29 @@ func isTimeZone(fl FieldLevel) bool { // isIso3166Alpha2 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-2 country code. func isIso3166Alpha2(fl FieldLevel) bool { - val := fl.Field().String() - return iso3166_1_alpha2[val] + _, ok := iso3166_1_alpha2[fl.Field().String()] + return ok +} + +// isIso3166Alpha2EU is the validation function for validating if the current field's value is a valid iso3166-1 alpha-2 European Union country code. +func isIso3166Alpha2EU(fl FieldLevel) bool { + _, ok := iso3166_1_alpha2_eu[fl.Field().String()] + return ok } -// isIso3166Alpha2 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-3 country code. +// isIso3166Alpha3 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-3 country code. func isIso3166Alpha3(fl FieldLevel) bool { - val := fl.Field().String() - return iso3166_1_alpha3[val] + _, ok := iso3166_1_alpha3[fl.Field().String()] + return ok } -// isIso3166Alpha2 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-numeric country code. +// isIso3166Alpha3EU is the validation function for validating if the current field's value is a valid iso3166-1 alpha-3 European Union country code. +func isIso3166Alpha3EU(fl FieldLevel) bool { + _, ok := iso3166_1_alpha3_eu[fl.Field().String()] + return ok +} + +// isIso3166AlphaNumeric is the validation function for validating if the current field's value is a valid iso3166-1 alpha-numeric country code. func isIso3166AlphaNumeric(fl FieldLevel) bool { field := fl.Field() @@ -2372,19 +2862,45 @@ func isIso3166AlphaNumeric(fl FieldLevel) bool { default: panic(fmt.Sprintf("Bad field type %T", field.Interface())) } - return iso3166_1_alpha_numeric[code] + + _, ok := iso3166_1_alpha_numeric[code] + return ok +} + +// isIso3166AlphaNumericEU is the validation function for validating if the current field's value is a valid iso3166-1 alpha-numeric European Union country code. +func isIso3166AlphaNumericEU(fl FieldLevel) bool { + field := fl.Field() + + var code int + switch field.Kind() { + case reflect.String: + i, err := strconv.Atoi(field.String()) + if err != nil { + return false + } + code = i % 1000 + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + code = int(field.Int() % 1000) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + code = int(field.Uint() % 1000) + default: + panic(fmt.Sprintf("Bad field type %T", field.Interface())) + } + + _, ok := iso3166_1_alpha_numeric_eu[code] + return ok } // isIso31662 is the validation function for validating if the current field's value is a valid iso3166-2 code. func isIso31662(fl FieldLevel) bool { - val := fl.Field().String() - return iso3166_2[val] + _, ok := iso3166_2[fl.Field().String()] + return ok } // isIso4217 is the validation function for validating if the current field's value is a valid iso4217 currency code. func isIso4217(fl FieldLevel) bool { - val := fl.Field().String() - return iso4217[val] + _, ok := iso4217[fl.Field().String()] + return ok } // isIso4217Numeric is the validation function for validating if the current field's value is a valid iso4217 numeric currency code. @@ -2400,7 +2916,9 @@ func isIso4217Numeric(fl FieldLevel) bool { default: panic(fmt.Sprintf("Bad field type %T", field.Interface())) } - return iso4217_numeric[code] + + _, ok := iso4217_numeric[code] + return ok } // isBCP47LanguageTag is the validation function for validating if the current field's value is a valid BCP 47 language tag, as parsed by language.Parse @@ -2419,14 +2937,21 @@ func isBCP47LanguageTag(fl FieldLevel) bool { func isIsoBicFormat(fl FieldLevel) bool { bicString := fl.Field().String() - return bicRegex.MatchString(bicString) + return bicRegex().MatchString(bicString) } // isSemverFormat is the validation function for validating if the current field's value is a valid semver version, defined in Semantic Versioning 2.0.0 func isSemverFormat(fl FieldLevel) bool { semverString := fl.Field().String() - return semverRegex.MatchString(semverString) + return semverRegex().MatchString(semverString) +} + +// isCveFormat is the validation function for validating if the current field's value is a valid cve id, defined in CVE mitre org +func isCveFormat(fl FieldLevel) bool { + cveString := fl.Field().String() + + return cveRegex().MatchString(cveString) } // isDnsRFC1035LabelFormat is the validation function @@ -2434,5 +2959,123 @@ func isSemverFormat(fl FieldLevel) bool { // a valid dns RFC 1035 label, defined in RFC 1035. func isDnsRFC1035LabelFormat(fl FieldLevel) bool { val := fl.Field().String() - return dnsRegexRFC1035Label.MatchString(val) + + size := len(val) + if size > 63 { + return false + } + + return dnsRegexRFC1035Label().MatchString(val) +} + +// digitsHaveLuhnChecksum returns true if and only if the last element of the given digits slice is the Luhn checksum of the previous elements +func digitsHaveLuhnChecksum(digits []string) bool { + size := len(digits) + sum := 0 + for i, digit := range digits { + value, err := strconv.Atoi(digit) + if err != nil { + return false + } + if size%2 == 0 && i%2 == 0 || size%2 == 1 && i%2 == 1 { + v := value * 2 + if v >= 10 { + sum += 1 + (v % 10) + } else { + sum += v + } + } else { + sum += value + } + } + return (sum % 10) == 0 +} + +// isMongoDBObjectId is the validation function for validating if the current field's value is valid MongoDB ObjectID +func isMongoDBObjectId(fl FieldLevel) bool { + val := fl.Field().String() + return mongodbIdRegex().MatchString(val) +} + +// isMongoDBConnectionString is the validation function for validating if the current field's value is valid MongoDB Connection String +func isMongoDBConnectionString(fl FieldLevel) bool { + val := fl.Field().String() + return mongodbConnectionRegex().MatchString(val) +} + +// isSpiceDB is the validation function for validating if the current field's value is valid for use with Authzed SpiceDB in the indicated way +func isSpiceDB(fl FieldLevel) bool { + val := fl.Field().String() + param := fl.Param() + + switch param { + case "permission": + return spicedbPermissionRegex().MatchString(val) + case "type": + return spicedbTypeRegex().MatchString(val) + case "id", "": + return spicedbIDRegex().MatchString(val) + } + + panic("Unrecognized parameter: " + param) +} + +// isCreditCard is the validation function for validating if the current field's value is a valid credit card number +func isCreditCard(fl FieldLevel) bool { + val := fl.Field().String() + var creditCard bytes.Buffer + segments := strings.Split(val, " ") + for _, segment := range segments { + if len(segment) < 3 { + return false + } + creditCard.WriteString(segment) + } + + ccDigits := strings.Split(creditCard.String(), "") + size := len(ccDigits) + if size < 12 || size > 19 { + return false + } + + return digitsHaveLuhnChecksum(ccDigits) +} + +// hasLuhnChecksum is the validation for validating if the current field's value has a valid Luhn checksum +func hasLuhnChecksum(fl FieldLevel) bool { + field := fl.Field() + var str string // convert to a string which will then be split into single digits; easier and more readable than shifting/extracting single digits from a number + switch field.Kind() { + case reflect.String: + str = field.String() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + str = strconv.FormatInt(field.Int(), 10) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + str = strconv.FormatUint(field.Uint(), 10) + default: + panic(fmt.Sprintf("Bad field type %T", field.Interface())) + } + size := len(str) + if size < 2 { // there has to be at least one digit that carries a meaning + the checksum + return false + } + digits := strings.Split(str, "") + return digitsHaveLuhnChecksum(digits) +} + +// isCron is the validation function for validating if the current field's value is a valid cron expression +func isCron(fl FieldLevel) bool { + cronString := fl.Field().String() + return cronRegex().MatchString(cronString) +} + +// isEIN is the validation function for validating if the current field's value is a valid U.S. Employer Identification Number (EIN) +func isEIN(fl FieldLevel) bool { + field := fl.Field() + + if field.Len() != 10 { + return false + } + + return einRegex().MatchString(field.String()) } diff --git a/vendor/github.com/go-playground/validator/v10/cache.go b/vendor/github.com/go-playground/validator/v10/cache.go index 0d18d6ec..41d40bfe 100644 --- a/vendor/github.com/go-playground/validator/v10/cache.go +++ b/vendor/github.com/go-playground/validator/v10/cache.go @@ -20,6 +20,8 @@ const ( typeOr typeKeys typeEndKeys + typeOmitNil + typeOmitZero ) const ( @@ -114,6 +116,7 @@ func (v *Validate) extractStructCache(current reflect.Value, sName string) *cStr cs = &cStruct{name: sName, fields: make([]*cField, 0), fn: v.structLevelFuncs[typ]} numFields := current.NumField() + rules := v.rules[typ] var ctag *cTag var fld reflect.StructField @@ -124,11 +127,15 @@ func (v *Validate) extractStructCache(current reflect.Value, sName string) *cStr fld = typ.Field(i) - if !fld.Anonymous && len(fld.PkgPath) > 0 { + if !v.privateFieldValidation && !fld.Anonymous && len(fld.PkgPath) > 0 { continue } - tag = fld.Tag.Get(v.tagName) + if rtag, ok := rules[fld.Name]; ok { + tag = rtag + } else { + tag = fld.Tag.Get(v.tagName) + } if tag == skipValidationTag { continue @@ -243,10 +250,18 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s } return + case omitzero: + current.typeof = typeOmitZero + continue + case omitempty: current.typeof = typeOmitEmpty continue + case omitnil: + current.typeof = typeOmitNil + continue + case structOnlyTag: current.typeof = typeStructOnly continue @@ -284,7 +299,7 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s if wrapper, ok := v.validations[current.tag]; ok { current.fn = wrapper.fn - current.runValidationWhenNil = wrapper.runValidatinOnNil + current.runValidationWhenNil = wrapper.runValidationOnNil } else { panic(strings.TrimSpace(fmt.Sprintf(undefinedValidation, current.tag, fieldName))) } @@ -294,7 +309,7 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s } if len(vals) > 1 { - current.param = strings.Replace(strings.Replace(vals[1], utf8HexComma, ",", -1), utf8Pipe, "|", -1) + current.param = strings.ReplaceAll(strings.ReplaceAll(vals[1], utf8HexComma, ","), utf8Pipe, "|") } } current.isBlockEnd = true diff --git a/vendor/github.com/go-playground/validator/v10/country_codes.go b/vendor/github.com/go-playground/validator/v10/country_codes.go index 0d9eda03..b5f10d3c 100644 --- a/vendor/github.com/go-playground/validator/v10/country_codes.go +++ b/vendor/github.com/go-playground/validator/v10/country_codes.go @@ -1,1132 +1,1177 @@ package validator -var iso3166_1_alpha2 = map[string]bool{ +var iso3166_1_alpha2 = map[string]struct{}{ // see: https://www.iso.org/iso-3166-country-codes.html - "AF": true, "AX": true, "AL": true, "DZ": true, "AS": true, - "AD": true, "AO": true, "AI": true, "AQ": true, "AG": true, - "AR": true, "AM": true, "AW": true, "AU": true, "AT": true, - "AZ": true, "BS": true, "BH": true, "BD": true, "BB": true, - "BY": true, "BE": true, "BZ": true, "BJ": true, "BM": true, - "BT": true, "BO": true, "BQ": true, "BA": true, "BW": true, - "BV": true, "BR": true, "IO": true, "BN": true, "BG": true, - "BF": true, "BI": true, "KH": true, "CM": true, "CA": true, - "CV": true, "KY": true, "CF": true, "TD": true, "CL": true, - "CN": true, "CX": true, "CC": true, "CO": true, "KM": true, - "CG": true, "CD": true, "CK": true, "CR": true, "CI": true, - "HR": true, "CU": true, "CW": true, "CY": true, "CZ": true, - "DK": true, "DJ": true, "DM": true, "DO": true, "EC": true, - "EG": true, "SV": true, "GQ": true, "ER": true, "EE": true, - "ET": true, "FK": true, "FO": true, "FJ": true, "FI": true, - "FR": true, "GF": true, "PF": true, "TF": true, "GA": true, - "GM": true, "GE": true, "DE": true, "GH": true, "GI": true, - "GR": true, "GL": true, "GD": true, "GP": true, "GU": true, - "GT": true, "GG": true, "GN": true, "GW": true, "GY": true, - "HT": true, "HM": true, "VA": true, "HN": true, "HK": true, - "HU": true, "IS": true, "IN": true, "ID": true, "IR": true, - "IQ": true, "IE": true, "IM": true, "IL": true, "IT": true, - "JM": true, "JP": true, "JE": true, "JO": true, "KZ": true, - "KE": true, "KI": true, "KP": true, "KR": true, "KW": true, - "KG": true, "LA": true, "LV": true, "LB": true, "LS": true, - "LR": true, "LY": true, "LI": true, "LT": true, "LU": true, - "MO": true, "MK": true, "MG": true, "MW": true, "MY": true, - "MV": true, "ML": true, "MT": true, "MH": true, "MQ": true, - "MR": true, "MU": true, "YT": true, "MX": true, "FM": true, - "MD": true, "MC": true, "MN": true, "ME": true, "MS": true, - "MA": true, "MZ": true, "MM": true, "NA": true, "NR": true, - "NP": true, "NL": true, "NC": true, "NZ": true, "NI": true, - "NE": true, "NG": true, "NU": true, "NF": true, "MP": true, - "NO": true, "OM": true, "PK": true, "PW": true, "PS": true, - "PA": true, "PG": true, "PY": true, "PE": true, "PH": true, - "PN": true, "PL": true, "PT": true, "PR": true, "QA": true, - "RE": true, "RO": true, "RU": true, "RW": true, "BL": true, - "SH": true, "KN": true, "LC": true, "MF": true, "PM": true, - "VC": true, "WS": true, "SM": true, "ST": true, "SA": true, - "SN": true, "RS": true, "SC": true, "SL": true, "SG": true, - "SX": true, "SK": true, "SI": true, "SB": true, "SO": true, - "ZA": true, "GS": true, "SS": true, "ES": true, "LK": true, - "SD": true, "SR": true, "SJ": true, "SZ": true, "SE": true, - "CH": true, "SY": true, "TW": true, "TJ": true, "TZ": true, - "TH": true, "TL": true, "TG": true, "TK": true, "TO": true, - "TT": true, "TN": true, "TR": true, "TM": true, "TC": true, - "TV": true, "UG": true, "UA": true, "AE": true, "GB": true, - "US": true, "UM": true, "UY": true, "UZ": true, "VU": true, - "VE": true, "VN": true, "VG": true, "VI": true, "WF": true, - "EH": true, "YE": true, "ZM": true, "ZW": true, + "AF": {}, "AX": {}, "AL": {}, "DZ": {}, "AS": {}, + "AD": {}, "AO": {}, "AI": {}, "AQ": {}, "AG": {}, + "AR": {}, "AM": {}, "AW": {}, "AU": {}, "AT": {}, + "AZ": {}, "BS": {}, "BH": {}, "BD": {}, "BB": {}, + "BY": {}, "BE": {}, "BZ": {}, "BJ": {}, "BM": {}, + "BT": {}, "BO": {}, "BQ": {}, "BA": {}, "BW": {}, + "BV": {}, "BR": {}, "IO": {}, "BN": {}, "BG": {}, + "BF": {}, "BI": {}, "KH": {}, "CM": {}, "CA": {}, + "CV": {}, "KY": {}, "CF": {}, "TD": {}, "CL": {}, + "CN": {}, "CX": {}, "CC": {}, "CO": {}, "KM": {}, + "CG": {}, "CD": {}, "CK": {}, "CR": {}, "CI": {}, + "HR": {}, "CU": {}, "CW": {}, "CY": {}, "CZ": {}, + "DK": {}, "DJ": {}, "DM": {}, "DO": {}, "EC": {}, + "EG": {}, "SV": {}, "GQ": {}, "ER": {}, "EE": {}, + "ET": {}, "FK": {}, "FO": {}, "FJ": {}, "FI": {}, + "FR": {}, "GF": {}, "PF": {}, "TF": {}, "GA": {}, + "GM": {}, "GE": {}, "DE": {}, "GH": {}, "GI": {}, + "GR": {}, "GL": {}, "GD": {}, "GP": {}, "GU": {}, + "GT": {}, "GG": {}, "GN": {}, "GW": {}, "GY": {}, + "HT": {}, "HM": {}, "VA": {}, "HN": {}, "HK": {}, + "HU": {}, "IS": {}, "IN": {}, "ID": {}, "IR": {}, + "IQ": {}, "IE": {}, "IM": {}, "IL": {}, "IT": {}, + "JM": {}, "JP": {}, "JE": {}, "JO": {}, "KZ": {}, + "KE": {}, "KI": {}, "KP": {}, "KR": {}, "KW": {}, + "KG": {}, "LA": {}, "LV": {}, "LB": {}, "LS": {}, + "LR": {}, "LY": {}, "LI": {}, "LT": {}, "LU": {}, + "MO": {}, "MK": {}, "MG": {}, "MW": {}, "MY": {}, + "MV": {}, "ML": {}, "MT": {}, "MH": {}, "MQ": {}, + "MR": {}, "MU": {}, "YT": {}, "MX": {}, "FM": {}, + "MD": {}, "MC": {}, "MN": {}, "ME": {}, "MS": {}, + "MA": {}, "MZ": {}, "MM": {}, "NA": {}, "NR": {}, + "NP": {}, "NL": {}, "NC": {}, "NZ": {}, "NI": {}, + "NE": {}, "NG": {}, "NU": {}, "NF": {}, "MP": {}, + "NO": {}, "OM": {}, "PK": {}, "PW": {}, "PS": {}, + "PA": {}, "PG": {}, "PY": {}, "PE": {}, "PH": {}, + "PN": {}, "PL": {}, "PT": {}, "PR": {}, "QA": {}, + "RE": {}, "RO": {}, "RU": {}, "RW": {}, "BL": {}, + "SH": {}, "KN": {}, "LC": {}, "MF": {}, "PM": {}, + "VC": {}, "WS": {}, "SM": {}, "ST": {}, "SA": {}, + "SN": {}, "RS": {}, "SC": {}, "SL": {}, "SG": {}, + "SX": {}, "SK": {}, "SI": {}, "SB": {}, "SO": {}, + "ZA": {}, "GS": {}, "SS": {}, "ES": {}, "LK": {}, + "SD": {}, "SR": {}, "SJ": {}, "SZ": {}, "SE": {}, + "CH": {}, "SY": {}, "TW": {}, "TJ": {}, "TZ": {}, + "TH": {}, "TL": {}, "TG": {}, "TK": {}, "TO": {}, + "TT": {}, "TN": {}, "TR": {}, "TM": {}, "TC": {}, + "TV": {}, "UG": {}, "UA": {}, "AE": {}, "GB": {}, + "US": {}, "UM": {}, "UY": {}, "UZ": {}, "VU": {}, + "VE": {}, "VN": {}, "VG": {}, "VI": {}, "WF": {}, + "EH": {}, "YE": {}, "ZM": {}, "ZW": {}, "XK": {}, } -var iso3166_1_alpha3 = map[string]bool{ +var iso3166_1_alpha2_eu = map[string]struct{}{ + "AT": {}, "BE": {}, "BG": {}, "HR": {}, "CY": {}, + "CZ": {}, "DK": {}, "EE": {}, "FI": {}, "FR": {}, + "DE": {}, "GR": {}, "HU": {}, "IE": {}, "IT": {}, + "LV": {}, "LT": {}, "LU": {}, "MT": {}, "NL": {}, + "PL": {}, "PT": {}, "RO": {}, "SK": {}, "SI": {}, + "ES": {}, "SE": {}, +} + +var iso3166_1_alpha3 = map[string]struct{}{ // see: https://www.iso.org/iso-3166-country-codes.html - "AFG": true, "ALB": true, "DZA": true, "ASM": true, "AND": true, - "AGO": true, "AIA": true, "ATA": true, "ATG": true, "ARG": true, - "ARM": true, "ABW": true, "AUS": true, "AUT": true, "AZE": true, - "BHS": true, "BHR": true, "BGD": true, "BRB": true, "BLR": true, - "BEL": true, "BLZ": true, "BEN": true, "BMU": true, "BTN": true, - "BOL": true, "BES": true, "BIH": true, "BWA": true, "BVT": true, - "BRA": true, "IOT": true, "BRN": true, "BGR": true, "BFA": true, - "BDI": true, "CPV": true, "KHM": true, "CMR": true, "CAN": true, - "CYM": true, "CAF": true, "TCD": true, "CHL": true, "CHN": true, - "CXR": true, "CCK": true, "COL": true, "COM": true, "COD": true, - "COG": true, "COK": true, "CRI": true, "HRV": true, "CUB": true, - "CUW": true, "CYP": true, "CZE": true, "CIV": true, "DNK": true, - "DJI": true, "DMA": true, "DOM": true, "ECU": true, "EGY": true, - "SLV": true, "GNQ": true, "ERI": true, "EST": true, "SWZ": true, - "ETH": true, "FLK": true, "FRO": true, "FJI": true, "FIN": true, - "FRA": true, "GUF": true, "PYF": true, "ATF": true, "GAB": true, - "GMB": true, "GEO": true, "DEU": true, "GHA": true, "GIB": true, - "GRC": true, "GRL": true, "GRD": true, "GLP": true, "GUM": true, - "GTM": true, "GGY": true, "GIN": true, "GNB": true, "GUY": true, - "HTI": true, "HMD": true, "VAT": true, "HND": true, "HKG": true, - "HUN": true, "ISL": true, "IND": true, "IDN": true, "IRN": true, - "IRQ": true, "IRL": true, "IMN": true, "ISR": true, "ITA": true, - "JAM": true, "JPN": true, "JEY": true, "JOR": true, "KAZ": true, - "KEN": true, "KIR": true, "PRK": true, "KOR": true, "KWT": true, - "KGZ": true, "LAO": true, "LVA": true, "LBN": true, "LSO": true, - "LBR": true, "LBY": true, "LIE": true, "LTU": true, "LUX": true, - "MAC": true, "MDG": true, "MWI": true, "MYS": true, "MDV": true, - "MLI": true, "MLT": true, "MHL": true, "MTQ": true, "MRT": true, - "MUS": true, "MYT": true, "MEX": true, "FSM": true, "MDA": true, - "MCO": true, "MNG": true, "MNE": true, "MSR": true, "MAR": true, - "MOZ": true, "MMR": true, "NAM": true, "NRU": true, "NPL": true, - "NLD": true, "NCL": true, "NZL": true, "NIC": true, "NER": true, - "NGA": true, "NIU": true, "NFK": true, "MKD": true, "MNP": true, - "NOR": true, "OMN": true, "PAK": true, "PLW": true, "PSE": true, - "PAN": true, "PNG": true, "PRY": true, "PER": true, "PHL": true, - "PCN": true, "POL": true, "PRT": true, "PRI": true, "QAT": true, - "ROU": true, "RUS": true, "RWA": true, "REU": true, "BLM": true, - "SHN": true, "KNA": true, "LCA": true, "MAF": true, "SPM": true, - "VCT": true, "WSM": true, "SMR": true, "STP": true, "SAU": true, - "SEN": true, "SRB": true, "SYC": true, "SLE": true, "SGP": true, - "SXM": true, "SVK": true, "SVN": true, "SLB": true, "SOM": true, - "ZAF": true, "SGS": true, "SSD": true, "ESP": true, "LKA": true, - "SDN": true, "SUR": true, "SJM": true, "SWE": true, "CHE": true, - "SYR": true, "TWN": true, "TJK": true, "TZA": true, "THA": true, - "TLS": true, "TGO": true, "TKL": true, "TON": true, "TTO": true, - "TUN": true, "TUR": true, "TKM": true, "TCA": true, "TUV": true, - "UGA": true, "UKR": true, "ARE": true, "GBR": true, "UMI": true, - "USA": true, "URY": true, "UZB": true, "VUT": true, "VEN": true, - "VNM": true, "VGB": true, "VIR": true, "WLF": true, "ESH": true, - "YEM": true, "ZMB": true, "ZWE": true, "ALA": true, + "AFG": {}, "ALB": {}, "DZA": {}, "ASM": {}, "AND": {}, + "AGO": {}, "AIA": {}, "ATA": {}, "ATG": {}, "ARG": {}, + "ARM": {}, "ABW": {}, "AUS": {}, "AUT": {}, "AZE": {}, + "BHS": {}, "BHR": {}, "BGD": {}, "BRB": {}, "BLR": {}, + "BEL": {}, "BLZ": {}, "BEN": {}, "BMU": {}, "BTN": {}, + "BOL": {}, "BES": {}, "BIH": {}, "BWA": {}, "BVT": {}, + "BRA": {}, "IOT": {}, "BRN": {}, "BGR": {}, "BFA": {}, + "BDI": {}, "CPV": {}, "KHM": {}, "CMR": {}, "CAN": {}, + "CYM": {}, "CAF": {}, "TCD": {}, "CHL": {}, "CHN": {}, + "CXR": {}, "CCK": {}, "COL": {}, "COM": {}, "COD": {}, + "COG": {}, "COK": {}, "CRI": {}, "HRV": {}, "CUB": {}, + "CUW": {}, "CYP": {}, "CZE": {}, "CIV": {}, "DNK": {}, + "DJI": {}, "DMA": {}, "DOM": {}, "ECU": {}, "EGY": {}, + "SLV": {}, "GNQ": {}, "ERI": {}, "EST": {}, "SWZ": {}, + "ETH": {}, "FLK": {}, "FRO": {}, "FJI": {}, "FIN": {}, + "FRA": {}, "GUF": {}, "PYF": {}, "ATF": {}, "GAB": {}, + "GMB": {}, "GEO": {}, "DEU": {}, "GHA": {}, "GIB": {}, + "GRC": {}, "GRL": {}, "GRD": {}, "GLP": {}, "GUM": {}, + "GTM": {}, "GGY": {}, "GIN": {}, "GNB": {}, "GUY": {}, + "HTI": {}, "HMD": {}, "VAT": {}, "HND": {}, "HKG": {}, + "HUN": {}, "ISL": {}, "IND": {}, "IDN": {}, "IRN": {}, + "IRQ": {}, "IRL": {}, "IMN": {}, "ISR": {}, "ITA": {}, + "JAM": {}, "JPN": {}, "JEY": {}, "JOR": {}, "KAZ": {}, + "KEN": {}, "KIR": {}, "PRK": {}, "KOR": {}, "KWT": {}, + "KGZ": {}, "LAO": {}, "LVA": {}, "LBN": {}, "LSO": {}, + "LBR": {}, "LBY": {}, "LIE": {}, "LTU": {}, "LUX": {}, + "MAC": {}, "MDG": {}, "MWI": {}, "MYS": {}, "MDV": {}, + "MLI": {}, "MLT": {}, "MHL": {}, "MTQ": {}, "MRT": {}, + "MUS": {}, "MYT": {}, "MEX": {}, "FSM": {}, "MDA": {}, + "MCO": {}, "MNG": {}, "MNE": {}, "MSR": {}, "MAR": {}, + "MOZ": {}, "MMR": {}, "NAM": {}, "NRU": {}, "NPL": {}, + "NLD": {}, "NCL": {}, "NZL": {}, "NIC": {}, "NER": {}, + "NGA": {}, "NIU": {}, "NFK": {}, "MKD": {}, "MNP": {}, + "NOR": {}, "OMN": {}, "PAK": {}, "PLW": {}, "PSE": {}, + "PAN": {}, "PNG": {}, "PRY": {}, "PER": {}, "PHL": {}, + "PCN": {}, "POL": {}, "PRT": {}, "PRI": {}, "QAT": {}, + "ROU": {}, "RUS": {}, "RWA": {}, "REU": {}, "BLM": {}, + "SHN": {}, "KNA": {}, "LCA": {}, "MAF": {}, "SPM": {}, + "VCT": {}, "WSM": {}, "SMR": {}, "STP": {}, "SAU": {}, + "SEN": {}, "SRB": {}, "SYC": {}, "SLE": {}, "SGP": {}, + "SXM": {}, "SVK": {}, "SVN": {}, "SLB": {}, "SOM": {}, + "ZAF": {}, "SGS": {}, "SSD": {}, "ESP": {}, "LKA": {}, + "SDN": {}, "SUR": {}, "SJM": {}, "SWE": {}, "CHE": {}, + "SYR": {}, "TWN": {}, "TJK": {}, "TZA": {}, "THA": {}, + "TLS": {}, "TGO": {}, "TKL": {}, "TON": {}, "TTO": {}, + "TUN": {}, "TUR": {}, "TKM": {}, "TCA": {}, "TUV": {}, + "UGA": {}, "UKR": {}, "ARE": {}, "GBR": {}, "UMI": {}, + "USA": {}, "URY": {}, "UZB": {}, "VUT": {}, "VEN": {}, + "VNM": {}, "VGB": {}, "VIR": {}, "WLF": {}, "ESH": {}, + "YEM": {}, "ZMB": {}, "ZWE": {}, "ALA": {}, "UNK": {}, +} + +var iso3166_1_alpha3_eu = map[string]struct{}{ + "AUT": {}, "BEL": {}, "BGR": {}, "HRV": {}, "CYP": {}, + "CZE": {}, "DNK": {}, "EST": {}, "FIN": {}, "FRA": {}, + "DEU": {}, "GRC": {}, "HUN": {}, "IRL": {}, "ITA": {}, + "LVA": {}, "LTU": {}, "LUX": {}, "MLT": {}, "NLD": {}, + "POL": {}, "PRT": {}, "ROU": {}, "SVK": {}, "SVN": {}, + "ESP": {}, "SWE": {}, } -var iso3166_1_alpha_numeric = map[int]bool{ +var iso3166_1_alpha_numeric = map[int]struct{}{ // see: https://www.iso.org/iso-3166-country-codes.html - 4: true, 8: true, 12: true, 16: true, 20: true, - 24: true, 660: true, 10: true, 28: true, 32: true, - 51: true, 533: true, 36: true, 40: true, 31: true, - 44: true, 48: true, 50: true, 52: true, 112: true, - 56: true, 84: true, 204: true, 60: true, 64: true, - 68: true, 535: true, 70: true, 72: true, 74: true, - 76: true, 86: true, 96: true, 100: true, 854: true, - 108: true, 132: true, 116: true, 120: true, 124: true, - 136: true, 140: true, 148: true, 152: true, 156: true, - 162: true, 166: true, 170: true, 174: true, 180: true, - 178: true, 184: true, 188: true, 191: true, 192: true, - 531: true, 196: true, 203: true, 384: true, 208: true, - 262: true, 212: true, 214: true, 218: true, 818: true, - 222: true, 226: true, 232: true, 233: true, 748: true, - 231: true, 238: true, 234: true, 242: true, 246: true, - 250: true, 254: true, 258: true, 260: true, 266: true, - 270: true, 268: true, 276: true, 288: true, 292: true, - 300: true, 304: true, 308: true, 312: true, 316: true, - 320: true, 831: true, 324: true, 624: true, 328: true, - 332: true, 334: true, 336: true, 340: true, 344: true, - 348: true, 352: true, 356: true, 360: true, 364: true, - 368: true, 372: true, 833: true, 376: true, 380: true, - 388: true, 392: true, 832: true, 400: true, 398: true, - 404: true, 296: true, 408: true, 410: true, 414: true, - 417: true, 418: true, 428: true, 422: true, 426: true, - 430: true, 434: true, 438: true, 440: true, 442: true, - 446: true, 450: true, 454: true, 458: true, 462: true, - 466: true, 470: true, 584: true, 474: true, 478: true, - 480: true, 175: true, 484: true, 583: true, 498: true, - 492: true, 496: true, 499: true, 500: true, 504: true, - 508: true, 104: true, 516: true, 520: true, 524: true, - 528: true, 540: true, 554: true, 558: true, 562: true, - 566: true, 570: true, 574: true, 807: true, 580: true, - 578: true, 512: true, 586: true, 585: true, 275: true, - 591: true, 598: true, 600: true, 604: true, 608: true, - 612: true, 616: true, 620: true, 630: true, 634: true, - 642: true, 643: true, 646: true, 638: true, 652: true, - 654: true, 659: true, 662: true, 663: true, 666: true, - 670: true, 882: true, 674: true, 678: true, 682: true, - 686: true, 688: true, 690: true, 694: true, 702: true, - 534: true, 703: true, 705: true, 90: true, 706: true, - 710: true, 239: true, 728: true, 724: true, 144: true, - 729: true, 740: true, 744: true, 752: true, 756: true, - 760: true, 158: true, 762: true, 834: true, 764: true, - 626: true, 768: true, 772: true, 776: true, 780: true, - 788: true, 792: true, 795: true, 796: true, 798: true, - 800: true, 804: true, 784: true, 826: true, 581: true, - 840: true, 858: true, 860: true, 548: true, 862: true, - 704: true, 92: true, 850: true, 876: true, 732: true, - 887: true, 894: true, 716: true, 248: true, + 4: {}, 8: {}, 12: {}, 16: {}, 20: {}, + 24: {}, 660: {}, 10: {}, 28: {}, 32: {}, + 51: {}, 533: {}, 36: {}, 40: {}, 31: {}, + 44: {}, 48: {}, 50: {}, 52: {}, 112: {}, + 56: {}, 84: {}, 204: {}, 60: {}, 64: {}, + 68: {}, 535: {}, 70: {}, 72: {}, 74: {}, + 76: {}, 86: {}, 96: {}, 100: {}, 854: {}, + 108: {}, 132: {}, 116: {}, 120: {}, 124: {}, + 136: {}, 140: {}, 148: {}, 152: {}, 156: {}, + 162: {}, 166: {}, 170: {}, 174: {}, 180: {}, + 178: {}, 184: {}, 188: {}, 191: {}, 192: {}, + 531: {}, 196: {}, 203: {}, 384: {}, 208: {}, + 262: {}, 212: {}, 214: {}, 218: {}, 818: {}, + 222: {}, 226: {}, 232: {}, 233: {}, 748: {}, + 231: {}, 238: {}, 234: {}, 242: {}, 246: {}, + 250: {}, 254: {}, 258: {}, 260: {}, 266: {}, + 270: {}, 268: {}, 276: {}, 288: {}, 292: {}, + 300: {}, 304: {}, 308: {}, 312: {}, 316: {}, + 320: {}, 831: {}, 324: {}, 624: {}, 328: {}, + 332: {}, 334: {}, 336: {}, 340: {}, 344: {}, + 348: {}, 352: {}, 356: {}, 360: {}, 364: {}, + 368: {}, 372: {}, 833: {}, 376: {}, 380: {}, + 388: {}, 392: {}, 832: {}, 400: {}, 398: {}, + 404: {}, 296: {}, 408: {}, 410: {}, 414: {}, + 417: {}, 418: {}, 428: {}, 422: {}, 426: {}, + 430: {}, 434: {}, 438: {}, 440: {}, 442: {}, + 446: {}, 450: {}, 454: {}, 458: {}, 462: {}, + 466: {}, 470: {}, 584: {}, 474: {}, 478: {}, + 480: {}, 175: {}, 484: {}, 583: {}, 498: {}, + 492: {}, 496: {}, 499: {}, 500: {}, 504: {}, + 508: {}, 104: {}, 516: {}, 520: {}, 524: {}, + 528: {}, 540: {}, 554: {}, 558: {}, 562: {}, + 566: {}, 570: {}, 574: {}, 807: {}, 580: {}, + 578: {}, 512: {}, 586: {}, 585: {}, 275: {}, + 591: {}, 598: {}, 600: {}, 604: {}, 608: {}, + 612: {}, 616: {}, 620: {}, 630: {}, 634: {}, + 642: {}, 643: {}, 646: {}, 638: {}, 652: {}, + 654: {}, 659: {}, 662: {}, 663: {}, 666: {}, + 670: {}, 882: {}, 674: {}, 678: {}, 682: {}, + 686: {}, 688: {}, 690: {}, 694: {}, 702: {}, + 534: {}, 703: {}, 705: {}, 90: {}, 706: {}, + 710: {}, 239: {}, 728: {}, 724: {}, 144: {}, + 729: {}, 740: {}, 744: {}, 752: {}, 756: {}, + 760: {}, 158: {}, 762: {}, 834: {}, 764: {}, + 626: {}, 768: {}, 772: {}, 776: {}, 780: {}, + 788: {}, 792: {}, 795: {}, 796: {}, 798: {}, + 800: {}, 804: {}, 784: {}, 826: {}, 581: {}, + 840: {}, 858: {}, 860: {}, 548: {}, 862: {}, + 704: {}, 92: {}, 850: {}, 876: {}, 732: {}, + 887: {}, 894: {}, 716: {}, 248: {}, 153: {}, +} + +var iso3166_1_alpha_numeric_eu = map[int]struct{}{ + 40: {}, 56: {}, 100: {}, 191: {}, 196: {}, + 200: {}, 208: {}, 233: {}, 246: {}, 250: {}, + 276: {}, 300: {}, 348: {}, 372: {}, 380: {}, + 428: {}, 440: {}, 442: {}, 470: {}, 528: {}, + 616: {}, 620: {}, 642: {}, 703: {}, 705: {}, + 724: {}, 752: {}, } -var iso3166_2 = map[string]bool{ - "AD-02" : true, "AD-03" : true, "AD-04" : true, "AD-05" : true, "AD-06" : true, - "AD-07" : true, "AD-08" : true, "AE-AJ" : true, "AE-AZ" : true, "AE-DU" : true, - "AE-FU" : true, "AE-RK" : true, "AE-SH" : true, "AE-UQ" : true, "AF-BAL" : true, - "AF-BAM" : true, "AF-BDG" : true, "AF-BDS" : true, "AF-BGL" : true, "AF-DAY" : true, - "AF-FRA" : true, "AF-FYB" : true, "AF-GHA" : true, "AF-GHO" : true, "AF-HEL" : true, - "AF-HER" : true, "AF-JOW" : true, "AF-KAB" : true, "AF-KAN" : true, "AF-KAP" : true, - "AF-KDZ" : true, "AF-KHO" : true, "AF-KNR" : true, "AF-LAG" : true, "AF-LOG" : true, - "AF-NAN" : true, "AF-NIM" : true, "AF-NUR" : true, "AF-PAN" : true, "AF-PAR" : true, - "AF-PIA" : true, "AF-PKA" : true, "AF-SAM" : true, "AF-SAR" : true, "AF-TAK" : true, - "AF-URU" : true, "AF-WAR" : true, "AF-ZAB" : true, "AG-03" : true, "AG-04" : true, - "AG-05" : true, "AG-06" : true, "AG-07" : true, "AG-08" : true, "AG-10" : true, - "AG-11" : true, "AL-01" : true, "AL-02" : true, "AL-03" : true, "AL-04" : true, - "AL-05" : true, "AL-06" : true, "AL-07" : true, "AL-08" : true, "AL-09" : true, - "AL-10" : true, "AL-11" : true, "AL-12" : true, "AL-BR" : true, "AL-BU" : true, - "AL-DI" : true, "AL-DL" : true, "AL-DR" : true, "AL-DV" : true, "AL-EL" : true, - "AL-ER" : true, "AL-FR" : true, "AL-GJ" : true, "AL-GR" : true, "AL-HA" : true, - "AL-KA" : true, "AL-KB" : true, "AL-KC" : true, "AL-KO" : true, "AL-KR" : true, - "AL-KU" : true, "AL-LB" : true, "AL-LE" : true, "AL-LU" : true, "AL-MK" : true, - "AL-MM" : true, "AL-MR" : true, "AL-MT" : true, "AL-PG" : true, "AL-PQ" : true, - "AL-PR" : true, "AL-PU" : true, "AL-SH" : true, "AL-SK" : true, "AL-SR" : true, - "AL-TE" : true, "AL-TP" : true, "AL-TR" : true, "AL-VL" : true, "AM-AG" : true, - "AM-AR" : true, "AM-AV" : true, "AM-ER" : true, "AM-GR" : true, "AM-KT" : true, - "AM-LO" : true, "AM-SH" : true, "AM-SU" : true, "AM-TV" : true, "AM-VD" : true, - "AO-BGO" : true, "AO-BGU" : true, "AO-BIE" : true, "AO-CAB" : true, "AO-CCU" : true, - "AO-CNN" : true, "AO-CNO" : true, "AO-CUS" : true, "AO-HUA" : true, "AO-HUI" : true, - "AO-LNO" : true, "AO-LSU" : true, "AO-LUA" : true, "AO-MAL" : true, "AO-MOX" : true, - "AO-NAM" : true, "AO-UIG" : true, "AO-ZAI" : true, "AR-A" : true, "AR-B" : true, - "AR-C" : true, "AR-D" : true, "AR-E" : true, "AR-G" : true, "AR-H" : true, - "AR-J" : true, "AR-K" : true, "AR-L" : true, "AR-M" : true, "AR-N" : true, - "AR-P" : true, "AR-Q" : true, "AR-R" : true, "AR-S" : true, "AR-T" : true, - "AR-U" : true, "AR-V" : true, "AR-W" : true, "AR-X" : true, "AR-Y" : true, - "AR-Z" : true, "AT-1" : true, "AT-2" : true, "AT-3" : true, "AT-4" : true, - "AT-5" : true, "AT-6" : true, "AT-7" : true, "AT-8" : true, "AT-9" : true, - "AU-ACT" : true, "AU-NSW" : true, "AU-NT" : true, "AU-QLD" : true, "AU-SA" : true, - "AU-TAS" : true, "AU-VIC" : true, "AU-WA" : true, "AZ-ABS" : true, "AZ-AGA" : true, - "AZ-AGC" : true, "AZ-AGM" : true, "AZ-AGS" : true, "AZ-AGU" : true, "AZ-AST" : true, - "AZ-BA" : true, "AZ-BAB" : true, "AZ-BAL" : true, "AZ-BAR" : true, "AZ-BEY" : true, - "AZ-BIL" : true, "AZ-CAB" : true, "AZ-CAL" : true, "AZ-CUL" : true, "AZ-DAS" : true, - "AZ-FUZ" : true, "AZ-GA" : true, "AZ-GAD" : true, "AZ-GOR" : true, "AZ-GOY" : true, - "AZ-GYG" : true, "AZ-HAC" : true, "AZ-IMI" : true, "AZ-ISM" : true, "AZ-KAL" : true, - "AZ-KAN" : true, "AZ-KUR" : true, "AZ-LA" : true, "AZ-LAC" : true, "AZ-LAN" : true, - "AZ-LER" : true, "AZ-MAS" : true, "AZ-MI" : true, "AZ-NA" : true, "AZ-NEF" : true, - "AZ-NV" : true, "AZ-NX" : true, "AZ-OGU" : true, "AZ-ORD" : true, "AZ-QAB" : true, - "AZ-QAX" : true, "AZ-QAZ" : true, "AZ-QBA" : true, "AZ-QBI" : true, "AZ-QOB" : true, - "AZ-QUS" : true, "AZ-SA" : true, "AZ-SAB" : true, "AZ-SAD" : true, "AZ-SAH" : true, - "AZ-SAK" : true, "AZ-SAL" : true, "AZ-SAR" : true, "AZ-SAT" : true, "AZ-SBN" : true, - "AZ-SIY" : true, "AZ-SKR" : true, "AZ-SM" : true, "AZ-SMI" : true, "AZ-SMX" : true, - "AZ-SR" : true, "AZ-SUS" : true, "AZ-TAR" : true, "AZ-TOV" : true, "AZ-UCA" : true, - "AZ-XA" : true, "AZ-XAC" : true, "AZ-XCI" : true, "AZ-XIZ" : true, "AZ-XVD" : true, - "AZ-YAR" : true, "AZ-YE" : true, "AZ-YEV" : true, "AZ-ZAN" : true, "AZ-ZAQ" : true, - "AZ-ZAR" : true, "BA-01" : true, "BA-02" : true, "BA-03" : true, "BA-04" : true, - "BA-05" : true, "BA-06" : true, "BA-07" : true, "BA-08" : true, "BA-09" : true, - "BA-10" : true, "BA-BIH" : true, "BA-BRC" : true, "BA-SRP" : true, "BB-01" : true, - "BB-02" : true, "BB-03" : true, "BB-04" : true, "BB-05" : true, "BB-06" : true, - "BB-07" : true, "BB-08" : true, "BB-09" : true, "BB-10" : true, "BB-11" : true, - "BD-01" : true, "BD-02" : true, "BD-03" : true, "BD-04" : true, "BD-05" : true, - "BD-06" : true, "BD-07" : true, "BD-08" : true, "BD-09" : true, "BD-10" : true, - "BD-11" : true, "BD-12" : true, "BD-13" : true, "BD-14" : true, "BD-15" : true, - "BD-16" : true, "BD-17" : true, "BD-18" : true, "BD-19" : true, "BD-20" : true, - "BD-21" : true, "BD-22" : true, "BD-23" : true, "BD-24" : true, "BD-25" : true, - "BD-26" : true, "BD-27" : true, "BD-28" : true, "BD-29" : true, "BD-30" : true, - "BD-31" : true, "BD-32" : true, "BD-33" : true, "BD-34" : true, "BD-35" : true, - "BD-36" : true, "BD-37" : true, "BD-38" : true, "BD-39" : true, "BD-40" : true, - "BD-41" : true, "BD-42" : true, "BD-43" : true, "BD-44" : true, "BD-45" : true, - "BD-46" : true, "BD-47" : true, "BD-48" : true, "BD-49" : true, "BD-50" : true, - "BD-51" : true, "BD-52" : true, "BD-53" : true, "BD-54" : true, "BD-55" : true, - "BD-56" : true, "BD-57" : true, "BD-58" : true, "BD-59" : true, "BD-60" : true, - "BD-61" : true, "BD-62" : true, "BD-63" : true, "BD-64" : true, "BD-A" : true, - "BD-B" : true, "BD-C" : true, "BD-D" : true, "BD-E" : true, "BD-F" : true, - "BD-G" : true, "BE-BRU" : true, "BE-VAN" : true, "BE-VBR" : true, "BE-VLG" : true, - "BE-VLI" : true, "BE-VOV" : true, "BE-VWV" : true, "BE-WAL" : true, "BE-WBR" : true, - "BE-WHT" : true, "BE-WLG" : true, "BE-WLX" : true, "BE-WNA" : true, "BF-01" : true, - "BF-02" : true, "BF-03" : true, "BF-04" : true, "BF-05" : true, "BF-06" : true, - "BF-07" : true, "BF-08" : true, "BF-09" : true, "BF-10" : true, "BF-11" : true, - "BF-12" : true, "BF-13" : true, "BF-BAL" : true, "BF-BAM" : true, "BF-BAN" : true, - "BF-BAZ" : true, "BF-BGR" : true, "BF-BLG" : true, "BF-BLK" : true, "BF-COM" : true, - "BF-GAN" : true, "BF-GNA" : true, "BF-GOU" : true, "BF-HOU" : true, "BF-IOB" : true, - "BF-KAD" : true, "BF-KEN" : true, "BF-KMD" : true, "BF-KMP" : true, "BF-KOP" : true, - "BF-KOS" : true, "BF-KOT" : true, "BF-KOW" : true, "BF-LER" : true, "BF-LOR" : true, - "BF-MOU" : true, "BF-NAM" : true, "BF-NAO" : true, "BF-NAY" : true, "BF-NOU" : true, - "BF-OUB" : true, "BF-OUD" : true, "BF-PAS" : true, "BF-PON" : true, "BF-SEN" : true, - "BF-SIS" : true, "BF-SMT" : true, "BF-SNG" : true, "BF-SOM" : true, "BF-SOR" : true, - "BF-TAP" : true, "BF-TUI" : true, "BF-YAG" : true, "BF-YAT" : true, "BF-ZIR" : true, - "BF-ZON" : true, "BF-ZOU" : true, "BG-01" : true, "BG-02" : true, "BG-03" : true, - "BG-04" : true, "BG-05" : true, "BG-06" : true, "BG-07" : true, "BG-08" : true, - "BG-09" : true, "BG-10" : true, "BG-11" : true, "BG-12" : true, "BG-13" : true, - "BG-14" : true, "BG-15" : true, "BG-16" : true, "BG-17" : true, "BG-18" : true, - "BG-19" : true, "BG-20" : true, "BG-21" : true, "BG-22" : true, "BG-23" : true, - "BG-24" : true, "BG-25" : true, "BG-26" : true, "BG-27" : true, "BG-28" : true, - "BH-13" : true, "BH-14" : true, "BH-15" : true, "BH-16" : true, "BH-17" : true, - "BI-BB" : true, "BI-BL" : true, "BI-BM" : true, "BI-BR" : true, "BI-CA" : true, - "BI-CI" : true, "BI-GI" : true, "BI-KI" : true, "BI-KR" : true, "BI-KY" : true, - "BI-MA" : true, "BI-MU" : true, "BI-MW" : true, "BI-NG" : true, "BI-RT" : true, - "BI-RY" : true, "BJ-AK" : true, "BJ-AL" : true, "BJ-AQ" : true, "BJ-BO" : true, - "BJ-CO" : true, "BJ-DO" : true, "BJ-KO" : true, "BJ-LI" : true, "BJ-MO" : true, - "BJ-OU" : true, "BJ-PL" : true, "BJ-ZO" : true, "BN-BE" : true, "BN-BM" : true, - "BN-TE" : true, "BN-TU" : true, "BO-B" : true, "BO-C" : true, "BO-H" : true, - "BO-L" : true, "BO-N" : true, "BO-O" : true, "BO-P" : true, "BO-S" : true, - "BO-T" : true, "BQ-BO" : true, "BQ-SA" : true, "BQ-SE" : true, "BR-AC" : true, - "BR-AL" : true, "BR-AM" : true, "BR-AP" : true, "BR-BA" : true, "BR-CE" : true, - "BR-DF" : true, "BR-ES" : true, "BR-FN" : true, "BR-GO" : true, "BR-MA" : true, - "BR-MG" : true, "BR-MS" : true, "BR-MT" : true, "BR-PA" : true, "BR-PB" : true, - "BR-PE" : true, "BR-PI" : true, "BR-PR" : true, "BR-RJ" : true, "BR-RN" : true, - "BR-RO" : true, "BR-RR" : true, "BR-RS" : true, "BR-SC" : true, "BR-SE" : true, - "BR-SP" : true, "BR-TO" : true, "BS-AK" : true, "BS-BI" : true, "BS-BP" : true, - "BS-BY" : true, "BS-CE" : true, "BS-CI" : true, "BS-CK" : true, "BS-CO" : true, - "BS-CS" : true, "BS-EG" : true, "BS-EX" : true, "BS-FP" : true, "BS-GC" : true, - "BS-HI" : true, "BS-HT" : true, "BS-IN" : true, "BS-LI" : true, "BS-MC" : true, - "BS-MG" : true, "BS-MI" : true, "BS-NE" : true, "BS-NO" : true, "BS-NS" : true, - "BS-RC" : true, "BS-RI" : true, "BS-SA" : true, "BS-SE" : true, "BS-SO" : true, - "BS-SS" : true, "BS-SW" : true, "BS-WG" : true, "BT-11" : true, "BT-12" : true, - "BT-13" : true, "BT-14" : true, "BT-15" : true, "BT-21" : true, "BT-22" : true, - "BT-23" : true, "BT-24" : true, "BT-31" : true, "BT-32" : true, "BT-33" : true, - "BT-34" : true, "BT-41" : true, "BT-42" : true, "BT-43" : true, "BT-44" : true, - "BT-45" : true, "BT-GA" : true, "BT-TY" : true, "BW-CE" : true, "BW-GH" : true, - "BW-KG" : true, "BW-KL" : true, "BW-KW" : true, "BW-NE" : true, "BW-NW" : true, - "BW-SE" : true, "BW-SO" : true, "BY-BR" : true, "BY-HM" : true, "BY-HO" : true, - "BY-HR" : true, "BY-MA" : true, "BY-MI" : true, "BY-VI" : true, "BZ-BZ" : true, - "BZ-CY" : true, "BZ-CZL" : true, "BZ-OW" : true, "BZ-SC" : true, "BZ-TOL" : true, - "CA-AB" : true, "CA-BC" : true, "CA-MB" : true, "CA-NB" : true, "CA-NL" : true, - "CA-NS" : true, "CA-NT" : true, "CA-NU" : true, "CA-ON" : true, "CA-PE" : true, - "CA-QC" : true, "CA-SK" : true, "CA-YT" : true, "CD-BC" : true, "CD-BN" : true, - "CD-EQ" : true, "CD-KA" : true, "CD-KE" : true, "CD-KN" : true, "CD-KW" : true, - "CD-MA" : true, "CD-NK" : true, "CD-OR" : true, "CD-SK" : true, "CF-AC" : true, - "CF-BB" : true, "CF-BGF" : true, "CF-BK" : true, "CF-HK" : true, "CF-HM" : true, - "CF-HS" : true, "CF-KB" : true, "CF-KG" : true, "CF-LB" : true, "CF-MB" : true, - "CF-MP" : true, "CF-NM" : true, "CF-OP" : true, "CF-SE" : true, "CF-UK" : true, - "CF-VK" : true, "CG-11" : true, "CG-12" : true, "CG-13" : true, "CG-14" : true, - "CG-15" : true, "CG-2" : true, "CG-5" : true, "CG-7" : true, "CG-8" : true, - "CG-9" : true, "CG-BZV" : true, "CH-AG" : true, "CH-AI" : true, "CH-AR" : true, - "CH-BE" : true, "CH-BL" : true, "CH-BS" : true, "CH-FR" : true, "CH-GE" : true, - "CH-GL" : true, "CH-GR" : true, "CH-JU" : true, "CH-LU" : true, "CH-NE" : true, - "CH-NW" : true, "CH-OW" : true, "CH-SG" : true, "CH-SH" : true, "CH-SO" : true, - "CH-SZ" : true, "CH-TG" : true, "CH-TI" : true, "CH-UR" : true, "CH-VD" : true, - "CH-VS" : true, "CH-ZG" : true, "CH-ZH" : true, "CI-01" : true, "CI-02" : true, - "CI-03" : true, "CI-04" : true, "CI-05" : true, "CI-06" : true, "CI-07" : true, - "CI-08" : true, "CI-09" : true, "CI-10" : true, "CI-11" : true, "CI-12" : true, - "CI-13" : true, "CI-14" : true, "CI-15" : true, "CI-16" : true, "CI-17" : true, - "CI-18" : true, "CI-19" : true, "CL-AI" : true, "CL-AN" : true, "CL-AP" : true, - "CL-AR" : true, "CL-AT" : true, "CL-BI" : true, "CL-CO" : true, "CL-LI" : true, - "CL-LL" : true, "CL-LR" : true, "CL-MA" : true, "CL-ML" : true, "CL-RM" : true, - "CL-TA" : true, "CL-VS" : true, "CM-AD" : true, "CM-CE" : true, "CM-EN" : true, - "CM-ES" : true, "CM-LT" : true, "CM-NO" : true, "CM-NW" : true, "CM-OU" : true, - "CM-SU" : true, "CM-SW" : true, "CN-11" : true, "CN-12" : true, "CN-13" : true, - "CN-14" : true, "CN-15" : true, "CN-21" : true, "CN-22" : true, "CN-23" : true, - "CN-31" : true, "CN-32" : true, "CN-33" : true, "CN-34" : true, "CN-35" : true, - "CN-36" : true, "CN-37" : true, "CN-41" : true, "CN-42" : true, "CN-43" : true, - "CN-44" : true, "CN-45" : true, "CN-46" : true, "CN-50" : true, "CN-51" : true, - "CN-52" : true, "CN-53" : true, "CN-54" : true, "CN-61" : true, "CN-62" : true, - "CN-63" : true, "CN-64" : true, "CN-65" : true, "CN-71" : true, "CN-91" : true, - "CN-92" : true, "CO-AMA" : true, "CO-ANT" : true, "CO-ARA" : true, "CO-ATL" : true, - "CO-BOL" : true, "CO-BOY" : true, "CO-CAL" : true, "CO-CAQ" : true, "CO-CAS" : true, - "CO-CAU" : true, "CO-CES" : true, "CO-CHO" : true, "CO-COR" : true, "CO-CUN" : true, - "CO-DC" : true, "CO-GUA" : true, "CO-GUV" : true, "CO-HUI" : true, "CO-LAG" : true, - "CO-MAG" : true, "CO-MET" : true, "CO-NAR" : true, "CO-NSA" : true, "CO-PUT" : true, - "CO-QUI" : true, "CO-RIS" : true, "CO-SAN" : true, "CO-SAP" : true, "CO-SUC" : true, - "CO-TOL" : true, "CO-VAC" : true, "CO-VAU" : true, "CO-VID" : true, "CR-A" : true, - "CR-C" : true, "CR-G" : true, "CR-H" : true, "CR-L" : true, "CR-P" : true, - "CR-SJ" : true, "CU-01" : true, "CU-02" : true, "CU-03" : true, "CU-04" : true, - "CU-05" : true, "CU-06" : true, "CU-07" : true, "CU-08" : true, "CU-09" : true, - "CU-10" : true, "CU-11" : true, "CU-12" : true, "CU-13" : true, "CU-14" : true, - "CU-99" : true, "CV-B" : true, "CV-BR" : true, "CV-BV" : true, "CV-CA" : true, - "CV-CF" : true, "CV-CR" : true, "CV-MA" : true, "CV-MO" : true, "CV-PA" : true, - "CV-PN" : true, "CV-PR" : true, "CV-RB" : true, "CV-RG" : true, "CV-RS" : true, - "CV-S" : true, "CV-SD" : true, "CV-SF" : true, "CV-SL" : true, "CV-SM" : true, - "CV-SO" : true, "CV-SS" : true, "CV-SV" : true, "CV-TA" : true, "CV-TS" : true, - "CY-01" : true, "CY-02" : true, "CY-03" : true, "CY-04" : true, "CY-05" : true, - "CY-06" : true, "CZ-10" : true, "CZ-101" : true, "CZ-102" : true, "CZ-103" : true, - "CZ-104" : true, "CZ-105" : true, "CZ-106" : true, "CZ-107" : true, "CZ-108" : true, - "CZ-109" : true, "CZ-110" : true, "CZ-111" : true, "CZ-112" : true, "CZ-113" : true, - "CZ-114" : true, "CZ-115" : true, "CZ-116" : true, "CZ-117" : true, "CZ-118" : true, - "CZ-119" : true, "CZ-120" : true, "CZ-121" : true, "CZ-122" : true, "CZ-20" : true, - "CZ-201" : true, "CZ-202" : true, "CZ-203" : true, "CZ-204" : true, "CZ-205" : true, - "CZ-206" : true, "CZ-207" : true, "CZ-208" : true, "CZ-209" : true, "CZ-20A" : true, - "CZ-20B" : true, "CZ-20C" : true, "CZ-31" : true, "CZ-311" : true, "CZ-312" : true, - "CZ-313" : true, "CZ-314" : true, "CZ-315" : true, "CZ-316" : true, "CZ-317" : true, - "CZ-32" : true, "CZ-321" : true, "CZ-322" : true, "CZ-323" : true, "CZ-324" : true, - "CZ-325" : true, "CZ-326" : true, "CZ-327" : true, "CZ-41" : true, "CZ-411" : true, - "CZ-412" : true, "CZ-413" : true, "CZ-42" : true, "CZ-421" : true, "CZ-422" : true, - "CZ-423" : true, "CZ-424" : true, "CZ-425" : true, "CZ-426" : true, "CZ-427" : true, - "CZ-51" : true, "CZ-511" : true, "CZ-512" : true, "CZ-513" : true, "CZ-514" : true, - "CZ-52" : true, "CZ-521" : true, "CZ-522" : true, "CZ-523" : true, "CZ-524" : true, - "CZ-525" : true, "CZ-53" : true, "CZ-531" : true, "CZ-532" : true, "CZ-533" : true, - "CZ-534" : true, "CZ-63" : true, "CZ-631" : true, "CZ-632" : true, "CZ-633" : true, - "CZ-634" : true, "CZ-635" : true, "CZ-64" : true, "CZ-641" : true, "CZ-642" : true, - "CZ-643" : true, "CZ-644" : true, "CZ-645" : true, "CZ-646" : true, "CZ-647" : true, - "CZ-71" : true, "CZ-711" : true, "CZ-712" : true, "CZ-713" : true, "CZ-714" : true, - "CZ-715" : true, "CZ-72" : true, "CZ-721" : true, "CZ-722" : true, "CZ-723" : true, - "CZ-724" : true, "CZ-80" : true, "CZ-801" : true, "CZ-802" : true, "CZ-803" : true, - "CZ-804" : true, "CZ-805" : true, "CZ-806" : true, "DE-BB" : true, "DE-BE" : true, - "DE-BW" : true, "DE-BY" : true, "DE-HB" : true, "DE-HE" : true, "DE-HH" : true, - "DE-MV" : true, "DE-NI" : true, "DE-NW" : true, "DE-RP" : true, "DE-SH" : true, - "DE-SL" : true, "DE-SN" : true, "DE-ST" : true, "DE-TH" : true, "DJ-AR" : true, - "DJ-AS" : true, "DJ-DI" : true, "DJ-DJ" : true, "DJ-OB" : true, "DJ-TA" : true, - "DK-81" : true, "DK-82" : true, "DK-83" : true, "DK-84" : true, "DK-85" : true, - "DM-01" : true, "DM-02" : true, "DM-03" : true, "DM-04" : true, "DM-05" : true, - "DM-06" : true, "DM-07" : true, "DM-08" : true, "DM-09" : true, "DM-10" : true, - "DO-01" : true, "DO-02" : true, "DO-03" : true, "DO-04" : true, "DO-05" : true, - "DO-06" : true, "DO-07" : true, "DO-08" : true, "DO-09" : true, "DO-10" : true, - "DO-11" : true, "DO-12" : true, "DO-13" : true, "DO-14" : true, "DO-15" : true, - "DO-16" : true, "DO-17" : true, "DO-18" : true, "DO-19" : true, "DO-20" : true, - "DO-21" : true, "DO-22" : true, "DO-23" : true, "DO-24" : true, "DO-25" : true, - "DO-26" : true, "DO-27" : true, "DO-28" : true, "DO-29" : true, "DO-30" : true, - "DZ-01" : true, "DZ-02" : true, "DZ-03" : true, "DZ-04" : true, "DZ-05" : true, - "DZ-06" : true, "DZ-07" : true, "DZ-08" : true, "DZ-09" : true, "DZ-10" : true, - "DZ-11" : true, "DZ-12" : true, "DZ-13" : true, "DZ-14" : true, "DZ-15" : true, - "DZ-16" : true, "DZ-17" : true, "DZ-18" : true, "DZ-19" : true, "DZ-20" : true, - "DZ-21" : true, "DZ-22" : true, "DZ-23" : true, "DZ-24" : true, "DZ-25" : true, - "DZ-26" : true, "DZ-27" : true, "DZ-28" : true, "DZ-29" : true, "DZ-30" : true, - "DZ-31" : true, "DZ-32" : true, "DZ-33" : true, "DZ-34" : true, "DZ-35" : true, - "DZ-36" : true, "DZ-37" : true, "DZ-38" : true, "DZ-39" : true, "DZ-40" : true, - "DZ-41" : true, "DZ-42" : true, "DZ-43" : true, "DZ-44" : true, "DZ-45" : true, - "DZ-46" : true, "DZ-47" : true, "DZ-48" : true, "EC-A" : true, "EC-B" : true, - "EC-C" : true, "EC-D" : true, "EC-E" : true, "EC-F" : true, "EC-G" : true, - "EC-H" : true, "EC-I" : true, "EC-L" : true, "EC-M" : true, "EC-N" : true, - "EC-O" : true, "EC-P" : true, "EC-R" : true, "EC-S" : true, "EC-SD" : true, - "EC-SE" : true, "EC-T" : true, "EC-U" : true, "EC-W" : true, "EC-X" : true, - "EC-Y" : true, "EC-Z" : true, "EE-37" : true, "EE-39" : true, "EE-44" : true, - "EE-49" : true, "EE-51" : true, "EE-57" : true, "EE-59" : true, "EE-65" : true, - "EE-67" : true, "EE-70" : true, "EE-74" : true, "EE-78" : true, "EE-82" : true, - "EE-84" : true, "EE-86" : true, "EG-ALX" : true, "EG-ASN" : true, "EG-AST" : true, - "EG-BA" : true, "EG-BH" : true, "EG-BNS" : true, "EG-C" : true, "EG-DK" : true, - "EG-DT" : true, "EG-FYM" : true, "EG-GH" : true, "EG-GZ" : true, "EG-HU" : true, - "EG-IS" : true, "EG-JS" : true, "EG-KB" : true, "EG-KFS" : true, "EG-KN" : true, - "EG-MN" : true, "EG-MNF" : true, "EG-MT" : true, "EG-PTS" : true, "EG-SHG" : true, - "EG-SHR" : true, "EG-SIN" : true, "EG-SU" : true, "EG-SUZ" : true, "EG-WAD" : true, - "ER-AN" : true, "ER-DK" : true, "ER-DU" : true, "ER-GB" : true, "ER-MA" : true, - "ER-SK" : true, "ES-A" : true, "ES-AB" : true, "ES-AL" : true, "ES-AN" : true, - "ES-AR" : true, "ES-AS" : true, "ES-AV" : true, "ES-B" : true, "ES-BA" : true, - "ES-BI" : true, "ES-BU" : true, "ES-C" : true, "ES-CA" : true, "ES-CB" : true, - "ES-CC" : true, "ES-CE" : true, "ES-CL" : true, "ES-CM" : true, "ES-CN" : true, - "ES-CO" : true, "ES-CR" : true, "ES-CS" : true, "ES-CT" : true, "ES-CU" : true, - "ES-EX" : true, "ES-GA" : true, "ES-GC" : true, "ES-GI" : true, "ES-GR" : true, - "ES-GU" : true, "ES-H" : true, "ES-HU" : true, "ES-IB" : true, "ES-J" : true, - "ES-L" : true, "ES-LE" : true, "ES-LO" : true, "ES-LU" : true, "ES-M" : true, - "ES-MA" : true, "ES-MC" : true, "ES-MD" : true, "ES-ML" : true, "ES-MU" : true, - "ES-NA" : true, "ES-NC" : true, "ES-O" : true, "ES-OR" : true, "ES-P" : true, - "ES-PM" : true, "ES-PO" : true, "ES-PV" : true, "ES-RI" : true, "ES-S" : true, - "ES-SA" : true, "ES-SE" : true, "ES-SG" : true, "ES-SO" : true, "ES-SS" : true, - "ES-T" : true, "ES-TE" : true, "ES-TF" : true, "ES-TO" : true, "ES-V" : true, - "ES-VA" : true, "ES-VC" : true, "ES-VI" : true, "ES-Z" : true, "ES-ZA" : true, - "ET-AA" : true, "ET-AF" : true, "ET-AM" : true, "ET-BE" : true, "ET-DD" : true, - "ET-GA" : true, "ET-HA" : true, "ET-OR" : true, "ET-SN" : true, "ET-SO" : true, - "ET-TI" : true, "FI-01" : true, "FI-02" : true, "FI-03" : true, "FI-04" : true, - "FI-05" : true, "FI-06" : true, "FI-07" : true, "FI-08" : true, "FI-09" : true, - "FI-10" : true, "FI-11" : true, "FI-12" : true, "FI-13" : true, "FI-14" : true, - "FI-15" : true, "FI-16" : true, "FI-17" : true, "FI-18" : true, "FI-19" : true, - "FJ-C" : true, "FJ-E" : true, "FJ-N" : true, "FJ-R" : true, "FJ-W" : true, - "FM-KSA" : true, "FM-PNI" : true, "FM-TRK" : true, "FM-YAP" : true, "FR-01" : true, - "FR-02" : true, "FR-03" : true, "FR-04" : true, "FR-05" : true, "FR-06" : true, - "FR-07" : true, "FR-08" : true, "FR-09" : true, "FR-10" : true, "FR-11" : true, - "FR-12" : true, "FR-13" : true, "FR-14" : true, "FR-15" : true, "FR-16" : true, - "FR-17" : true, "FR-18" : true, "FR-19" : true, "FR-21" : true, "FR-22" : true, - "FR-23" : true, "FR-24" : true, "FR-25" : true, "FR-26" : true, "FR-27" : true, - "FR-28" : true, "FR-29" : true, "FR-2A" : true, "FR-2B" : true, "FR-30" : true, - "FR-31" : true, "FR-32" : true, "FR-33" : true, "FR-34" : true, "FR-35" : true, - "FR-36" : true, "FR-37" : true, "FR-38" : true, "FR-39" : true, "FR-40" : true, - "FR-41" : true, "FR-42" : true, "FR-43" : true, "FR-44" : true, "FR-45" : true, - "FR-46" : true, "FR-47" : true, "FR-48" : true, "FR-49" : true, "FR-50" : true, - "FR-51" : true, "FR-52" : true, "FR-53" : true, "FR-54" : true, "FR-55" : true, - "FR-56" : true, "FR-57" : true, "FR-58" : true, "FR-59" : true, "FR-60" : true, - "FR-61" : true, "FR-62" : true, "FR-63" : true, "FR-64" : true, "FR-65" : true, - "FR-66" : true, "FR-67" : true, "FR-68" : true, "FR-69" : true, "FR-70" : true, - "FR-71" : true, "FR-72" : true, "FR-73" : true, "FR-74" : true, "FR-75" : true, - "FR-76" : true, "FR-77" : true, "FR-78" : true, "FR-79" : true, "FR-80" : true, - "FR-81" : true, "FR-82" : true, "FR-83" : true, "FR-84" : true, "FR-85" : true, - "FR-86" : true, "FR-87" : true, "FR-88" : true, "FR-89" : true, "FR-90" : true, - "FR-91" : true, "FR-92" : true, "FR-93" : true, "FR-94" : true, "FR-95" : true, - "FR-ARA" : true, "FR-BFC" : true, "FR-BL" : true, "FR-BRE" : true, "FR-COR" : true, - "FR-CP" : true, "FR-CVL" : true, "FR-GES" : true, "FR-GF" : true, "FR-GP" : true, - "FR-GUA" : true, "FR-HDF" : true, "FR-IDF" : true, "FR-LRE" : true, "FR-MAY" : true, - "FR-MF" : true, "FR-MQ" : true, "FR-NAQ" : true, "FR-NC" : true, "FR-NOR" : true, - "FR-OCC" : true, "FR-PAC" : true, "FR-PDL" : true, "FR-PF" : true, "FR-PM" : true, - "FR-RE" : true, "FR-TF" : true, "FR-WF" : true, "FR-YT" : true, "GA-1" : true, - "GA-2" : true, "GA-3" : true, "GA-4" : true, "GA-5" : true, "GA-6" : true, - "GA-7" : true, "GA-8" : true, "GA-9" : true, "GB-ABC" : true, "GB-ABD" : true, - "GB-ABE" : true, "GB-AGB" : true, "GB-AGY" : true, "GB-AND" : true, "GB-ANN" : true, - "GB-ANS" : true, "GB-BAS" : true, "GB-BBD" : true, "GB-BDF" : true, "GB-BDG" : true, - "GB-BEN" : true, "GB-BEX" : true, "GB-BFS" : true, "GB-BGE" : true, "GB-BGW" : true, - "GB-BIR" : true, "GB-BKM" : true, "GB-BMH" : true, "GB-BNE" : true, "GB-BNH" : true, - "GB-BNS" : true, "GB-BOL" : true, "GB-BPL" : true, "GB-BRC" : true, "GB-BRD" : true, - "GB-BRY" : true, "GB-BST" : true, "GB-BUR" : true, "GB-CAM" : true, "GB-CAY" : true, - "GB-CBF" : true, "GB-CCG" : true, "GB-CGN" : true, "GB-CHE" : true, "GB-CHW" : true, - "GB-CLD" : true, "GB-CLK" : true, "GB-CMA" : true, "GB-CMD" : true, "GB-CMN" : true, - "GB-CON" : true, "GB-COV" : true, "GB-CRF" : true, "GB-CRY" : true, "GB-CWY" : true, - "GB-DAL" : true, "GB-DBY" : true, "GB-DEN" : true, "GB-DER" : true, "GB-DEV" : true, - "GB-DGY" : true, "GB-DNC" : true, "GB-DND" : true, "GB-DOR" : true, "GB-DRS" : true, - "GB-DUD" : true, "GB-DUR" : true, "GB-EAL" : true, "GB-EAW" : true, "GB-EAY" : true, - "GB-EDH" : true, "GB-EDU" : true, "GB-ELN" : true, "GB-ELS" : true, "GB-ENF" : true, - "GB-ENG" : true, "GB-ERW" : true, "GB-ERY" : true, "GB-ESS" : true, "GB-ESX" : true, - "GB-FAL" : true, "GB-FIF" : true, "GB-FLN" : true, "GB-FMO" : true, "GB-GAT" : true, - "GB-GBN" : true, "GB-GLG" : true, "GB-GLS" : true, "GB-GRE" : true, "GB-GWN" : true, - "GB-HAL" : true, "GB-HAM" : true, "GB-HAV" : true, "GB-HCK" : true, "GB-HEF" : true, - "GB-HIL" : true, "GB-HLD" : true, "GB-HMF" : true, "GB-HNS" : true, "GB-HPL" : true, - "GB-HRT" : true, "GB-HRW" : true, "GB-HRY" : true, "GB-IOS" : true, "GB-IOW" : true, - "GB-ISL" : true, "GB-IVC" : true, "GB-KEC" : true, "GB-KEN" : true, "GB-KHL" : true, - "GB-KIR" : true, "GB-KTT" : true, "GB-KWL" : true, "GB-LAN" : true, "GB-LBC" : true, - "GB-LBH" : true, "GB-LCE" : true, "GB-LDS" : true, "GB-LEC" : true, "GB-LEW" : true, - "GB-LIN" : true, "GB-LIV" : true, "GB-LND" : true, "GB-LUT" : true, "GB-MAN" : true, - "GB-MDB" : true, "GB-MDW" : true, "GB-MEA" : true, "GB-MIK" : true, "GD-01" : true, - "GB-MLN" : true, "GB-MON" : true, "GB-MRT" : true, "GB-MRY" : true, "GB-MTY" : true, - "GB-MUL" : true, "GB-NAY" : true, "GB-NBL" : true, "GB-NEL" : true, "GB-NET" : true, - "GB-NFK" : true, "GB-NGM" : true, "GB-NIR" : true, "GB-NLK" : true, "GB-NLN" : true, - "GB-NMD" : true, "GB-NSM" : true, "GB-NTH" : true, "GB-NTL" : true, "GB-NTT" : true, - "GB-NTY" : true, "GB-NWM" : true, "GB-NWP" : true, "GB-NYK" : true, "GB-OLD" : true, - "GB-ORK" : true, "GB-OXF" : true, "GB-PEM" : true, "GB-PKN" : true, "GB-PLY" : true, - "GB-POL" : true, "GB-POR" : true, "GB-POW" : true, "GB-PTE" : true, "GB-RCC" : true, - "GB-RCH" : true, "GB-RCT" : true, "GB-RDB" : true, "GB-RDG" : true, "GB-RFW" : true, - "GB-RIC" : true, "GB-ROT" : true, "GB-RUT" : true, "GB-SAW" : true, "GB-SAY" : true, - "GB-SCB" : true, "GB-SCT" : true, "GB-SFK" : true, "GB-SFT" : true, "GB-SGC" : true, - "GB-SHF" : true, "GB-SHN" : true, "GB-SHR" : true, "GB-SKP" : true, "GB-SLF" : true, - "GB-SLG" : true, "GB-SLK" : true, "GB-SND" : true, "GB-SOL" : true, "GB-SOM" : true, - "GB-SOS" : true, "GB-SRY" : true, "GB-STE" : true, "GB-STG" : true, "GB-STH" : true, - "GB-STN" : true, "GB-STS" : true, "GB-STT" : true, "GB-STY" : true, "GB-SWA" : true, - "GB-SWD" : true, "GB-SWK" : true, "GB-TAM" : true, "GB-TFW" : true, "GB-THR" : true, - "GB-TOB" : true, "GB-TOF" : true, "GB-TRF" : true, "GB-TWH" : true, "GB-UKM" : true, - "GB-VGL" : true, "GB-WAR" : true, "GB-WBK" : true, "GB-WDU" : true, "GB-WFT" : true, - "GB-WGN" : true, "GB-WIL" : true, "GB-WKF" : true, "GB-WLL" : true, "GB-WLN" : true, - "GB-WLS" : true, "GB-WLV" : true, "GB-WND" : true, "GB-WNM" : true, "GB-WOK" : true, - "GB-WOR" : true, "GB-WRL" : true, "GB-WRT" : true, "GB-WRX" : true, "GB-WSM" : true, - "GB-WSX" : true, "GB-YOR" : true, "GB-ZET" : true, "GD-02" : true, "GD-03" : true, - "GD-04" : true, "GD-05" : true, "GD-06" : true, "GD-10" : true, "GE-AB" : true, - "GE-AJ" : true, "GE-GU" : true, "GE-IM" : true, "GE-KA" : true, "GE-KK" : true, - "GE-MM" : true, "GE-RL" : true, "GE-SJ" : true, "GE-SK" : true, "GE-SZ" : true, - "GE-TB" : true, "GH-AA" : true, "GH-AH" : true, "GH-BA" : true, "GH-CP" : true, - "GH-EP" : true, "GH-NP" : true, "GH-TV" : true, "GH-UE" : true, "GH-UW" : true, - "GH-WP" : true, "GL-KU" : true, "GL-QA" : true, "GL-QE" : true, "GL-SM" : true, - "GM-B" : true, "GM-L" : true, "GM-M" : true, "GM-N" : true, "GM-U" : true, - "GM-W" : true, "GN-B" : true, "GN-BE" : true, "GN-BF" : true, "GN-BK" : true, - "GN-C" : true, "GN-CO" : true, "GN-D" : true, "GN-DB" : true, "GN-DI" : true, - "GN-DL" : true, "GN-DU" : true, "GN-F" : true, "GN-FA" : true, "GN-FO" : true, - "GN-FR" : true, "GN-GA" : true, "GN-GU" : true, "GN-K" : true, "GN-KA" : true, - "GN-KB" : true, "GN-KD" : true, "GN-KE" : true, "GN-KN" : true, "GN-KO" : true, - "GN-KS" : true, "GN-L" : true, "GN-LA" : true, "GN-LE" : true, "GN-LO" : true, - "GN-M" : true, "GN-MC" : true, "GN-MD" : true, "GN-ML" : true, "GN-MM" : true, - "GN-N" : true, "GN-NZ" : true, "GN-PI" : true, "GN-SI" : true, "GN-TE" : true, - "GN-TO" : true, "GN-YO" : true, "GQ-AN" : true, "GQ-BN" : true, "GQ-BS" : true, - "GQ-C" : true, "GQ-CS" : true, "GQ-I" : true, "GQ-KN" : true, "GQ-LI" : true, - "GQ-WN" : true, "GR-01" : true, "GR-03" : true, "GR-04" : true, "GR-05" : true, - "GR-06" : true, "GR-07" : true, "GR-11" : true, "GR-12" : true, "GR-13" : true, - "GR-14" : true, "GR-15" : true, "GR-16" : true, "GR-17" : true, "GR-21" : true, - "GR-22" : true, "GR-23" : true, "GR-24" : true, "GR-31" : true, "GR-32" : true, - "GR-33" : true, "GR-34" : true, "GR-41" : true, "GR-42" : true, "GR-43" : true, - "GR-44" : true, "GR-51" : true, "GR-52" : true, "GR-53" : true, "GR-54" : true, - "GR-55" : true, "GR-56" : true, "GR-57" : true, "GR-58" : true, "GR-59" : true, - "GR-61" : true, "GR-62" : true, "GR-63" : true, "GR-64" : true, "GR-69" : true, - "GR-71" : true, "GR-72" : true, "GR-73" : true, "GR-81" : true, "GR-82" : true, - "GR-83" : true, "GR-84" : true, "GR-85" : true, "GR-91" : true, "GR-92" : true, - "GR-93" : true, "GR-94" : true, "GR-A" : true, "GR-A1" : true, "GR-B" : true, - "GR-C" : true, "GR-D" : true, "GR-E" : true, "GR-F" : true, "GR-G" : true, - "GR-H" : true, "GR-I" : true, "GR-J" : true, "GR-K" : true, "GR-L" : true, - "GR-M" : true, "GT-AV" : true, "GT-BV" : true, "GT-CM" : true, "GT-CQ" : true, - "GT-ES" : true, "GT-GU" : true, "GT-HU" : true, "GT-IZ" : true, "GT-JA" : true, - "GT-JU" : true, "GT-PE" : true, "GT-PR" : true, "GT-QC" : true, "GT-QZ" : true, - "GT-RE" : true, "GT-SA" : true, "GT-SM" : true, "GT-SO" : true, "GT-SR" : true, - "GT-SU" : true, "GT-TO" : true, "GT-ZA" : true, "GW-BA" : true, "GW-BL" : true, - "GW-BM" : true, "GW-BS" : true, "GW-CA" : true, "GW-GA" : true, "GW-L" : true, - "GW-N" : true, "GW-OI" : true, "GW-QU" : true, "GW-S" : true, "GW-TO" : true, - "GY-BA" : true, "GY-CU" : true, "GY-DE" : true, "GY-EB" : true, "GY-ES" : true, - "GY-MA" : true, "GY-PM" : true, "GY-PT" : true, "GY-UD" : true, "GY-UT" : true, - "HN-AT" : true, "HN-CH" : true, "HN-CL" : true, "HN-CM" : true, "HN-CP" : true, - "HN-CR" : true, "HN-EP" : true, "HN-FM" : true, "HN-GD" : true, "HN-IB" : true, - "HN-IN" : true, "HN-LE" : true, "HN-LP" : true, "HN-OC" : true, "HN-OL" : true, - "HN-SB" : true, "HN-VA" : true, "HN-YO" : true, "HR-01" : true, "HR-02" : true, - "HR-03" : true, "HR-04" : true, "HR-05" : true, "HR-06" : true, "HR-07" : true, - "HR-08" : true, "HR-09" : true, "HR-10" : true, "HR-11" : true, "HR-12" : true, - "HR-13" : true, "HR-14" : true, "HR-15" : true, "HR-16" : true, "HR-17" : true, - "HR-18" : true, "HR-19" : true, "HR-20" : true, "HR-21" : true, "HT-AR" : true, - "HT-CE" : true, "HT-GA" : true, "HT-ND" : true, "HT-NE" : true, "HT-NO" : true, - "HT-OU" : true, "HT-SD" : true, "HT-SE" : true, "HU-BA" : true, "HU-BC" : true, - "HU-BE" : true, "HU-BK" : true, "HU-BU" : true, "HU-BZ" : true, "HU-CS" : true, - "HU-DE" : true, "HU-DU" : true, "HU-EG" : true, "HU-ER" : true, "HU-FE" : true, - "HU-GS" : true, "HU-GY" : true, "HU-HB" : true, "HU-HE" : true, "HU-HV" : true, - "HU-JN" : true, "HU-KE" : true, "HU-KM" : true, "HU-KV" : true, "HU-MI" : true, - "HU-NK" : true, "HU-NO" : true, "HU-NY" : true, "HU-PE" : true, "HU-PS" : true, - "HU-SD" : true, "HU-SF" : true, "HU-SH" : true, "HU-SK" : true, "HU-SN" : true, - "HU-SO" : true, "HU-SS" : true, "HU-ST" : true, "HU-SZ" : true, "HU-TB" : true, - "HU-TO" : true, "HU-VA" : true, "HU-VE" : true, "HU-VM" : true, "HU-ZA" : true, - "HU-ZE" : true, "ID-AC" : true, "ID-BA" : true, "ID-BB" : true, "ID-BE" : true, - "ID-BT" : true, "ID-GO" : true, "ID-IJ" : true, "ID-JA" : true, "ID-JB" : true, - "ID-JI" : true, "ID-JK" : true, "ID-JT" : true, "ID-JW" : true, "ID-KA" : true, - "ID-KB" : true, "ID-KI" : true, "ID-KR" : true, "ID-KS" : true, "ID-KT" : true, - "ID-LA" : true, "ID-MA" : true, "ID-ML" : true, "ID-MU" : true, "ID-NB" : true, - "ID-NT" : true, "ID-NU" : true, "ID-PA" : true, "ID-PB" : true, "ID-RI" : true, - "ID-SA" : true, "ID-SB" : true, "ID-SG" : true, "ID-SL" : true, "ID-SM" : true, - "ID-SN" : true, "ID-SR" : true, "ID-SS" : true, "ID-ST" : true, "ID-SU" : true, - "ID-YO" : true, "IE-C" : true, "IE-CE" : true, "IE-CN" : true, "IE-CO" : true, - "IE-CW" : true, "IE-D" : true, "IE-DL" : true, "IE-G" : true, "IE-KE" : true, - "IE-KK" : true, "IE-KY" : true, "IE-L" : true, "IE-LD" : true, "IE-LH" : true, - "IE-LK" : true, "IE-LM" : true, "IE-LS" : true, "IE-M" : true, "IE-MH" : true, - "IE-MN" : true, "IE-MO" : true, "IE-OY" : true, "IE-RN" : true, "IE-SO" : true, - "IE-TA" : true, "IE-U" : true, "IE-WD" : true, "IE-WH" : true, "IE-WW" : true, - "IE-WX" : true, "IL-D" : true, "IL-HA" : true, "IL-JM" : true, "IL-M" : true, - "IL-TA" : true, "IL-Z" : true, "IN-AN" : true, "IN-AP" : true, "IN-AR" : true, - "IN-AS" : true, "IN-BR" : true, "IN-CH" : true, "IN-CT" : true, "IN-DD" : true, - "IN-DL" : true, "IN-DN" : true, "IN-GA" : true, "IN-GJ" : true, "IN-HP" : true, - "IN-HR" : true, "IN-JH" : true, "IN-JK" : true, "IN-KA" : true, "IN-KL" : true, - "IN-LD" : true, "IN-MH" : true, "IN-ML" : true, "IN-MN" : true, "IN-MP" : true, - "IN-MZ" : true, "IN-NL" : true, "IN-OR" : true, "IN-PB" : true, "IN-PY" : true, - "IN-RJ" : true, "IN-SK" : true, "IN-TN" : true, "IN-TR" : true, "IN-UP" : true, - "IN-UT" : true, "IN-WB" : true, "IQ-AN" : true, "IQ-AR" : true, "IQ-BA" : true, - "IQ-BB" : true, "IQ-BG" : true, "IQ-DA" : true, "IQ-DI" : true, "IQ-DQ" : true, - "IQ-KA" : true, "IQ-MA" : true, "IQ-MU" : true, "IQ-NA" : true, "IQ-NI" : true, - "IQ-QA" : true, "IQ-SD" : true, "IQ-SW" : true, "IQ-TS" : true, "IQ-WA" : true, - "IR-01" : true, "IR-02" : true, "IR-03" : true, "IR-04" : true, "IR-05" : true, - "IR-06" : true, "IR-07" : true, "IR-08" : true, "IR-10" : true, "IR-11" : true, - "IR-12" : true, "IR-13" : true, "IR-14" : true, "IR-15" : true, "IR-16" : true, - "IR-17" : true, "IR-18" : true, "IR-19" : true, "IR-20" : true, "IR-21" : true, - "IR-22" : true, "IR-23" : true, "IR-24" : true, "IR-25" : true, "IR-26" : true, - "IR-27" : true, "IR-28" : true, "IR-29" : true, "IR-30" : true, "IR-31" : true, - "IS-0" : true, "IS-1" : true, "IS-2" : true, "IS-3" : true, "IS-4" : true, - "IS-5" : true, "IS-6" : true, "IS-7" : true, "IS-8" : true, "IT-21" : true, - "IT-23" : true, "IT-25" : true, "IT-32" : true, "IT-34" : true, "IT-36" : true, - "IT-42" : true, "IT-45" : true, "IT-52" : true, "IT-55" : true, "IT-57" : true, - "IT-62" : true, "IT-65" : true, "IT-67" : true, "IT-72" : true, "IT-75" : true, - "IT-77" : true, "IT-78" : true, "IT-82" : true, "IT-88" : true, "IT-AG" : true, - "IT-AL" : true, "IT-AN" : true, "IT-AO" : true, "IT-AP" : true, "IT-AQ" : true, - "IT-AR" : true, "IT-AT" : true, "IT-AV" : true, "IT-BA" : true, "IT-BG" : true, - "IT-BI" : true, "IT-BL" : true, "IT-BN" : true, "IT-BO" : true, "IT-BR" : true, - "IT-BS" : true, "IT-BT" : true, "IT-BZ" : true, "IT-CA" : true, "IT-CB" : true, - "IT-CE" : true, "IT-CH" : true, "IT-CI" : true, "IT-CL" : true, "IT-CN" : true, - "IT-CO" : true, "IT-CR" : true, "IT-CS" : true, "IT-CT" : true, "IT-CZ" : true, - "IT-EN" : true, "IT-FC" : true, "IT-FE" : true, "IT-FG" : true, "IT-FI" : true, - "IT-FM" : true, "IT-FR" : true, "IT-GE" : true, "IT-GO" : true, "IT-GR" : true, - "IT-IM" : true, "IT-IS" : true, "IT-KR" : true, "IT-LC" : true, "IT-LE" : true, - "IT-LI" : true, "IT-LO" : true, "IT-LT" : true, "IT-LU" : true, "IT-MB" : true, - "IT-MC" : true, "IT-ME" : true, "IT-MI" : true, "IT-MN" : true, "IT-MO" : true, - "IT-MS" : true, "IT-MT" : true, "IT-NA" : true, "IT-NO" : true, "IT-NU" : true, - "IT-OG" : true, "IT-OR" : true, "IT-OT" : true, "IT-PA" : true, "IT-PC" : true, - "IT-PD" : true, "IT-PE" : true, "IT-PG" : true, "IT-PI" : true, "IT-PN" : true, - "IT-PO" : true, "IT-PR" : true, "IT-PT" : true, "IT-PU" : true, "IT-PV" : true, - "IT-PZ" : true, "IT-RA" : true, "IT-RC" : true, "IT-RE" : true, "IT-RG" : true, - "IT-RI" : true, "IT-RM" : true, "IT-RN" : true, "IT-RO" : true, "IT-SA" : true, - "IT-SI" : true, "IT-SO" : true, "IT-SP" : true, "IT-SR" : true, "IT-SS" : true, - "IT-SV" : true, "IT-TA" : true, "IT-TE" : true, "IT-TN" : true, "IT-TO" : true, - "IT-TP" : true, "IT-TR" : true, "IT-TS" : true, "IT-TV" : true, "IT-UD" : true, - "IT-VA" : true, "IT-VB" : true, "IT-VC" : true, "IT-VE" : true, "IT-VI" : true, - "IT-VR" : true, "IT-VS" : true, "IT-VT" : true, "IT-VV" : true, "JM-01" : true, - "JM-02" : true, "JM-03" : true, "JM-04" : true, "JM-05" : true, "JM-06" : true, - "JM-07" : true, "JM-08" : true, "JM-09" : true, "JM-10" : true, "JM-11" : true, - "JM-12" : true, "JM-13" : true, "JM-14" : true, "JO-AJ" : true, "JO-AM" : true, - "JO-AQ" : true, "JO-AT" : true, "JO-AZ" : true, "JO-BA" : true, "JO-IR" : true, - "JO-JA" : true, "JO-KA" : true, "JO-MA" : true, "JO-MD" : true, "JO-MN" : true, - "JP-01" : true, "JP-02" : true, "JP-03" : true, "JP-04" : true, "JP-05" : true, - "JP-06" : true, "JP-07" : true, "JP-08" : true, "JP-09" : true, "JP-10" : true, - "JP-11" : true, "JP-12" : true, "JP-13" : true, "JP-14" : true, "JP-15" : true, - "JP-16" : true, "JP-17" : true, "JP-18" : true, "JP-19" : true, "JP-20" : true, - "JP-21" : true, "JP-22" : true, "JP-23" : true, "JP-24" : true, "JP-25" : true, - "JP-26" : true, "JP-27" : true, "JP-28" : true, "JP-29" : true, "JP-30" : true, - "JP-31" : true, "JP-32" : true, "JP-33" : true, "JP-34" : true, "JP-35" : true, - "JP-36" : true, "JP-37" : true, "JP-38" : true, "JP-39" : true, "JP-40" : true, - "JP-41" : true, "JP-42" : true, "JP-43" : true, "JP-44" : true, "JP-45" : true, - "JP-46" : true, "JP-47" : true, "KE-110" : true, "KE-200" : true, "KE-300" : true, - "KE-400" : true, "KE-500" : true, "KE-700" : true, "KE-800" : true, "KG-B" : true, - "KG-C" : true, "KG-GB" : true, "KG-J" : true, "KG-N" : true, "KG-O" : true, - "KG-T" : true, "KG-Y" : true, "KH-1" : true, "KH-10" : true, "KH-11" : true, - "KH-12" : true, "KH-13" : true, "KH-14" : true, "KH-15" : true, "KH-16" : true, - "KH-17" : true, "KH-18" : true, "KH-19" : true, "KH-2" : true, "KH-20" : true, - "KH-21" : true, "KH-22" : true, "KH-23" : true, "KH-24" : true, "KH-3" : true, - "KH-4" : true, "KH-5" : true, "KH-6" : true, "KH-7" : true, "KH-8" : true, - "KH-9" : true, "KI-G" : true, "KI-L" : true, "KI-P" : true, "KM-A" : true, - "KM-G" : true, "KM-M" : true, "KN-01" : true, "KN-02" : true, "KN-03" : true, - "KN-04" : true, "KN-05" : true, "KN-06" : true, "KN-07" : true, "KN-08" : true, - "KN-09" : true, "KN-10" : true, "KN-11" : true, "KN-12" : true, "KN-13" : true, - "KN-15" : true, "KN-K" : true, "KN-N" : true, "KP-01" : true, "KP-02" : true, - "KP-03" : true, "KP-04" : true, "KP-05" : true, "KP-06" : true, "KP-07" : true, - "KP-08" : true, "KP-09" : true, "KP-10" : true, "KP-13" : true, "KR-11" : true, - "KR-26" : true, "KR-27" : true, "KR-28" : true, "KR-29" : true, "KR-30" : true, - "KR-31" : true, "KR-41" : true, "KR-42" : true, "KR-43" : true, "KR-44" : true, - "KR-45" : true, "KR-46" : true, "KR-47" : true, "KR-48" : true, "KR-49" : true, - "KW-AH" : true, "KW-FA" : true, "KW-HA" : true, "KW-JA" : true, "KW-KU" : true, - "KW-MU" : true, "KZ-AKM" : true, "KZ-AKT" : true, "KZ-ALA" : true, "KZ-ALM" : true, - "KZ-AST" : true, "KZ-ATY" : true, "KZ-KAR" : true, "KZ-KUS" : true, "KZ-KZY" : true, - "KZ-MAN" : true, "KZ-PAV" : true, "KZ-SEV" : true, "KZ-VOS" : true, "KZ-YUZ" : true, - "KZ-ZAP" : true, "KZ-ZHA" : true, "LA-AT" : true, "LA-BK" : true, "LA-BL" : true, - "LA-CH" : true, "LA-HO" : true, "LA-KH" : true, "LA-LM" : true, "LA-LP" : true, - "LA-OU" : true, "LA-PH" : true, "LA-SL" : true, "LA-SV" : true, "LA-VI" : true, - "LA-VT" : true, "LA-XA" : true, "LA-XE" : true, "LA-XI" : true, "LA-XS" : true, - "LB-AK" : true, "LB-AS" : true, "LB-BA" : true, "LB-BH" : true, "LB-BI" : true, - "LB-JA" : true, "LB-JL" : true, "LB-NA" : true, "LI-01" : true, "LI-02" : true, - "LI-03" : true, "LI-04" : true, "LI-05" : true, "LI-06" : true, "LI-07" : true, - "LI-08" : true, "LI-09" : true, "LI-10" : true, "LI-11" : true, "LK-1" : true, - "LK-11" : true, "LK-12" : true, "LK-13" : true, "LK-2" : true, "LK-21" : true, - "LK-22" : true, "LK-23" : true, "LK-3" : true, "LK-31" : true, "LK-32" : true, - "LK-33" : true, "LK-4" : true, "LK-41" : true, "LK-42" : true, "LK-43" : true, - "LK-44" : true, "LK-45" : true, "LK-5" : true, "LK-51" : true, "LK-52" : true, - "LK-53" : true, "LK-6" : true, "LK-61" : true, "LK-62" : true, "LK-7" : true, - "LK-71" : true, "LK-72" : true, "LK-8" : true, "LK-81" : true, "LK-82" : true, - "LK-9" : true, "LK-91" : true, "LK-92" : true, "LR-BG" : true, "LR-BM" : true, - "LR-CM" : true, "LR-GB" : true, "LR-GG" : true, "LR-GK" : true, "LR-LO" : true, - "LR-MG" : true, "LR-MO" : true, "LR-MY" : true, "LR-NI" : true, "LR-RI" : true, - "LR-SI" : true, "LS-A" : true, "LS-B" : true, "LS-C" : true, "LS-D" : true, - "LS-E" : true, "LS-F" : true, "LS-G" : true, "LS-H" : true, "LS-J" : true, - "LS-K" : true, "LT-AL" : true, "LT-KL" : true, "LT-KU" : true, "LT-MR" : true, - "LT-PN" : true, "LT-SA" : true, "LT-TA" : true, "LT-TE" : true, "LT-UT" : true, - "LT-VL" : true, "LU-D" : true, "LU-G" : true, "LU-L" : true, "LV-001" : true, - "LV-002" : true, "LV-003" : true, "LV-004" : true, "LV-005" : true, "LV-006" : true, - "LV-007" : true, "LV-008" : true, "LV-009" : true, "LV-010" : true, "LV-011" : true, - "LV-012" : true, "LV-013" : true, "LV-014" : true, "LV-015" : true, "LV-016" : true, - "LV-017" : true, "LV-018" : true, "LV-019" : true, "LV-020" : true, "LV-021" : true, - "LV-022" : true, "LV-023" : true, "LV-024" : true, "LV-025" : true, "LV-026" : true, - "LV-027" : true, "LV-028" : true, "LV-029" : true, "LV-030" : true, "LV-031" : true, - "LV-032" : true, "LV-033" : true, "LV-034" : true, "LV-035" : true, "LV-036" : true, - "LV-037" : true, "LV-038" : true, "LV-039" : true, "LV-040" : true, "LV-041" : true, - "LV-042" : true, "LV-043" : true, "LV-044" : true, "LV-045" : true, "LV-046" : true, - "LV-047" : true, "LV-048" : true, "LV-049" : true, "LV-050" : true, "LV-051" : true, - "LV-052" : true, "LV-053" : true, "LV-054" : true, "LV-055" : true, "LV-056" : true, - "LV-057" : true, "LV-058" : true, "LV-059" : true, "LV-060" : true, "LV-061" : true, - "LV-062" : true, "LV-063" : true, "LV-064" : true, "LV-065" : true, "LV-066" : true, - "LV-067" : true, "LV-068" : true, "LV-069" : true, "LV-070" : true, "LV-071" : true, - "LV-072" : true, "LV-073" : true, "LV-074" : true, "LV-075" : true, "LV-076" : true, - "LV-077" : true, "LV-078" : true, "LV-079" : true, "LV-080" : true, "LV-081" : true, - "LV-082" : true, "LV-083" : true, "LV-084" : true, "LV-085" : true, "LV-086" : true, - "LV-087" : true, "LV-088" : true, "LV-089" : true, "LV-090" : true, "LV-091" : true, - "LV-092" : true, "LV-093" : true, "LV-094" : true, "LV-095" : true, "LV-096" : true, - "LV-097" : true, "LV-098" : true, "LV-099" : true, "LV-100" : true, "LV-101" : true, - "LV-102" : true, "LV-103" : true, "LV-104" : true, "LV-105" : true, "LV-106" : true, - "LV-107" : true, "LV-108" : true, "LV-109" : true, "LV-110" : true, "LV-DGV" : true, - "LV-JEL" : true, "LV-JKB" : true, "LV-JUR" : true, "LV-LPX" : true, "LV-REZ" : true, - "LV-RIX" : true, "LV-VEN" : true, "LV-VMR" : true, "LY-BA" : true, "LY-BU" : true, - "LY-DR" : true, "LY-GT" : true, "LY-JA" : true, "LY-JB" : true, "LY-JG" : true, - "LY-JI" : true, "LY-JU" : true, "LY-KF" : true, "LY-MB" : true, "LY-MI" : true, - "LY-MJ" : true, "LY-MQ" : true, "LY-NL" : true, "LY-NQ" : true, "LY-SB" : true, - "LY-SR" : true, "LY-TB" : true, "LY-WA" : true, "LY-WD" : true, "LY-WS" : true, - "LY-ZA" : true, "MA-01" : true, "MA-02" : true, "MA-03" : true, "MA-04" : true, - "MA-05" : true, "MA-06" : true, "MA-07" : true, "MA-08" : true, "MA-09" : true, - "MA-10" : true, "MA-11" : true, "MA-12" : true, "MA-13" : true, "MA-14" : true, - "MA-15" : true, "MA-16" : true, "MA-AGD" : true, "MA-AOU" : true, "MA-ASZ" : true, - "MA-AZI" : true, "MA-BEM" : true, "MA-BER" : true, "MA-BES" : true, "MA-BOD" : true, - "MA-BOM" : true, "MA-CAS" : true, "MA-CHE" : true, "MA-CHI" : true, "MA-CHT" : true, - "MA-ERR" : true, "MA-ESI" : true, "MA-ESM" : true, "MA-FAH" : true, "MA-FES" : true, - "MA-FIG" : true, "MA-GUE" : true, "MA-HAJ" : true, "MA-HAO" : true, "MA-HOC" : true, - "MA-IFR" : true, "MA-INE" : true, "MA-JDI" : true, "MA-JRA" : true, "MA-KEN" : true, - "MA-KES" : true, "MA-KHE" : true, "MA-KHN" : true, "MA-KHO" : true, "MA-LAA" : true, - "MA-LAR" : true, "MA-MED" : true, "MA-MEK" : true, "MA-MMD" : true, "MA-MMN" : true, - "MA-MOH" : true, "MA-MOU" : true, "MA-NAD" : true, "MA-NOU" : true, "MA-OUA" : true, - "MA-OUD" : true, "MA-OUJ" : true, "MA-RAB" : true, "MA-SAF" : true, "MA-SAL" : true, - "MA-SEF" : true, "MA-SET" : true, "MA-SIK" : true, "MA-SKH" : true, "MA-SYB" : true, - "MA-TAI" : true, "MA-TAO" : true, "MA-TAR" : true, "MA-TAT" : true, "MA-TAZ" : true, - "MA-TET" : true, "MA-TIZ" : true, "MA-TNG" : true, "MA-TNT" : true, "MA-ZAG" : true, - "MC-CL" : true, "MC-CO" : true, "MC-FO" : true, "MC-GA" : true, "MC-JE" : true, - "MC-LA" : true, "MC-MA" : true, "MC-MC" : true, "MC-MG" : true, "MC-MO" : true, - "MC-MU" : true, "MC-PH" : true, "MC-SD" : true, "MC-SO" : true, "MC-SP" : true, - "MC-SR" : true, "MC-VR" : true, "MD-AN" : true, "MD-BA" : true, "MD-BD" : true, - "MD-BR" : true, "MD-BS" : true, "MD-CA" : true, "MD-CL" : true, "MD-CM" : true, - "MD-CR" : true, "MD-CS" : true, "MD-CT" : true, "MD-CU" : true, "MD-DO" : true, - "MD-DR" : true, "MD-DU" : true, "MD-ED" : true, "MD-FA" : true, "MD-FL" : true, - "MD-GA" : true, "MD-GL" : true, "MD-HI" : true, "MD-IA" : true, "MD-LE" : true, - "MD-NI" : true, "MD-OC" : true, "MD-OR" : true, "MD-RE" : true, "MD-RI" : true, - "MD-SD" : true, "MD-SI" : true, "MD-SN" : true, "MD-SO" : true, "MD-ST" : true, - "MD-SV" : true, "MD-TA" : true, "MD-TE" : true, "MD-UN" : true, "ME-01" : true, - "ME-02" : true, "ME-03" : true, "ME-04" : true, "ME-05" : true, "ME-06" : true, - "ME-07" : true, "ME-08" : true, "ME-09" : true, "ME-10" : true, "ME-11" : true, - "ME-12" : true, "ME-13" : true, "ME-14" : true, "ME-15" : true, "ME-16" : true, - "ME-17" : true, "ME-18" : true, "ME-19" : true, "ME-20" : true, "ME-21" : true, - "MG-A" : true, "MG-D" : true, "MG-F" : true, "MG-M" : true, "MG-T" : true, - "MG-U" : true, "MH-ALK" : true, "MH-ALL" : true, "MH-ARN" : true, "MH-AUR" : true, - "MH-EBO" : true, "MH-ENI" : true, "MH-JAB" : true, "MH-JAL" : true, "MH-KIL" : true, - "MH-KWA" : true, "MH-L" : true, "MH-LAE" : true, "MH-LIB" : true, "MH-LIK" : true, - "MH-MAJ" : true, "MH-MAL" : true, "MH-MEJ" : true, "MH-MIL" : true, "MH-NMK" : true, - "MH-NMU" : true, "MH-RON" : true, "MH-T" : true, "MH-UJA" : true, "MH-UTI" : true, - "MH-WTJ" : true, "MH-WTN" : true, "MK-01" : true, "MK-02" : true, "MK-03" : true, - "MK-04" : true, "MK-05" : true, "MK-06" : true, "MK-07" : true, "MK-08" : true, - "MK-09" : true, "MK-10" : true, "MK-11" : true, "MK-12" : true, "MK-13" : true, - "MK-14" : true, "MK-15" : true, "MK-16" : true, "MK-17" : true, "MK-18" : true, - "MK-19" : true, "MK-20" : true, "MK-21" : true, "MK-22" : true, "MK-23" : true, - "MK-24" : true, "MK-25" : true, "MK-26" : true, "MK-27" : true, "MK-28" : true, - "MK-29" : true, "MK-30" : true, "MK-31" : true, "MK-32" : true, "MK-33" : true, - "MK-34" : true, "MK-35" : true, "MK-36" : true, "MK-37" : true, "MK-38" : true, - "MK-39" : true, "MK-40" : true, "MK-41" : true, "MK-42" : true, "MK-43" : true, - "MK-44" : true, "MK-45" : true, "MK-46" : true, "MK-47" : true, "MK-48" : true, - "MK-49" : true, "MK-50" : true, "MK-51" : true, "MK-52" : true, "MK-53" : true, - "MK-54" : true, "MK-55" : true, "MK-56" : true, "MK-57" : true, "MK-58" : true, - "MK-59" : true, "MK-60" : true, "MK-61" : true, "MK-62" : true, "MK-63" : true, - "MK-64" : true, "MK-65" : true, "MK-66" : true, "MK-67" : true, "MK-68" : true, - "MK-69" : true, "MK-70" : true, "MK-71" : true, "MK-72" : true, "MK-73" : true, - "MK-74" : true, "MK-75" : true, "MK-76" : true, "MK-77" : true, "MK-78" : true, - "MK-79" : true, "MK-80" : true, "MK-81" : true, "MK-82" : true, "MK-83" : true, - "MK-84" : true, "ML-1" : true, "ML-2" : true, "ML-3" : true, "ML-4" : true, - "ML-5" : true, "ML-6" : true, "ML-7" : true, "ML-8" : true, "ML-BK0" : true, - "MM-01" : true, "MM-02" : true, "MM-03" : true, "MM-04" : true, "MM-05" : true, - "MM-06" : true, "MM-07" : true, "MM-11" : true, "MM-12" : true, "MM-13" : true, - "MM-14" : true, "MM-15" : true, "MM-16" : true, "MM-17" : true, "MN-035" : true, - "MN-037" : true, "MN-039" : true, "MN-041" : true, "MN-043" : true, "MN-046" : true, - "MN-047" : true, "MN-049" : true, "MN-051" : true, "MN-053" : true, "MN-055" : true, - "MN-057" : true, "MN-059" : true, "MN-061" : true, "MN-063" : true, "MN-064" : true, - "MN-065" : true, "MN-067" : true, "MN-069" : true, "MN-071" : true, "MN-073" : true, - "MN-1" : true, "MR-01" : true, "MR-02" : true, "MR-03" : true, "MR-04" : true, - "MR-05" : true, "MR-06" : true, "MR-07" : true, "MR-08" : true, "MR-09" : true, - "MR-10" : true, "MR-11" : true, "MR-12" : true, "MR-NKC" : true, "MT-01" : true, - "MT-02" : true, "MT-03" : true, "MT-04" : true, "MT-05" : true, "MT-06" : true, - "MT-07" : true, "MT-08" : true, "MT-09" : true, "MT-10" : true, "MT-11" : true, - "MT-12" : true, "MT-13" : true, "MT-14" : true, "MT-15" : true, "MT-16" : true, - "MT-17" : true, "MT-18" : true, "MT-19" : true, "MT-20" : true, "MT-21" : true, - "MT-22" : true, "MT-23" : true, "MT-24" : true, "MT-25" : true, "MT-26" : true, - "MT-27" : true, "MT-28" : true, "MT-29" : true, "MT-30" : true, "MT-31" : true, - "MT-32" : true, "MT-33" : true, "MT-34" : true, "MT-35" : true, "MT-36" : true, - "MT-37" : true, "MT-38" : true, "MT-39" : true, "MT-40" : true, "MT-41" : true, - "MT-42" : true, "MT-43" : true, "MT-44" : true, "MT-45" : true, "MT-46" : true, - "MT-47" : true, "MT-48" : true, "MT-49" : true, "MT-50" : true, "MT-51" : true, - "MT-52" : true, "MT-53" : true, "MT-54" : true, "MT-55" : true, "MT-56" : true, - "MT-57" : true, "MT-58" : true, "MT-59" : true, "MT-60" : true, "MT-61" : true, - "MT-62" : true, "MT-63" : true, "MT-64" : true, "MT-65" : true, "MT-66" : true, - "MT-67" : true, "MT-68" : true, "MU-AG" : true, "MU-BL" : true, "MU-BR" : true, - "MU-CC" : true, "MU-CU" : true, "MU-FL" : true, "MU-GP" : true, "MU-MO" : true, - "MU-PA" : true, "MU-PL" : true, "MU-PU" : true, "MU-PW" : true, "MU-QB" : true, - "MU-RO" : true, "MU-RP" : true, "MU-SA" : true, "MU-VP" : true, "MV-00" : true, - "MV-01" : true, "MV-02" : true, "MV-03" : true, "MV-04" : true, "MV-05" : true, - "MV-07" : true, "MV-08" : true, "MV-12" : true, "MV-13" : true, "MV-14" : true, - "MV-17" : true, "MV-20" : true, "MV-23" : true, "MV-24" : true, "MV-25" : true, - "MV-26" : true, "MV-27" : true, "MV-28" : true, "MV-29" : true, "MV-CE" : true, - "MV-MLE" : true, "MV-NC" : true, "MV-NO" : true, "MV-SC" : true, "MV-SU" : true, - "MV-UN" : true, "MV-US" : true, "MW-BA" : true, "MW-BL" : true, "MW-C" : true, - "MW-CK" : true, "MW-CR" : true, "MW-CT" : true, "MW-DE" : true, "MW-DO" : true, - "MW-KR" : true, "MW-KS" : true, "MW-LI" : true, "MW-LK" : true, "MW-MC" : true, - "MW-MG" : true, "MW-MH" : true, "MW-MU" : true, "MW-MW" : true, "MW-MZ" : true, - "MW-N" : true, "MW-NB" : true, "MW-NE" : true, "MW-NI" : true, "MW-NK" : true, - "MW-NS" : true, "MW-NU" : true, "MW-PH" : true, "MW-RU" : true, "MW-S" : true, - "MW-SA" : true, "MW-TH" : true, "MW-ZO" : true, "MX-AGU" : true, "MX-BCN" : true, - "MX-BCS" : true, "MX-CAM" : true, "MX-CHH" : true, "MX-CHP" : true, "MX-COA" : true, - "MX-COL" : true, "MX-DIF" : true, "MX-DUR" : true, "MX-GRO" : true, "MX-GUA" : true, - "MX-HID" : true, "MX-JAL" : true, "MX-MEX" : true, "MX-MIC" : true, "MX-MOR" : true, - "MX-NAY" : true, "MX-NLE" : true, "MX-OAX" : true, "MX-PUE" : true, "MX-QUE" : true, - "MX-ROO" : true, "MX-SIN" : true, "MX-SLP" : true, "MX-SON" : true, "MX-TAB" : true, - "MX-TAM" : true, "MX-TLA" : true, "MX-VER" : true, "MX-YUC" : true, "MX-ZAC" : true, - "MY-01" : true, "MY-02" : true, "MY-03" : true, "MY-04" : true, "MY-05" : true, - "MY-06" : true, "MY-07" : true, "MY-08" : true, "MY-09" : true, "MY-10" : true, - "MY-11" : true, "MY-12" : true, "MY-13" : true, "MY-14" : true, "MY-15" : true, - "MY-16" : true, "MZ-A" : true, "MZ-B" : true, "MZ-G" : true, "MZ-I" : true, - "MZ-L" : true, "MZ-MPM" : true, "MZ-N" : true, "MZ-P" : true, "MZ-Q" : true, - "MZ-S" : true, "MZ-T" : true, "NA-CA" : true, "NA-ER" : true, "NA-HA" : true, - "NA-KA" : true, "NA-KH" : true, "NA-KU" : true, "NA-OD" : true, "NA-OH" : true, - "NA-OK" : true, "NA-ON" : true, "NA-OS" : true, "NA-OT" : true, "NA-OW" : true, - "NE-1" : true, "NE-2" : true, "NE-3" : true, "NE-4" : true, "NE-5" : true, - "NE-6" : true, "NE-7" : true, "NE-8" : true, "NG-AB" : true, "NG-AD" : true, - "NG-AK" : true, "NG-AN" : true, "NG-BA" : true, "NG-BE" : true, "NG-BO" : true, - "NG-BY" : true, "NG-CR" : true, "NG-DE" : true, "NG-EB" : true, "NG-ED" : true, - "NG-EK" : true, "NG-EN" : true, "NG-FC" : true, "NG-GO" : true, "NG-IM" : true, - "NG-JI" : true, "NG-KD" : true, "NG-KE" : true, "NG-KN" : true, "NG-KO" : true, - "NG-KT" : true, "NG-KW" : true, "NG-LA" : true, "NG-NA" : true, "NG-NI" : true, - "NG-OG" : true, "NG-ON" : true, "NG-OS" : true, "NG-OY" : true, "NG-PL" : true, - "NG-RI" : true, "NG-SO" : true, "NG-TA" : true, "NG-YO" : true, "NG-ZA" : true, - "NI-AN" : true, "NI-AS" : true, "NI-BO" : true, "NI-CA" : true, "NI-CI" : true, - "NI-CO" : true, "NI-ES" : true, "NI-GR" : true, "NI-JI" : true, "NI-LE" : true, - "NI-MD" : true, "NI-MN" : true, "NI-MS" : true, "NI-MT" : true, "NI-NS" : true, - "NI-RI" : true, "NI-SJ" : true, "NL-AW" : true, "NL-BQ1" : true, "NL-BQ2" : true, - "NL-BQ3" : true, "NL-CW" : true, "NL-DR" : true, "NL-FL" : true, "NL-FR" : true, - "NL-GE" : true, "NL-GR" : true, "NL-LI" : true, "NL-NB" : true, "NL-NH" : true, - "NL-OV" : true, "NL-SX" : true, "NL-UT" : true, "NL-ZE" : true, "NL-ZH" : true, - "NO-01" : true, "NO-02" : true, "NO-03" : true, "NO-04" : true, "NO-05" : true, - "NO-06" : true, "NO-07" : true, "NO-08" : true, "NO-09" : true, "NO-10" : true, - "NO-11" : true, "NO-12" : true, "NO-14" : true, "NO-15" : true, "NO-16" : true, - "NO-17" : true, "NO-18" : true, "NO-19" : true, "NO-20" : true, "NO-21" : true, - "NO-22" : true, "NP-1" : true, "NP-2" : true, "NP-3" : true, "NP-4" : true, - "NP-5" : true, "NP-BA" : true, "NP-BH" : true, "NP-DH" : true, "NP-GA" : true, - "NP-JA" : true, "NP-KA" : true, "NP-KO" : true, "NP-LU" : true, "NP-MA" : true, - "NP-ME" : true, "NP-NA" : true, "NP-RA" : true, "NP-SA" : true, "NP-SE" : true, - "NR-01" : true, "NR-02" : true, "NR-03" : true, "NR-04" : true, "NR-05" : true, - "NR-06" : true, "NR-07" : true, "NR-08" : true, "NR-09" : true, "NR-10" : true, - "NR-11" : true, "NR-12" : true, "NR-13" : true, "NR-14" : true, "NZ-AUK" : true, - "NZ-BOP" : true, "NZ-CAN" : true, "NZ-CIT" : true, "NZ-GIS" : true, "NZ-HKB" : true, - "NZ-MBH" : true, "NZ-MWT" : true, "NZ-N" : true, "NZ-NSN" : true, "NZ-NTL" : true, - "NZ-OTA" : true, "NZ-S" : true, "NZ-STL" : true, "NZ-TAS" : true, "NZ-TKI" : true, - "NZ-WGN" : true, "NZ-WKO" : true, "NZ-WTC" : true, "OM-BA" : true, "OM-BU" : true, - "OM-DA" : true, "OM-MA" : true, "OM-MU" : true, "OM-SH" : true, "OM-WU" : true, - "OM-ZA" : true, "OM-ZU" : true, "PA-1" : true, "PA-2" : true, "PA-3" : true, - "PA-4" : true, "PA-5" : true, "PA-6" : true, "PA-7" : true, "PA-8" : true, - "PA-9" : true, "PA-EM" : true, "PA-KY" : true, "PA-NB" : true, "PE-AMA" : true, - "PE-ANC" : true, "PE-APU" : true, "PE-ARE" : true, "PE-AYA" : true, "PE-CAJ" : true, - "PE-CAL" : true, "PE-CUS" : true, "PE-HUC" : true, "PE-HUV" : true, "PE-ICA" : true, - "PE-JUN" : true, "PE-LAL" : true, "PE-LAM" : true, "PE-LIM" : true, "PE-LMA" : true, - "PE-LOR" : true, "PE-MDD" : true, "PE-MOQ" : true, "PE-PAS" : true, "PE-PIU" : true, - "PE-PUN" : true, "PE-SAM" : true, "PE-TAC" : true, "PE-TUM" : true, "PE-UCA" : true, - "PG-CPK" : true, "PG-CPM" : true, "PG-EBR" : true, "PG-EHG" : true, "PG-EPW" : true, - "PG-ESW" : true, "PG-GPK" : true, "PG-MBA" : true, "PG-MPL" : true, "PG-MPM" : true, - "PG-MRL" : true, "PG-NCD" : true, "PG-NIK" : true, "PG-NPP" : true, "PG-NSB" : true, - "PG-SAN" : true, "PG-SHM" : true, "PG-WBK" : true, "PG-WHM" : true, "PG-WPD" : true, - "PH-00" : true, "PH-01" : true, "PH-02" : true, "PH-03" : true, "PH-05" : true, - "PH-06" : true, "PH-07" : true, "PH-08" : true, "PH-09" : true, "PH-10" : true, - "PH-11" : true, "PH-12" : true, "PH-13" : true, "PH-14" : true, "PH-15" : true, - "PH-40" : true, "PH-41" : true, "PH-ABR" : true, "PH-AGN" : true, "PH-AGS" : true, - "PH-AKL" : true, "PH-ALB" : true, "PH-ANT" : true, "PH-APA" : true, "PH-AUR" : true, - "PH-BAN" : true, "PH-BAS" : true, "PH-BEN" : true, "PH-BIL" : true, "PH-BOH" : true, - "PH-BTG" : true, "PH-BTN" : true, "PH-BUK" : true, "PH-BUL" : true, "PH-CAG" : true, - "PH-CAM" : true, "PH-CAN" : true, "PH-CAP" : true, "PH-CAS" : true, "PH-CAT" : true, - "PH-CAV" : true, "PH-CEB" : true, "PH-COM" : true, "PH-DAO" : true, "PH-DAS" : true, - "PH-DAV" : true, "PH-DIN" : true, "PH-EAS" : true, "PH-GUI" : true, "PH-IFU" : true, - "PH-ILI" : true, "PH-ILN" : true, "PH-ILS" : true, "PH-ISA" : true, "PH-KAL" : true, - "PH-LAG" : true, "PH-LAN" : true, "PH-LAS" : true, "PH-LEY" : true, "PH-LUN" : true, - "PH-MAD" : true, "PH-MAG" : true, "PH-MAS" : true, "PH-MDC" : true, "PH-MDR" : true, - "PH-MOU" : true, "PH-MSC" : true, "PH-MSR" : true, "PH-NCO" : true, "PH-NEC" : true, - "PH-NER" : true, "PH-NSA" : true, "PH-NUE" : true, "PH-NUV" : true, "PH-PAM" : true, - "PH-PAN" : true, "PH-PLW" : true, "PH-QUE" : true, "PH-QUI" : true, "PH-RIZ" : true, - "PH-ROM" : true, "PH-SAR" : true, "PH-SCO" : true, "PH-SIG" : true, "PH-SLE" : true, - "PH-SLU" : true, "PH-SOR" : true, "PH-SUK" : true, "PH-SUN" : true, "PH-SUR" : true, - "PH-TAR" : true, "PH-TAW" : true, "PH-WSA" : true, "PH-ZAN" : true, "PH-ZAS" : true, - "PH-ZMB" : true, "PH-ZSI" : true, "PK-BA" : true, "PK-GB" : true, "PK-IS" : true, - "PK-JK" : true, "PK-KP" : true, "PK-PB" : true, "PK-SD" : true, "PK-TA" : true, - "PL-DS" : true, "PL-KP" : true, "PL-LB" : true, "PL-LD" : true, "PL-LU" : true, - "PL-MA" : true, "PL-MZ" : true, "PL-OP" : true, "PL-PD" : true, "PL-PK" : true, - "PL-PM" : true, "PL-SK" : true, "PL-SL" : true, "PL-WN" : true, "PL-WP" : true, - "PL-ZP" : true, "PS-BTH" : true, "PS-DEB" : true, "PS-GZA" : true, "PS-HBN" : true, - "PS-JEM" : true, "PS-JEN" : true, "PS-JRH" : true, "PS-KYS" : true, "PS-NBS" : true, - "PS-NGZ" : true, "PS-QQA" : true, "PS-RBH" : true, "PS-RFH" : true, "PS-SLT" : true, - "PS-TBS" : true, "PS-TKM" : true, "PT-01" : true, "PT-02" : true, "PT-03" : true, - "PT-04" : true, "PT-05" : true, "PT-06" : true, "PT-07" : true, "PT-08" : true, - "PT-09" : true, "PT-10" : true, "PT-11" : true, "PT-12" : true, "PT-13" : true, - "PT-14" : true, "PT-15" : true, "PT-16" : true, "PT-17" : true, "PT-18" : true, - "PT-20" : true, "PT-30" : true, "PW-002" : true, "PW-004" : true, "PW-010" : true, - "PW-050" : true, "PW-100" : true, "PW-150" : true, "PW-212" : true, "PW-214" : true, - "PW-218" : true, "PW-222" : true, "PW-224" : true, "PW-226" : true, "PW-227" : true, - "PW-228" : true, "PW-350" : true, "PW-370" : true, "PY-1" : true, "PY-10" : true, - "PY-11" : true, "PY-12" : true, "PY-13" : true, "PY-14" : true, "PY-15" : true, - "PY-16" : true, "PY-19" : true, "PY-2" : true, "PY-3" : true, "PY-4" : true, - "PY-5" : true, "PY-6" : true, "PY-7" : true, "PY-8" : true, "PY-9" : true, - "PY-ASU" : true, "QA-DA" : true, "QA-KH" : true, "QA-MS" : true, "QA-RA" : true, - "QA-US" : true, "QA-WA" : true, "QA-ZA" : true, "RO-AB" : true, "RO-AG" : true, - "RO-AR" : true, "RO-B" : true, "RO-BC" : true, "RO-BH" : true, "RO-BN" : true, - "RO-BR" : true, "RO-BT" : true, "RO-BV" : true, "RO-BZ" : true, "RO-CJ" : true, - "RO-CL" : true, "RO-CS" : true, "RO-CT" : true, "RO-CV" : true, "RO-DB" : true, - "RO-DJ" : true, "RO-GJ" : true, "RO-GL" : true, "RO-GR" : true, "RO-HD" : true, - "RO-HR" : true, "RO-IF" : true, "RO-IL" : true, "RO-IS" : true, "RO-MH" : true, - "RO-MM" : true, "RO-MS" : true, "RO-NT" : true, "RO-OT" : true, "RO-PH" : true, - "RO-SB" : true, "RO-SJ" : true, "RO-SM" : true, "RO-SV" : true, "RO-TL" : true, - "RO-TM" : true, "RO-TR" : true, "RO-VL" : true, "RO-VN" : true, "RO-VS" : true, - "RS-00" : true, "RS-01" : true, "RS-02" : true, "RS-03" : true, "RS-04" : true, - "RS-05" : true, "RS-06" : true, "RS-07" : true, "RS-08" : true, "RS-09" : true, - "RS-10" : true, "RS-11" : true, "RS-12" : true, "RS-13" : true, "RS-14" : true, - "RS-15" : true, "RS-16" : true, "RS-17" : true, "RS-18" : true, "RS-19" : true, - "RS-20" : true, "RS-21" : true, "RS-22" : true, "RS-23" : true, "RS-24" : true, - "RS-25" : true, "RS-26" : true, "RS-27" : true, "RS-28" : true, "RS-29" : true, - "RS-KM" : true, "RS-VO" : true, "RU-AD" : true, "RU-AL" : true, "RU-ALT" : true, - "RU-AMU" : true, "RU-ARK" : true, "RU-AST" : true, "RU-BA" : true, "RU-BEL" : true, - "RU-BRY" : true, "RU-BU" : true, "RU-CE" : true, "RU-CHE" : true, "RU-CHU" : true, - "RU-CU" : true, "RU-DA" : true, "RU-IN" : true, "RU-IRK" : true, "RU-IVA" : true, - "RU-KAM" : true, "RU-KB" : true, "RU-KC" : true, "RU-KDA" : true, "RU-KEM" : true, - "RU-KGD" : true, "RU-KGN" : true, "RU-KHA" : true, "RU-KHM" : true, "RU-KIR" : true, - "RU-KK" : true, "RU-KL" : true, "RU-KLU" : true, "RU-KO" : true, "RU-KOS" : true, - "RU-KR" : true, "RU-KRS" : true, "RU-KYA" : true, "RU-LEN" : true, "RU-LIP" : true, - "RU-MAG" : true, "RU-ME" : true, "RU-MO" : true, "RU-MOS" : true, "RU-MOW" : true, - "RU-MUR" : true, "RU-NEN" : true, "RU-NGR" : true, "RU-NIZ" : true, "RU-NVS" : true, - "RU-OMS" : true, "RU-ORE" : true, "RU-ORL" : true, "RU-PER" : true, "RU-PNZ" : true, - "RU-PRI" : true, "RU-PSK" : true, "RU-ROS" : true, "RU-RYA" : true, "RU-SA" : true, - "RU-SAK" : true, "RU-SAM" : true, "RU-SAR" : true, "RU-SE" : true, "RU-SMO" : true, - "RU-SPE" : true, "RU-STA" : true, "RU-SVE" : true, "RU-TA" : true, "RU-TAM" : true, - "RU-TOM" : true, "RU-TUL" : true, "RU-TVE" : true, "RU-TY" : true, "RU-TYU" : true, - "RU-UD" : true, "RU-ULY" : true, "RU-VGG" : true, "RU-VLA" : true, "RU-VLG" : true, - "RU-VOR" : true, "RU-YAN" : true, "RU-YAR" : true, "RU-YEV" : true, "RU-ZAB" : true, - "RW-01" : true, "RW-02" : true, "RW-03" : true, "RW-04" : true, "RW-05" : true, - "SA-01" : true, "SA-02" : true, "SA-03" : true, "SA-04" : true, "SA-05" : true, - "SA-06" : true, "SA-07" : true, "SA-08" : true, "SA-09" : true, "SA-10" : true, - "SA-11" : true, "SA-12" : true, "SA-14" : true, "SB-CE" : true, "SB-CH" : true, - "SB-CT" : true, "SB-GU" : true, "SB-IS" : true, "SB-MK" : true, "SB-ML" : true, - "SB-RB" : true, "SB-TE" : true, "SB-WE" : true, "SC-01" : true, "SC-02" : true, - "SC-03" : true, "SC-04" : true, "SC-05" : true, "SC-06" : true, "SC-07" : true, - "SC-08" : true, "SC-09" : true, "SC-10" : true, "SC-11" : true, "SC-12" : true, - "SC-13" : true, "SC-14" : true, "SC-15" : true, "SC-16" : true, "SC-17" : true, - "SC-18" : true, "SC-19" : true, "SC-20" : true, "SC-21" : true, "SC-22" : true, - "SC-23" : true, "SC-24" : true, "SC-25" : true, "SD-DC" : true, "SD-DE" : true, - "SD-DN" : true, "SD-DS" : true, "SD-DW" : true, "SD-GD" : true, "SD-GZ" : true, - "SD-KA" : true, "SD-KH" : true, "SD-KN" : true, "SD-KS" : true, "SD-NB" : true, - "SD-NO" : true, "SD-NR" : true, "SD-NW" : true, "SD-RS" : true, "SD-SI" : true, - "SE-AB" : true, "SE-AC" : true, "SE-BD" : true, "SE-C" : true, "SE-D" : true, - "SE-E" : true, "SE-F" : true, "SE-G" : true, "SE-H" : true, "SE-I" : true, - "SE-K" : true, "SE-M" : true, "SE-N" : true, "SE-O" : true, "SE-S" : true, - "SE-T" : true, "SE-U" : true, "SE-W" : true, "SE-X" : true, "SE-Y" : true, - "SE-Z" : true, "SG-01" : true, "SG-02" : true, "SG-03" : true, "SG-04" : true, - "SG-05" : true, "SH-AC" : true, "SH-HL" : true, "SH-TA" : true, "SI-001" : true, - "SI-002" : true, "SI-003" : true, "SI-004" : true, "SI-005" : true, "SI-006" : true, - "SI-007" : true, "SI-008" : true, "SI-009" : true, "SI-010" : true, "SI-011" : true, - "SI-012" : true, "SI-013" : true, "SI-014" : true, "SI-015" : true, "SI-016" : true, - "SI-017" : true, "SI-018" : true, "SI-019" : true, "SI-020" : true, "SI-021" : true, - "SI-022" : true, "SI-023" : true, "SI-024" : true, "SI-025" : true, "SI-026" : true, - "SI-027" : true, "SI-028" : true, "SI-029" : true, "SI-030" : true, "SI-031" : true, - "SI-032" : true, "SI-033" : true, "SI-034" : true, "SI-035" : true, "SI-036" : true, - "SI-037" : true, "SI-038" : true, "SI-039" : true, "SI-040" : true, "SI-041" : true, - "SI-042" : true, "SI-043" : true, "SI-044" : true, "SI-045" : true, "SI-046" : true, - "SI-047" : true, "SI-048" : true, "SI-049" : true, "SI-050" : true, "SI-051" : true, - "SI-052" : true, "SI-053" : true, "SI-054" : true, "SI-055" : true, "SI-056" : true, - "SI-057" : true, "SI-058" : true, "SI-059" : true, "SI-060" : true, "SI-061" : true, - "SI-062" : true, "SI-063" : true, "SI-064" : true, "SI-065" : true, "SI-066" : true, - "SI-067" : true, "SI-068" : true, "SI-069" : true, "SI-070" : true, "SI-071" : true, - "SI-072" : true, "SI-073" : true, "SI-074" : true, "SI-075" : true, "SI-076" : true, - "SI-077" : true, "SI-078" : true, "SI-079" : true, "SI-080" : true, "SI-081" : true, - "SI-082" : true, "SI-083" : true, "SI-084" : true, "SI-085" : true, "SI-086" : true, - "SI-087" : true, "SI-088" : true, "SI-089" : true, "SI-090" : true, "SI-091" : true, - "SI-092" : true, "SI-093" : true, "SI-094" : true, "SI-095" : true, "SI-096" : true, - "SI-097" : true, "SI-098" : true, "SI-099" : true, "SI-100" : true, "SI-101" : true, - "SI-102" : true, "SI-103" : true, "SI-104" : true, "SI-105" : true, "SI-106" : true, - "SI-107" : true, "SI-108" : true, "SI-109" : true, "SI-110" : true, "SI-111" : true, - "SI-112" : true, "SI-113" : true, "SI-114" : true, "SI-115" : true, "SI-116" : true, - "SI-117" : true, "SI-118" : true, "SI-119" : true, "SI-120" : true, "SI-121" : true, - "SI-122" : true, "SI-123" : true, "SI-124" : true, "SI-125" : true, "SI-126" : true, - "SI-127" : true, "SI-128" : true, "SI-129" : true, "SI-130" : true, "SI-131" : true, - "SI-132" : true, "SI-133" : true, "SI-134" : true, "SI-135" : true, "SI-136" : true, - "SI-137" : true, "SI-138" : true, "SI-139" : true, "SI-140" : true, "SI-141" : true, - "SI-142" : true, "SI-143" : true, "SI-144" : true, "SI-146" : true, "SI-147" : true, - "SI-148" : true, "SI-149" : true, "SI-150" : true, "SI-151" : true, "SI-152" : true, - "SI-153" : true, "SI-154" : true, "SI-155" : true, "SI-156" : true, "SI-157" : true, - "SI-158" : true, "SI-159" : true, "SI-160" : true, "SI-161" : true, "SI-162" : true, - "SI-163" : true, "SI-164" : true, "SI-165" : true, "SI-166" : true, "SI-167" : true, - "SI-168" : true, "SI-169" : true, "SI-170" : true, "SI-171" : true, "SI-172" : true, - "SI-173" : true, "SI-174" : true, "SI-175" : true, "SI-176" : true, "SI-177" : true, - "SI-178" : true, "SI-179" : true, "SI-180" : true, "SI-181" : true, "SI-182" : true, - "SI-183" : true, "SI-184" : true, "SI-185" : true, "SI-186" : true, "SI-187" : true, - "SI-188" : true, "SI-189" : true, "SI-190" : true, "SI-191" : true, "SI-192" : true, - "SI-193" : true, "SI-194" : true, "SI-195" : true, "SI-196" : true, "SI-197" : true, - "SI-198" : true, "SI-199" : true, "SI-200" : true, "SI-201" : true, "SI-202" : true, - "SI-203" : true, "SI-204" : true, "SI-205" : true, "SI-206" : true, "SI-207" : true, - "SI-208" : true, "SI-209" : true, "SI-210" : true, "SI-211" : true, "SK-BC" : true, - "SK-BL" : true, "SK-KI" : true, "SK-NI" : true, "SK-PV" : true, "SK-TA" : true, - "SK-TC" : true, "SK-ZI" : true, "SL-E" : true, "SL-N" : true, "SL-S" : true, - "SL-W" : true, "SM-01" : true, "SM-02" : true, "SM-03" : true, "SM-04" : true, - "SM-05" : true, "SM-06" : true, "SM-07" : true, "SM-08" : true, "SM-09" : true, - "SN-DB" : true, "SN-DK" : true, "SN-FK" : true, "SN-KA" : true, "SN-KD" : true, - "SN-KE" : true, "SN-KL" : true, "SN-LG" : true, "SN-MT" : true, "SN-SE" : true, - "SN-SL" : true, "SN-TC" : true, "SN-TH" : true, "SN-ZG" : true, "SO-AW" : true, - "SO-BK" : true, "SO-BN" : true, "SO-BR" : true, "SO-BY" : true, "SO-GA" : true, - "SO-GE" : true, "SO-HI" : true, "SO-JD" : true, "SO-JH" : true, "SO-MU" : true, - "SO-NU" : true, "SO-SA" : true, "SO-SD" : true, "SO-SH" : true, "SO-SO" : true, - "SO-TO" : true, "SO-WO" : true, "SR-BR" : true, "SR-CM" : true, "SR-CR" : true, - "SR-MA" : true, "SR-NI" : true, "SR-PM" : true, "SR-PR" : true, "SR-SA" : true, - "SR-SI" : true, "SR-WA" : true, "SS-BN" : true, "SS-BW" : true, "SS-EC" : true, - "SS-EE8" : true, "SS-EW" : true, "SS-JG" : true, "SS-LK" : true, "SS-NU" : true, - "SS-UY" : true, "SS-WR" : true, "ST-P" : true, "ST-S" : true, "SV-AH" : true, - "SV-CA" : true, "SV-CH" : true, "SV-CU" : true, "SV-LI" : true, "SV-MO" : true, - "SV-PA" : true, "SV-SA" : true, "SV-SM" : true, "SV-SO" : true, "SV-SS" : true, - "SV-SV" : true, "SV-UN" : true, "SV-US" : true, "SY-DI" : true, "SY-DR" : true, - "SY-DY" : true, "SY-HA" : true, "SY-HI" : true, "SY-HL" : true, "SY-HM" : true, - "SY-ID" : true, "SY-LA" : true, "SY-QU" : true, "SY-RA" : true, "SY-RD" : true, - "SY-SU" : true, "SY-TA" : true, "SZ-HH" : true, "SZ-LU" : true, "SZ-MA" : true, - "SZ-SH" : true, "TD-BA" : true, "TD-BG" : true, "TD-BO" : true, "TD-CB" : true, - "TD-EN" : true, "TD-GR" : true, "TD-HL" : true, "TD-KA" : true, "TD-LC" : true, - "TD-LO" : true, "TD-LR" : true, "TD-MA" : true, "TD-MC" : true, "TD-ME" : true, - "TD-MO" : true, "TD-ND" : true, "TD-OD" : true, "TD-SA" : true, "TD-SI" : true, - "TD-TA" : true, "TD-TI" : true, "TD-WF" : true, "TG-C" : true, "TG-K" : true, - "TG-M" : true, "TG-P" : true, "TG-S" : true, "TH-10" : true, "TH-11" : true, - "TH-12" : true, "TH-13" : true, "TH-14" : true, "TH-15" : true, "TH-16" : true, - "TH-17" : true, "TH-18" : true, "TH-19" : true, "TH-20" : true, "TH-21" : true, - "TH-22" : true, "TH-23" : true, "TH-24" : true, "TH-25" : true, "TH-26" : true, - "TH-27" : true, "TH-30" : true, "TH-31" : true, "TH-32" : true, "TH-33" : true, - "TH-34" : true, "TH-35" : true, "TH-36" : true, "TH-37" : true, "TH-39" : true, - "TH-40" : true, "TH-41" : true, "TH-42" : true, "TH-43" : true, "TH-44" : true, - "TH-45" : true, "TH-46" : true, "TH-47" : true, "TH-48" : true, "TH-49" : true, - "TH-50" : true, "TH-51" : true, "TH-52" : true, "TH-53" : true, "TH-54" : true, - "TH-55" : true, "TH-56" : true, "TH-57" : true, "TH-58" : true, "TH-60" : true, - "TH-61" : true, "TH-62" : true, "TH-63" : true, "TH-64" : true, "TH-65" : true, - "TH-66" : true, "TH-67" : true, "TH-70" : true, "TH-71" : true, "TH-72" : true, - "TH-73" : true, "TH-74" : true, "TH-75" : true, "TH-76" : true, "TH-77" : true, - "TH-80" : true, "TH-81" : true, "TH-82" : true, "TH-83" : true, "TH-84" : true, - "TH-85" : true, "TH-86" : true, "TH-90" : true, "TH-91" : true, "TH-92" : true, - "TH-93" : true, "TH-94" : true, "TH-95" : true, "TH-96" : true, "TH-S" : true, - "TJ-GB" : true, "TJ-KT" : true, "TJ-SU" : true, "TL-AL" : true, "TL-AN" : true, - "TL-BA" : true, "TL-BO" : true, "TL-CO" : true, "TL-DI" : true, "TL-ER" : true, - "TL-LA" : true, "TL-LI" : true, "TL-MF" : true, "TL-MT" : true, "TL-OE" : true, - "TL-VI" : true, "TM-A" : true, "TM-B" : true, "TM-D" : true, "TM-L" : true, - "TM-M" : true, "TM-S" : true, "TN-11" : true, "TN-12" : true, "TN-13" : true, - "TN-14" : true, "TN-21" : true, "TN-22" : true, "TN-23" : true, "TN-31" : true, - "TN-32" : true, "TN-33" : true, "TN-34" : true, "TN-41" : true, "TN-42" : true, - "TN-43" : true, "TN-51" : true, "TN-52" : true, "TN-53" : true, "TN-61" : true, - "TN-71" : true, "TN-72" : true, "TN-73" : true, "TN-81" : true, "TN-82" : true, - "TN-83" : true, "TO-01" : true, "TO-02" : true, "TO-03" : true, "TO-04" : true, - "TO-05" : true, "TR-01" : true, "TR-02" : true, "TR-03" : true, "TR-04" : true, - "TR-05" : true, "TR-06" : true, "TR-07" : true, "TR-08" : true, "TR-09" : true, - "TR-10" : true, "TR-11" : true, "TR-12" : true, "TR-13" : true, "TR-14" : true, - "TR-15" : true, "TR-16" : true, "TR-17" : true, "TR-18" : true, "TR-19" : true, - "TR-20" : true, "TR-21" : true, "TR-22" : true, "TR-23" : true, "TR-24" : true, - "TR-25" : true, "TR-26" : true, "TR-27" : true, "TR-28" : true, "TR-29" : true, - "TR-30" : true, "TR-31" : true, "TR-32" : true, "TR-33" : true, "TR-34" : true, - "TR-35" : true, "TR-36" : true, "TR-37" : true, "TR-38" : true, "TR-39" : true, - "TR-40" : true, "TR-41" : true, "TR-42" : true, "TR-43" : true, "TR-44" : true, - "TR-45" : true, "TR-46" : true, "TR-47" : true, "TR-48" : true, "TR-49" : true, - "TR-50" : true, "TR-51" : true, "TR-52" : true, "TR-53" : true, "TR-54" : true, - "TR-55" : true, "TR-56" : true, "TR-57" : true, "TR-58" : true, "TR-59" : true, - "TR-60" : true, "TR-61" : true, "TR-62" : true, "TR-63" : true, "TR-64" : true, - "TR-65" : true, "TR-66" : true, "TR-67" : true, "TR-68" : true, "TR-69" : true, - "TR-70" : true, "TR-71" : true, "TR-72" : true, "TR-73" : true, "TR-74" : true, - "TR-75" : true, "TR-76" : true, "TR-77" : true, "TR-78" : true, "TR-79" : true, - "TR-80" : true, "TR-81" : true, "TT-ARI" : true, "TT-CHA" : true, "TT-CTT" : true, - "TT-DMN" : true, "TT-ETO" : true, "TT-PED" : true, "TT-POS" : true, "TT-PRT" : true, - "TT-PTF" : true, "TT-RCM" : true, "TT-SFO" : true, "TT-SGE" : true, "TT-SIP" : true, - "TT-SJL" : true, "TT-TUP" : true, "TT-WTO" : true, "TV-FUN" : true, "TV-NIT" : true, - "TV-NKF" : true, "TV-NKL" : true, "TV-NMA" : true, "TV-NMG" : true, "TV-NUI" : true, - "TV-VAI" : true, "TW-CHA" : true, "TW-CYI" : true, "TW-CYQ" : true, "TW-HSQ" : true, - "TW-HSZ" : true, "TW-HUA" : true, "TW-ILA" : true, "TW-KEE" : true, "TW-KHH" : true, - "TW-KHQ" : true, "TW-MIA" : true, "TW-NAN" : true, "TW-PEN" : true, "TW-PIF" : true, - "TW-TAO" : true, "TW-TNN" : true, "TW-TNQ" : true, "TW-TPE" : true, "TW-TPQ" : true, - "TW-TTT" : true, "TW-TXG" : true, "TW-TXQ" : true, "TW-YUN" : true, "TZ-01" : true, - "TZ-02" : true, "TZ-03" : true, "TZ-04" : true, "TZ-05" : true, "TZ-06" : true, - "TZ-07" : true, "TZ-08" : true, "TZ-09" : true, "TZ-10" : true, "TZ-11" : true, - "TZ-12" : true, "TZ-13" : true, "TZ-14" : true, "TZ-15" : true, "TZ-16" : true, - "TZ-17" : true, "TZ-18" : true, "TZ-19" : true, "TZ-20" : true, "TZ-21" : true, - "TZ-22" : true, "TZ-23" : true, "TZ-24" : true, "TZ-25" : true, "TZ-26" : true, - "UA-05" : true, "UA-07" : true, "UA-09" : true, "UA-12" : true, "UA-14" : true, - "UA-18" : true, "UA-21" : true, "UA-23" : true, "UA-26" : true, "UA-30" : true, - "UA-32" : true, "UA-35" : true, "UA-40" : true, "UA-43" : true, "UA-46" : true, - "UA-48" : true, "UA-51" : true, "UA-53" : true, "UA-56" : true, "UA-59" : true, - "UA-61" : true, "UA-63" : true, "UA-65" : true, "UA-68" : true, "UA-71" : true, - "UA-74" : true, "UA-77" : true, "UG-101" : true, "UG-102" : true, "UG-103" : true, - "UG-104" : true, "UG-105" : true, "UG-106" : true, "UG-107" : true, "UG-108" : true, - "UG-109" : true, "UG-110" : true, "UG-111" : true, "UG-112" : true, "UG-113" : true, - "UG-114" : true, "UG-115" : true, "UG-116" : true, "UG-201" : true, "UG-202" : true, - "UG-203" : true, "UG-204" : true, "UG-205" : true, "UG-206" : true, "UG-207" : true, - "UG-208" : true, "UG-209" : true, "UG-210" : true, "UG-211" : true, "UG-212" : true, - "UG-213" : true, "UG-214" : true, "UG-215" : true, "UG-216" : true, "UG-217" : true, - "UG-218" : true, "UG-219" : true, "UG-220" : true, "UG-221" : true, "UG-222" : true, - "UG-223" : true, "UG-224" : true, "UG-301" : true, "UG-302" : true, "UG-303" : true, - "UG-304" : true, "UG-305" : true, "UG-306" : true, "UG-307" : true, "UG-308" : true, - "UG-309" : true, "UG-310" : true, "UG-311" : true, "UG-312" : true, "UG-313" : true, - "UG-314" : true, "UG-315" : true, "UG-316" : true, "UG-317" : true, "UG-318" : true, - "UG-319" : true, "UG-320" : true, "UG-321" : true, "UG-401" : true, "UG-402" : true, - "UG-403" : true, "UG-404" : true, "UG-405" : true, "UG-406" : true, "UG-407" : true, - "UG-408" : true, "UG-409" : true, "UG-410" : true, "UG-411" : true, "UG-412" : true, - "UG-413" : true, "UG-414" : true, "UG-415" : true, "UG-416" : true, "UG-417" : true, - "UG-418" : true, "UG-419" : true, "UG-C" : true, "UG-E" : true, "UG-N" : true, - "UG-W" : true, "UM-67" : true, "UM-71" : true, "UM-76" : true, "UM-79" : true, - "UM-81" : true, "UM-84" : true, "UM-86" : true, "UM-89" : true, "UM-95" : true, - "US-AK" : true, "US-AL" : true, "US-AR" : true, "US-AS" : true, "US-AZ" : true, - "US-CA" : true, "US-CO" : true, "US-CT" : true, "US-DC" : true, "US-DE" : true, - "US-FL" : true, "US-GA" : true, "US-GU" : true, "US-HI" : true, "US-IA" : true, - "US-ID" : true, "US-IL" : true, "US-IN" : true, "US-KS" : true, "US-KY" : true, - "US-LA" : true, "US-MA" : true, "US-MD" : true, "US-ME" : true, "US-MI" : true, - "US-MN" : true, "US-MO" : true, "US-MP" : true, "US-MS" : true, "US-MT" : true, - "US-NC" : true, "US-ND" : true, "US-NE" : true, "US-NH" : true, "US-NJ" : true, - "US-NM" : true, "US-NV" : true, "US-NY" : true, "US-OH" : true, "US-OK" : true, - "US-OR" : true, "US-PA" : true, "US-PR" : true, "US-RI" : true, "US-SC" : true, - "US-SD" : true, "US-TN" : true, "US-TX" : true, "US-UM" : true, "US-UT" : true, - "US-VA" : true, "US-VI" : true, "US-VT" : true, "US-WA" : true, "US-WI" : true, - "US-WV" : true, "US-WY" : true, "UY-AR" : true, "UY-CA" : true, "UY-CL" : true, - "UY-CO" : true, "UY-DU" : true, "UY-FD" : true, "UY-FS" : true, "UY-LA" : true, - "UY-MA" : true, "UY-MO" : true, "UY-PA" : true, "UY-RN" : true, "UY-RO" : true, - "UY-RV" : true, "UY-SA" : true, "UY-SJ" : true, "UY-SO" : true, "UY-TA" : true, - "UY-TT" : true, "UZ-AN" : true, "UZ-BU" : true, "UZ-FA" : true, "UZ-JI" : true, - "UZ-NG" : true, "UZ-NW" : true, "UZ-QA" : true, "UZ-QR" : true, "UZ-SA" : true, - "UZ-SI" : true, "UZ-SU" : true, "UZ-TK" : true, "UZ-TO" : true, "UZ-XO" : true, - "VC-01" : true, "VC-02" : true, "VC-03" : true, "VC-04" : true, "VC-05" : true, - "VC-06" : true, "VE-A" : true, "VE-B" : true, "VE-C" : true, "VE-D" : true, - "VE-E" : true, "VE-F" : true, "VE-G" : true, "VE-H" : true, "VE-I" : true, - "VE-J" : true, "VE-K" : true, "VE-L" : true, "VE-M" : true, "VE-N" : true, - "VE-O" : true, "VE-P" : true, "VE-R" : true, "VE-S" : true, "VE-T" : true, - "VE-U" : true, "VE-V" : true, "VE-W" : true, "VE-X" : true, "VE-Y" : true, - "VE-Z" : true, "VN-01" : true, "VN-02" : true, "VN-03" : true, "VN-04" : true, - "VN-05" : true, "VN-06" : true, "VN-07" : true, "VN-09" : true, "VN-13" : true, - "VN-14" : true, "VN-15" : true, "VN-18" : true, "VN-20" : true, "VN-21" : true, - "VN-22" : true, "VN-23" : true, "VN-24" : true, "VN-25" : true, "VN-26" : true, - "VN-27" : true, "VN-28" : true, "VN-29" : true, "VN-30" : true, "VN-31" : true, - "VN-32" : true, "VN-33" : true, "VN-34" : true, "VN-35" : true, "VN-36" : true, - "VN-37" : true, "VN-39" : true, "VN-40" : true, "VN-41" : true, "VN-43" : true, - "VN-44" : true, "VN-45" : true, "VN-46" : true, "VN-47" : true, "VN-49" : true, - "VN-50" : true, "VN-51" : true, "VN-52" : true, "VN-53" : true, "VN-54" : true, - "VN-55" : true, "VN-56" : true, "VN-57" : true, "VN-58" : true, "VN-59" : true, - "VN-61" : true, "VN-63" : true, "VN-66" : true, "VN-67" : true, "VN-68" : true, - "VN-69" : true, "VN-70" : true, "VN-71" : true, "VN-72" : true, "VN-73" : true, - "VN-CT" : true, "VN-DN" : true, "VN-HN" : true, "VN-HP" : true, "VN-SG" : true, - "VU-MAP" : true, "VU-PAM" : true, "VU-SAM" : true, "VU-SEE" : true, "VU-TAE" : true, - "VU-TOB" : true, "WS-AA" : true, "WS-AL" : true, "WS-AT" : true, "WS-FA" : true, - "WS-GE" : true, "WS-GI" : true, "WS-PA" : true, "WS-SA" : true, "WS-TU" : true, - "WS-VF" : true, "WS-VS" : true, "YE-AB" : true, "YE-AD" : true, "YE-AM" : true, - "YE-BA" : true, "YE-DA" : true, "YE-DH" : true, "YE-HD" : true, "YE-HJ" : true, - "YE-IB" : true, "YE-JA" : true, "YE-LA" : true, "YE-MA" : true, "YE-MR" : true, - "YE-MU" : true, "YE-MW" : true, "YE-RA" : true, "YE-SD" : true, "YE-SH" : true, - "YE-SN" : true, "YE-TA" : true, "ZA-EC" : true, "ZA-FS" : true, "ZA-GP" : true, - "ZA-LP" : true, "ZA-MP" : true, "ZA-NC" : true, "ZA-NW" : true, "ZA-WC" : true, - "ZA-ZN" : true, "ZM-01" : true, "ZM-02" : true, "ZM-03" : true, "ZM-04" : true, - "ZM-05" : true, "ZM-06" : true, "ZM-07" : true, "ZM-08" : true, "ZM-09" : true, - "ZW-BU" : true, "ZW-HA" : true, "ZW-MA" : true, "ZW-MC" : true, "ZW-ME" : true, - "ZW-MI" : true, "ZW-MN" : true, "ZW-MS" : true, "ZW-MV" : true, "ZW-MW" : true, +var iso3166_2 = map[string]struct{}{ + "AD-02": {}, "AD-03": {}, "AD-04": {}, "AD-05": {}, "AD-06": {}, + "AD-07": {}, "AD-08": {}, "AE-AJ": {}, "AE-AZ": {}, "AE-DU": {}, + "AE-FU": {}, "AE-RK": {}, "AE-SH": {}, "AE-UQ": {}, "AF-BAL": {}, + "AF-BAM": {}, "AF-BDG": {}, "AF-BDS": {}, "AF-BGL": {}, "AF-DAY": {}, + "AF-FRA": {}, "AF-FYB": {}, "AF-GHA": {}, "AF-GHO": {}, "AF-HEL": {}, + "AF-HER": {}, "AF-JOW": {}, "AF-KAB": {}, "AF-KAN": {}, "AF-KAP": {}, + "AF-KDZ": {}, "AF-KHO": {}, "AF-KNR": {}, "AF-LAG": {}, "AF-LOG": {}, + "AF-NAN": {}, "AF-NIM": {}, "AF-NUR": {}, "AF-PAN": {}, "AF-PAR": {}, + "AF-PIA": {}, "AF-PKA": {}, "AF-SAM": {}, "AF-SAR": {}, "AF-TAK": {}, + "AF-URU": {}, "AF-WAR": {}, "AF-ZAB": {}, "AG-03": {}, "AG-04": {}, + "AG-05": {}, "AG-06": {}, "AG-07": {}, "AG-08": {}, "AG-10": {}, + "AG-11": {}, "AL-01": {}, "AL-02": {}, "AL-03": {}, "AL-04": {}, + "AL-05": {}, "AL-06": {}, "AL-07": {}, "AL-08": {}, "AL-09": {}, + "AL-10": {}, "AL-11": {}, "AL-12": {}, "AL-BR": {}, "AL-BU": {}, + "AL-DI": {}, "AL-DL": {}, "AL-DR": {}, "AL-DV": {}, "AL-EL": {}, + "AL-ER": {}, "AL-FR": {}, "AL-GJ": {}, "AL-GR": {}, "AL-HA": {}, + "AL-KA": {}, "AL-KB": {}, "AL-KC": {}, "AL-KO": {}, "AL-KR": {}, + "AL-KU": {}, "AL-LB": {}, "AL-LE": {}, "AL-LU": {}, "AL-MK": {}, + "AL-MM": {}, "AL-MR": {}, "AL-MT": {}, "AL-PG": {}, "AL-PQ": {}, + "AL-PR": {}, "AL-PU": {}, "AL-SH": {}, "AL-SK": {}, "AL-SR": {}, + "AL-TE": {}, "AL-TP": {}, "AL-TR": {}, "AL-VL": {}, "AM-AG": {}, + "AM-AR": {}, "AM-AV": {}, "AM-ER": {}, "AM-GR": {}, "AM-KT": {}, + "AM-LO": {}, "AM-SH": {}, "AM-SU": {}, "AM-TV": {}, "AM-VD": {}, + "AO-BGO": {}, "AO-BGU": {}, "AO-BIE": {}, "AO-CAB": {}, "AO-CCU": {}, + "AO-CNN": {}, "AO-CNO": {}, "AO-CUS": {}, "AO-HUA": {}, "AO-HUI": {}, + "AO-LNO": {}, "AO-LSU": {}, "AO-LUA": {}, "AO-MAL": {}, "AO-MOX": {}, + "AO-NAM": {}, "AO-UIG": {}, "AO-ZAI": {}, "AR-A": {}, "AR-B": {}, + "AR-C": {}, "AR-D": {}, "AR-E": {}, "AR-F": {}, "AR-G": {}, "AR-H": {}, + "AR-J": {}, "AR-K": {}, "AR-L": {}, "AR-M": {}, "AR-N": {}, + "AR-P": {}, "AR-Q": {}, "AR-R": {}, "AR-S": {}, "AR-T": {}, + "AR-U": {}, "AR-V": {}, "AR-W": {}, "AR-X": {}, "AR-Y": {}, + "AR-Z": {}, "AT-1": {}, "AT-2": {}, "AT-3": {}, "AT-4": {}, + "AT-5": {}, "AT-6": {}, "AT-7": {}, "AT-8": {}, "AT-9": {}, + "AU-ACT": {}, "AU-NSW": {}, "AU-NT": {}, "AU-QLD": {}, "AU-SA": {}, + "AU-TAS": {}, "AU-VIC": {}, "AU-WA": {}, "AZ-ABS": {}, "AZ-AGA": {}, + "AZ-AGC": {}, "AZ-AGM": {}, "AZ-AGS": {}, "AZ-AGU": {}, "AZ-AST": {}, + "AZ-BA": {}, "AZ-BAB": {}, "AZ-BAL": {}, "AZ-BAR": {}, "AZ-BEY": {}, + "AZ-BIL": {}, "AZ-CAB": {}, "AZ-CAL": {}, "AZ-CUL": {}, "AZ-DAS": {}, + "AZ-FUZ": {}, "AZ-GA": {}, "AZ-GAD": {}, "AZ-GOR": {}, "AZ-GOY": {}, + "AZ-GYG": {}, "AZ-HAC": {}, "AZ-IMI": {}, "AZ-ISM": {}, "AZ-KAL": {}, + "AZ-KAN": {}, "AZ-KUR": {}, "AZ-LA": {}, "AZ-LAC": {}, "AZ-LAN": {}, + "AZ-LER": {}, "AZ-MAS": {}, "AZ-MI": {}, "AZ-NA": {}, "AZ-NEF": {}, + "AZ-NV": {}, "AZ-NX": {}, "AZ-OGU": {}, "AZ-ORD": {}, "AZ-QAB": {}, + "AZ-QAX": {}, "AZ-QAZ": {}, "AZ-QBA": {}, "AZ-QBI": {}, "AZ-QOB": {}, + "AZ-QUS": {}, "AZ-SA": {}, "AZ-SAB": {}, "AZ-SAD": {}, "AZ-SAH": {}, + "AZ-SAK": {}, "AZ-SAL": {}, "AZ-SAR": {}, "AZ-SAT": {}, "AZ-SBN": {}, + "AZ-SIY": {}, "AZ-SKR": {}, "AZ-SM": {}, "AZ-SMI": {}, "AZ-SMX": {}, + "AZ-SR": {}, "AZ-SUS": {}, "AZ-TAR": {}, "AZ-TOV": {}, "AZ-UCA": {}, + "AZ-XA": {}, "AZ-XAC": {}, "AZ-XCI": {}, "AZ-XIZ": {}, "AZ-XVD": {}, + "AZ-YAR": {}, "AZ-YE": {}, "AZ-YEV": {}, "AZ-ZAN": {}, "AZ-ZAQ": {}, + "AZ-ZAR": {}, "BA-01": {}, "BA-02": {}, "BA-03": {}, "BA-04": {}, + "BA-05": {}, "BA-06": {}, "BA-07": {}, "BA-08": {}, "BA-09": {}, + "BA-10": {}, "BA-BIH": {}, "BA-BRC": {}, "BA-SRP": {}, "BB-01": {}, + "BB-02": {}, "BB-03": {}, "BB-04": {}, "BB-05": {}, "BB-06": {}, + "BB-07": {}, "BB-08": {}, "BB-09": {}, "BB-10": {}, "BB-11": {}, + "BD-01": {}, "BD-02": {}, "BD-03": {}, "BD-04": {}, "BD-05": {}, + "BD-06": {}, "BD-07": {}, "BD-08": {}, "BD-09": {}, "BD-10": {}, + "BD-11": {}, "BD-12": {}, "BD-13": {}, "BD-14": {}, "BD-15": {}, + "BD-16": {}, "BD-17": {}, "BD-18": {}, "BD-19": {}, "BD-20": {}, + "BD-21": {}, "BD-22": {}, "BD-23": {}, "BD-24": {}, "BD-25": {}, + "BD-26": {}, "BD-27": {}, "BD-28": {}, "BD-29": {}, "BD-30": {}, + "BD-31": {}, "BD-32": {}, "BD-33": {}, "BD-34": {}, "BD-35": {}, + "BD-36": {}, "BD-37": {}, "BD-38": {}, "BD-39": {}, "BD-40": {}, + "BD-41": {}, "BD-42": {}, "BD-43": {}, "BD-44": {}, "BD-45": {}, + "BD-46": {}, "BD-47": {}, "BD-48": {}, "BD-49": {}, "BD-50": {}, + "BD-51": {}, "BD-52": {}, "BD-53": {}, "BD-54": {}, "BD-55": {}, + "BD-56": {}, "BD-57": {}, "BD-58": {}, "BD-59": {}, "BD-60": {}, + "BD-61": {}, "BD-62": {}, "BD-63": {}, "BD-64": {}, "BD-A": {}, + "BD-B": {}, "BD-C": {}, "BD-D": {}, "BD-E": {}, "BD-F": {}, + "BD-G": {}, "BE-BRU": {}, "BE-VAN": {}, "BE-VBR": {}, "BE-VLG": {}, + "BE-VLI": {}, "BE-VOV": {}, "BE-VWV": {}, "BE-WAL": {}, "BE-WBR": {}, + "BE-WHT": {}, "BE-WLG": {}, "BE-WLX": {}, "BE-WNA": {}, "BF-01": {}, + "BF-02": {}, "BF-03": {}, "BF-04": {}, "BF-05": {}, "BF-06": {}, + "BF-07": {}, "BF-08": {}, "BF-09": {}, "BF-10": {}, "BF-11": {}, + "BF-12": {}, "BF-13": {}, "BF-BAL": {}, "BF-BAM": {}, "BF-BAN": {}, + "BF-BAZ": {}, "BF-BGR": {}, "BF-BLG": {}, "BF-BLK": {}, "BF-COM": {}, + "BF-GAN": {}, "BF-GNA": {}, "BF-GOU": {}, "BF-HOU": {}, "BF-IOB": {}, + "BF-KAD": {}, "BF-KEN": {}, "BF-KMD": {}, "BF-KMP": {}, "BF-KOP": {}, + "BF-KOS": {}, "BF-KOT": {}, "BF-KOW": {}, "BF-LER": {}, "BF-LOR": {}, + "BF-MOU": {}, "BF-NAM": {}, "BF-NAO": {}, "BF-NAY": {}, "BF-NOU": {}, + "BF-OUB": {}, "BF-OUD": {}, "BF-PAS": {}, "BF-PON": {}, "BF-SEN": {}, + "BF-SIS": {}, "BF-SMT": {}, "BF-SNG": {}, "BF-SOM": {}, "BF-SOR": {}, + "BF-TAP": {}, "BF-TUI": {}, "BF-YAG": {}, "BF-YAT": {}, "BF-ZIR": {}, + "BF-ZON": {}, "BF-ZOU": {}, "BG-01": {}, "BG-02": {}, "BG-03": {}, + "BG-04": {}, "BG-05": {}, "BG-06": {}, "BG-07": {}, "BG-08": {}, + "BG-09": {}, "BG-10": {}, "BG-11": {}, "BG-12": {}, "BG-13": {}, + "BG-14": {}, "BG-15": {}, "BG-16": {}, "BG-17": {}, "BG-18": {}, + "BG-19": {}, "BG-20": {}, "BG-21": {}, "BG-22": {}, "BG-23": {}, + "BG-24": {}, "BG-25": {}, "BG-26": {}, "BG-27": {}, "BG-28": {}, + "BH-13": {}, "BH-14": {}, "BH-15": {}, "BH-16": {}, "BH-17": {}, + "BI-BB": {}, "BI-BL": {}, "BI-BM": {}, "BI-BR": {}, "BI-CA": {}, + "BI-CI": {}, "BI-GI": {}, "BI-KI": {}, "BI-KR": {}, "BI-KY": {}, + "BI-MA": {}, "BI-MU": {}, "BI-MW": {}, "BI-NG": {}, "BI-RM": {}, "BI-RT": {}, + "BI-RY": {}, "BJ-AK": {}, "BJ-AL": {}, "BJ-AQ": {}, "BJ-BO": {}, + "BJ-CO": {}, "BJ-DO": {}, "BJ-KO": {}, "BJ-LI": {}, "BJ-MO": {}, + "BJ-OU": {}, "BJ-PL": {}, "BJ-ZO": {}, "BN-BE": {}, "BN-BM": {}, + "BN-TE": {}, "BN-TU": {}, "BO-B": {}, "BO-C": {}, "BO-H": {}, + "BO-L": {}, "BO-N": {}, "BO-O": {}, "BO-P": {}, "BO-S": {}, + "BO-T": {}, "BQ-BO": {}, "BQ-SA": {}, "BQ-SE": {}, "BR-AC": {}, + "BR-AL": {}, "BR-AM": {}, "BR-AP": {}, "BR-BA": {}, "BR-CE": {}, + "BR-DF": {}, "BR-ES": {}, "BR-FN": {}, "BR-GO": {}, "BR-MA": {}, + "BR-MG": {}, "BR-MS": {}, "BR-MT": {}, "BR-PA": {}, "BR-PB": {}, + "BR-PE": {}, "BR-PI": {}, "BR-PR": {}, "BR-RJ": {}, "BR-RN": {}, + "BR-RO": {}, "BR-RR": {}, "BR-RS": {}, "BR-SC": {}, "BR-SE": {}, + "BR-SP": {}, "BR-TO": {}, "BS-AK": {}, "BS-BI": {}, "BS-BP": {}, + "BS-BY": {}, "BS-CE": {}, "BS-CI": {}, "BS-CK": {}, "BS-CO": {}, + "BS-CS": {}, "BS-EG": {}, "BS-EX": {}, "BS-FP": {}, "BS-GC": {}, + "BS-HI": {}, "BS-HT": {}, "BS-IN": {}, "BS-LI": {}, "BS-MC": {}, + "BS-MG": {}, "BS-MI": {}, "BS-NE": {}, "BS-NO": {}, "BS-NP": {}, "BS-NS": {}, + "BS-RC": {}, "BS-RI": {}, "BS-SA": {}, "BS-SE": {}, "BS-SO": {}, + "BS-SS": {}, "BS-SW": {}, "BS-WG": {}, "BT-11": {}, "BT-12": {}, + "BT-13": {}, "BT-14": {}, "BT-15": {}, "BT-21": {}, "BT-22": {}, + "BT-23": {}, "BT-24": {}, "BT-31": {}, "BT-32": {}, "BT-33": {}, + "BT-34": {}, "BT-41": {}, "BT-42": {}, "BT-43": {}, "BT-44": {}, + "BT-45": {}, "BT-GA": {}, "BT-TY": {}, "BW-CE": {}, "BW-CH": {}, "BW-GH": {}, + "BW-KG": {}, "BW-KL": {}, "BW-KW": {}, "BW-NE": {}, "BW-NW": {}, + "BW-SE": {}, "BW-SO": {}, "BY-BR": {}, "BY-HM": {}, "BY-HO": {}, + "BY-HR": {}, "BY-MA": {}, "BY-MI": {}, "BY-VI": {}, "BZ-BZ": {}, + "BZ-CY": {}, "BZ-CZL": {}, "BZ-OW": {}, "BZ-SC": {}, "BZ-TOL": {}, + "CA-AB": {}, "CA-BC": {}, "CA-MB": {}, "CA-NB": {}, "CA-NL": {}, + "CA-NS": {}, "CA-NT": {}, "CA-NU": {}, "CA-ON": {}, "CA-PE": {}, + "CA-QC": {}, "CA-SK": {}, "CA-YT": {}, "CD-BC": {}, "CD-BN": {}, + "CD-EQ": {}, "CD-HK": {}, "CD-IT": {}, "CD-KA": {}, "CD-KC": {}, "CD-KE": {}, "CD-KG": {}, "CD-KN": {}, + "CD-KW": {}, "CD-KS": {}, "CD-LU": {}, "CD-MA": {}, "CD-NK": {}, "CD-OR": {}, "CD-SA": {}, "CD-SK": {}, + "CD-TA": {}, "CD-TO": {}, "CF-AC": {}, "CF-BB": {}, "CF-BGF": {}, "CF-BK": {}, "CF-HK": {}, "CF-HM": {}, + "CF-HS": {}, "CF-KB": {}, "CF-KG": {}, "CF-LB": {}, "CF-MB": {}, + "CF-MP": {}, "CF-NM": {}, "CF-OP": {}, "CF-SE": {}, "CF-UK": {}, + "CF-VK": {}, "CG-11": {}, "CG-12": {}, "CG-13": {}, "CG-14": {}, + "CG-15": {}, "CG-16": {}, "CG-2": {}, "CG-5": {}, "CG-7": {}, "CG-8": {}, + "CG-9": {}, "CG-BZV": {}, "CH-AG": {}, "CH-AI": {}, "CH-AR": {}, + "CH-BE": {}, "CH-BL": {}, "CH-BS": {}, "CH-FR": {}, "CH-GE": {}, + "CH-GL": {}, "CH-GR": {}, "CH-JU": {}, "CH-LU": {}, "CH-NE": {}, + "CH-NW": {}, "CH-OW": {}, "CH-SG": {}, "CH-SH": {}, "CH-SO": {}, + "CH-SZ": {}, "CH-TG": {}, "CH-TI": {}, "CH-UR": {}, "CH-VD": {}, + "CH-VS": {}, "CH-ZG": {}, "CH-ZH": {}, "CI-AB": {}, "CI-BS": {}, + "CI-CM": {}, "CI-DN": {}, "CI-GD": {}, "CI-LC": {}, "CI-LG": {}, + "CI-MG": {}, "CI-SM": {}, "CI-SV": {}, "CI-VB": {}, "CI-WR": {}, + "CI-YM": {}, "CI-ZZ": {}, "CL-AI": {}, "CL-AN": {}, "CL-AP": {}, + "CL-AR": {}, "CL-AT": {}, "CL-BI": {}, "CL-CO": {}, "CL-LI": {}, + "CL-LL": {}, "CL-LR": {}, "CL-MA": {}, "CL-ML": {}, "CL-NB": {}, "CL-RM": {}, + "CL-TA": {}, "CL-VS": {}, "CM-AD": {}, "CM-CE": {}, "CM-EN": {}, + "CM-ES": {}, "CM-LT": {}, "CM-NO": {}, "CM-NW": {}, "CM-OU": {}, + "CM-SU": {}, "CM-SW": {}, "CN-AH": {}, "CN-BJ": {}, "CN-CQ": {}, + "CN-FJ": {}, "CN-GS": {}, "CN-GD": {}, "CN-GX": {}, "CN-GZ": {}, + "CN-HI": {}, "CN-HE": {}, "CN-HL": {}, "CN-HA": {}, "CN-HB": {}, + "CN-HN": {}, "CN-JS": {}, "CN-JX": {}, "CN-JL": {}, "CN-LN": {}, + "CN-NM": {}, "CN-NX": {}, "CN-QH": {}, "CN-SN": {}, "CN-SD": {}, "CN-SH": {}, + "CN-SX": {}, "CN-SC": {}, "CN-TJ": {}, "CN-XJ": {}, "CN-XZ": {}, "CN-YN": {}, + "CN-ZJ": {}, "CO-AMA": {}, "CO-ANT": {}, "CO-ARA": {}, "CO-ATL": {}, + "CO-BOL": {}, "CO-BOY": {}, "CO-CAL": {}, "CO-CAQ": {}, "CO-CAS": {}, + "CO-CAU": {}, "CO-CES": {}, "CO-CHO": {}, "CO-COR": {}, "CO-CUN": {}, + "CO-DC": {}, "CO-GUA": {}, "CO-GUV": {}, "CO-HUI": {}, "CO-LAG": {}, + "CO-MAG": {}, "CO-MET": {}, "CO-NAR": {}, "CO-NSA": {}, "CO-PUT": {}, + "CO-QUI": {}, "CO-RIS": {}, "CO-SAN": {}, "CO-SAP": {}, "CO-SUC": {}, + "CO-TOL": {}, "CO-VAC": {}, "CO-VAU": {}, "CO-VID": {}, "CR-A": {}, + "CR-C": {}, "CR-G": {}, "CR-H": {}, "CR-L": {}, "CR-P": {}, + "CR-SJ": {}, "CU-01": {}, "CU-02": {}, "CU-03": {}, "CU-04": {}, + "CU-05": {}, "CU-06": {}, "CU-07": {}, "CU-08": {}, "CU-09": {}, + "CU-10": {}, "CU-11": {}, "CU-12": {}, "CU-13": {}, "CU-14": {}, "CU-15": {}, + "CU-16": {}, "CU-99": {}, "CV-B": {}, "CV-BR": {}, "CV-BV": {}, "CV-CA": {}, + "CV-CF": {}, "CV-CR": {}, "CV-MA": {}, "CV-MO": {}, "CV-PA": {}, + "CV-PN": {}, "CV-PR": {}, "CV-RB": {}, "CV-RG": {}, "CV-RS": {}, + "CV-S": {}, "CV-SD": {}, "CV-SF": {}, "CV-SL": {}, "CV-SM": {}, + "CV-SO": {}, "CV-SS": {}, "CV-SV": {}, "CV-TA": {}, "CV-TS": {}, + "CY-01": {}, "CY-02": {}, "CY-03": {}, "CY-04": {}, "CY-05": {}, + "CY-06": {}, "CZ-10": {}, "CZ-101": {}, "CZ-102": {}, "CZ-103": {}, + "CZ-104": {}, "CZ-105": {}, "CZ-106": {}, "CZ-107": {}, "CZ-108": {}, + "CZ-109": {}, "CZ-110": {}, "CZ-111": {}, "CZ-112": {}, "CZ-113": {}, + "CZ-114": {}, "CZ-115": {}, "CZ-116": {}, "CZ-117": {}, "CZ-118": {}, + "CZ-119": {}, "CZ-120": {}, "CZ-121": {}, "CZ-122": {}, "CZ-20": {}, + "CZ-201": {}, "CZ-202": {}, "CZ-203": {}, "CZ-204": {}, "CZ-205": {}, + "CZ-206": {}, "CZ-207": {}, "CZ-208": {}, "CZ-209": {}, "CZ-20A": {}, + "CZ-20B": {}, "CZ-20C": {}, "CZ-31": {}, "CZ-311": {}, "CZ-312": {}, + "CZ-313": {}, "CZ-314": {}, "CZ-315": {}, "CZ-316": {}, "CZ-317": {}, + "CZ-32": {}, "CZ-321": {}, "CZ-322": {}, "CZ-323": {}, "CZ-324": {}, + "CZ-325": {}, "CZ-326": {}, "CZ-327": {}, "CZ-41": {}, "CZ-411": {}, + "CZ-412": {}, "CZ-413": {}, "CZ-42": {}, "CZ-421": {}, "CZ-422": {}, + "CZ-423": {}, "CZ-424": {}, "CZ-425": {}, "CZ-426": {}, "CZ-427": {}, + "CZ-51": {}, "CZ-511": {}, "CZ-512": {}, "CZ-513": {}, "CZ-514": {}, + "CZ-52": {}, "CZ-521": {}, "CZ-522": {}, "CZ-523": {}, "CZ-524": {}, + "CZ-525": {}, "CZ-53": {}, "CZ-531": {}, "CZ-532": {}, "CZ-533": {}, + "CZ-534": {}, "CZ-63": {}, "CZ-631": {}, "CZ-632": {}, "CZ-633": {}, + "CZ-634": {}, "CZ-635": {}, "CZ-64": {}, "CZ-641": {}, "CZ-642": {}, + "CZ-643": {}, "CZ-644": {}, "CZ-645": {}, "CZ-646": {}, "CZ-647": {}, + "CZ-71": {}, "CZ-711": {}, "CZ-712": {}, "CZ-713": {}, "CZ-714": {}, + "CZ-715": {}, "CZ-72": {}, "CZ-721": {}, "CZ-722": {}, "CZ-723": {}, + "CZ-724": {}, "CZ-80": {}, "CZ-801": {}, "CZ-802": {}, "CZ-803": {}, + "CZ-804": {}, "CZ-805": {}, "CZ-806": {}, "DE-BB": {}, "DE-BE": {}, + "DE-BW": {}, "DE-BY": {}, "DE-HB": {}, "DE-HE": {}, "DE-HH": {}, + "DE-MV": {}, "DE-NI": {}, "DE-NW": {}, "DE-RP": {}, "DE-SH": {}, + "DE-SL": {}, "DE-SN": {}, "DE-ST": {}, "DE-TH": {}, "DJ-AR": {}, + "DJ-AS": {}, "DJ-DI": {}, "DJ-DJ": {}, "DJ-OB": {}, "DJ-TA": {}, + "DK-81": {}, "DK-82": {}, "DK-83": {}, "DK-84": {}, "DK-85": {}, + "DM-01": {}, "DM-02": {}, "DM-03": {}, "DM-04": {}, "DM-05": {}, + "DM-06": {}, "DM-07": {}, "DM-08": {}, "DM-09": {}, "DM-10": {}, + "DO-01": {}, "DO-02": {}, "DO-03": {}, "DO-04": {}, "DO-05": {}, + "DO-06": {}, "DO-07": {}, "DO-08": {}, "DO-09": {}, "DO-10": {}, + "DO-11": {}, "DO-12": {}, "DO-13": {}, "DO-14": {}, "DO-15": {}, + "DO-16": {}, "DO-17": {}, "DO-18": {}, "DO-19": {}, "DO-20": {}, + "DO-21": {}, "DO-22": {}, "DO-23": {}, "DO-24": {}, "DO-25": {}, + "DO-26": {}, "DO-27": {}, "DO-28": {}, "DO-29": {}, "DO-30": {}, "DO-31": {}, + "DZ-01": {}, "DZ-02": {}, "DZ-03": {}, "DZ-04": {}, "DZ-05": {}, + "DZ-06": {}, "DZ-07": {}, "DZ-08": {}, "DZ-09": {}, "DZ-10": {}, + "DZ-11": {}, "DZ-12": {}, "DZ-13": {}, "DZ-14": {}, "DZ-15": {}, + "DZ-16": {}, "DZ-17": {}, "DZ-18": {}, "DZ-19": {}, "DZ-20": {}, + "DZ-21": {}, "DZ-22": {}, "DZ-23": {}, "DZ-24": {}, "DZ-25": {}, + "DZ-26": {}, "DZ-27": {}, "DZ-28": {}, "DZ-29": {}, "DZ-30": {}, + "DZ-31": {}, "DZ-32": {}, "DZ-33": {}, "DZ-34": {}, "DZ-35": {}, + "DZ-36": {}, "DZ-37": {}, "DZ-38": {}, "DZ-39": {}, "DZ-40": {}, + "DZ-41": {}, "DZ-42": {}, "DZ-43": {}, "DZ-44": {}, "DZ-45": {}, + "DZ-46": {}, "DZ-47": {}, "DZ-48": {}, "DZ-49": {}, "DZ-51": {}, + "DZ-53": {}, "DZ-55": {}, "DZ-56": {}, "DZ-57": {}, "EC-A": {}, "EC-B": {}, + "EC-C": {}, "EC-D": {}, "EC-E": {}, "EC-F": {}, "EC-G": {}, + "EC-H": {}, "EC-I": {}, "EC-L": {}, "EC-M": {}, "EC-N": {}, + "EC-O": {}, "EC-P": {}, "EC-R": {}, "EC-S": {}, "EC-SD": {}, + "EC-SE": {}, "EC-T": {}, "EC-U": {}, "EC-W": {}, "EC-X": {}, + "EC-Y": {}, "EC-Z": {}, "EE-37": {}, "EE-39": {}, "EE-44": {}, "EE-45": {}, + "EE-49": {}, "EE-50": {}, "EE-51": {}, "EE-52": {}, "EE-56": {}, "EE-57": {}, + "EE-59": {}, "EE-60": {}, "EE-64": {}, "EE-65": {}, "EE-67": {}, "EE-68": {}, + "EE-70": {}, "EE-71": {}, "EE-74": {}, "EE-78": {}, "EE-79": {}, "EE-81": {}, "EE-82": {}, + "EE-84": {}, "EE-86": {}, "EE-87": {}, "EG-ALX": {}, "EG-ASN": {}, "EG-AST": {}, + "EG-BA": {}, "EG-BH": {}, "EG-BNS": {}, "EG-C": {}, "EG-DK": {}, + "EG-DT": {}, "EG-FYM": {}, "EG-GH": {}, "EG-GZ": {}, "EG-HU": {}, + "EG-IS": {}, "EG-JS": {}, "EG-KB": {}, "EG-KFS": {}, "EG-KN": {}, + "EG-LX": {}, "EG-MN": {}, "EG-MNF": {}, "EG-MT": {}, "EG-PTS": {}, "EG-SHG": {}, + "EG-SHR": {}, "EG-SIN": {}, "EG-SU": {}, "EG-SUZ": {}, "EG-WAD": {}, + "ER-AN": {}, "ER-DK": {}, "ER-DU": {}, "ER-GB": {}, "ER-MA": {}, + "ER-SK": {}, "ES-A": {}, "ES-AB": {}, "ES-AL": {}, "ES-AN": {}, + "ES-AR": {}, "ES-AS": {}, "ES-AV": {}, "ES-B": {}, "ES-BA": {}, + "ES-BI": {}, "ES-BU": {}, "ES-C": {}, "ES-CA": {}, "ES-CB": {}, + "ES-CC": {}, "ES-CE": {}, "ES-CL": {}, "ES-CM": {}, "ES-CN": {}, + "ES-CO": {}, "ES-CR": {}, "ES-CS": {}, "ES-CT": {}, "ES-CU": {}, + "ES-EX": {}, "ES-GA": {}, "ES-GC": {}, "ES-GI": {}, "ES-GR": {}, + "ES-GU": {}, "ES-H": {}, "ES-HU": {}, "ES-IB": {}, "ES-J": {}, + "ES-L": {}, "ES-LE": {}, "ES-LO": {}, "ES-LU": {}, "ES-M": {}, + "ES-MA": {}, "ES-MC": {}, "ES-MD": {}, "ES-ML": {}, "ES-MU": {}, + "ES-NA": {}, "ES-NC": {}, "ES-O": {}, "ES-OR": {}, "ES-P": {}, + "ES-PM": {}, "ES-PO": {}, "ES-PV": {}, "ES-RI": {}, "ES-S": {}, + "ES-SA": {}, "ES-SE": {}, "ES-SG": {}, "ES-SO": {}, "ES-SS": {}, + "ES-T": {}, "ES-TE": {}, "ES-TF": {}, "ES-TO": {}, "ES-V": {}, + "ES-VA": {}, "ES-VC": {}, "ES-VI": {}, "ES-Z": {}, "ES-ZA": {}, + "ET-AA": {}, "ET-AF": {}, "ET-AM": {}, "ET-BE": {}, "ET-DD": {}, + "ET-GA": {}, "ET-HA": {}, "ET-OR": {}, "ET-SN": {}, "ET-SO": {}, + "ET-TI": {}, "FI-01": {}, "FI-02": {}, "FI-03": {}, "FI-04": {}, + "FI-05": {}, "FI-06": {}, "FI-07": {}, "FI-08": {}, "FI-09": {}, + "FI-10": {}, "FI-11": {}, "FI-12": {}, "FI-13": {}, "FI-14": {}, + "FI-15": {}, "FI-16": {}, "FI-17": {}, "FI-18": {}, "FI-19": {}, + "FJ-C": {}, "FJ-E": {}, "FJ-N": {}, "FJ-R": {}, "FJ-W": {}, + "FM-KSA": {}, "FM-PNI": {}, "FM-TRK": {}, "FM-YAP": {}, "FR-01": {}, + "FR-02": {}, "FR-03": {}, "FR-04": {}, "FR-05": {}, "FR-06": {}, + "FR-07": {}, "FR-08": {}, "FR-09": {}, "FR-10": {}, "FR-11": {}, + "FR-12": {}, "FR-13": {}, "FR-14": {}, "FR-15": {}, "FR-16": {}, + "FR-17": {}, "FR-18": {}, "FR-19": {}, "FR-20R": {}, "FR-21": {}, "FR-22": {}, + "FR-23": {}, "FR-24": {}, "FR-25": {}, "FR-26": {}, "FR-27": {}, + "FR-28": {}, "FR-29": {}, "FR-2A": {}, "FR-2B": {}, "FR-30": {}, + "FR-31": {}, "FR-32": {}, "FR-33": {}, "FR-34": {}, "FR-35": {}, + "FR-36": {}, "FR-37": {}, "FR-38": {}, "FR-39": {}, "FR-40": {}, + "FR-41": {}, "FR-42": {}, "FR-43": {}, "FR-44": {}, "FR-45": {}, + "FR-46": {}, "FR-47": {}, "FR-48": {}, "FR-49": {}, "FR-50": {}, + "FR-51": {}, "FR-52": {}, "FR-53": {}, "FR-54": {}, "FR-55": {}, + "FR-56": {}, "FR-57": {}, "FR-58": {}, "FR-59": {}, "FR-60": {}, + "FR-61": {}, "FR-62": {}, "FR-63": {}, "FR-64": {}, "FR-65": {}, + "FR-66": {}, "FR-67": {}, "FR-68": {}, "FR-69": {}, "FR-70": {}, + "FR-71": {}, "FR-72": {}, "FR-73": {}, "FR-74": {}, "FR-75": {}, + "FR-76": {}, "FR-77": {}, "FR-78": {}, "FR-79": {}, "FR-80": {}, + "FR-81": {}, "FR-82": {}, "FR-83": {}, "FR-84": {}, "FR-85": {}, + "FR-86": {}, "FR-87": {}, "FR-88": {}, "FR-89": {}, "FR-90": {}, + "FR-91": {}, "FR-92": {}, "FR-93": {}, "FR-94": {}, "FR-95": {}, + "FR-ARA": {}, "FR-BFC": {}, "FR-BL": {}, "FR-BRE": {}, "FR-COR": {}, + "FR-CP": {}, "FR-CVL": {}, "FR-GES": {}, "FR-GF": {}, "FR-GP": {}, + "FR-GUA": {}, "FR-HDF": {}, "FR-IDF": {}, "FR-LRE": {}, "FR-MAY": {}, + "FR-MF": {}, "FR-MQ": {}, "FR-NAQ": {}, "FR-NC": {}, "FR-NOR": {}, + "FR-OCC": {}, "FR-PAC": {}, "FR-PDL": {}, "FR-PF": {}, "FR-PM": {}, + "FR-RE": {}, "FR-TF": {}, "FR-WF": {}, "FR-YT": {}, "GA-1": {}, + "GA-2": {}, "GA-3": {}, "GA-4": {}, "GA-5": {}, "GA-6": {}, + "GA-7": {}, "GA-8": {}, "GA-9": {}, "GB-ABC": {}, "GB-ABD": {}, + "GB-ABE": {}, "GB-AGB": {}, "GB-AGY": {}, "GB-AND": {}, "GB-ANN": {}, + "GB-ANS": {}, "GB-BAS": {}, "GB-BBD": {}, "GB-BDF": {}, "GB-BDG": {}, + "GB-BEN": {}, "GB-BEX": {}, "GB-BFS": {}, "GB-BGE": {}, "GB-BGW": {}, + "GB-BIR": {}, "GB-BKM": {}, "GB-BMH": {}, "GB-BNE": {}, "GB-BNH": {}, + "GB-BNS": {}, "GB-BOL": {}, "GB-BPL": {}, "GB-BRC": {}, "GB-BRD": {}, + "GB-BRY": {}, "GB-BST": {}, "GB-BUR": {}, "GB-CAM": {}, "GB-CAY": {}, + "GB-CBF": {}, "GB-CCG": {}, "GB-CGN": {}, "GB-CHE": {}, "GB-CHW": {}, + "GB-CLD": {}, "GB-CLK": {}, "GB-CMA": {}, "GB-CMD": {}, "GB-CMN": {}, + "GB-CON": {}, "GB-COV": {}, "GB-CRF": {}, "GB-CRY": {}, "GB-CWY": {}, + "GB-DAL": {}, "GB-DBY": {}, "GB-DEN": {}, "GB-DER": {}, "GB-DEV": {}, + "GB-DGY": {}, "GB-DNC": {}, "GB-DND": {}, "GB-DOR": {}, "GB-DRS": {}, + "GB-DUD": {}, "GB-DUR": {}, "GB-EAL": {}, "GB-EAW": {}, "GB-EAY": {}, + "GB-EDH": {}, "GB-EDU": {}, "GB-ELN": {}, "GB-ELS": {}, "GB-ENF": {}, + "GB-ENG": {}, "GB-ERW": {}, "GB-ERY": {}, "GB-ESS": {}, "GB-ESX": {}, + "GB-FAL": {}, "GB-FIF": {}, "GB-FLN": {}, "GB-FMO": {}, "GB-GAT": {}, + "GB-GBN": {}, "GB-GLG": {}, "GB-GLS": {}, "GB-GRE": {}, "GB-GWN": {}, + "GB-HAL": {}, "GB-HAM": {}, "GB-HAV": {}, "GB-HCK": {}, "GB-HEF": {}, + "GB-HIL": {}, "GB-HLD": {}, "GB-HMF": {}, "GB-HNS": {}, "GB-HPL": {}, + "GB-HRT": {}, "GB-HRW": {}, "GB-HRY": {}, "GB-IOS": {}, "GB-IOW": {}, + "GB-ISL": {}, "GB-IVC": {}, "GB-KEC": {}, "GB-KEN": {}, "GB-KHL": {}, + "GB-KIR": {}, "GB-KTT": {}, "GB-KWL": {}, "GB-LAN": {}, "GB-LBC": {}, + "GB-LBH": {}, "GB-LCE": {}, "GB-LDS": {}, "GB-LEC": {}, "GB-LEW": {}, + "GB-LIN": {}, "GB-LIV": {}, "GB-LND": {}, "GB-LUT": {}, "GB-MAN": {}, + "GB-MDB": {}, "GB-MDW": {}, "GB-MEA": {}, "GB-MIK": {}, "GD-01": {}, + "GB-MLN": {}, "GB-MON": {}, "GB-MRT": {}, "GB-MRY": {}, "GB-MTY": {}, + "GB-MUL": {}, "GB-NAY": {}, "GB-NBL": {}, "GB-NEL": {}, "GB-NET": {}, + "GB-NFK": {}, "GB-NGM": {}, "GB-NIR": {}, "GB-NLK": {}, "GB-NLN": {}, + "GB-NMD": {}, "GB-NSM": {}, "GB-NTH": {}, "GB-NTL": {}, "GB-NTT": {}, + "GB-NTY": {}, "GB-NWM": {}, "GB-NWP": {}, "GB-NYK": {}, "GB-OLD": {}, + "GB-ORK": {}, "GB-OXF": {}, "GB-PEM": {}, "GB-PKN": {}, "GB-PLY": {}, + "GB-POL": {}, "GB-POR": {}, "GB-POW": {}, "GB-PTE": {}, "GB-RCC": {}, + "GB-RCH": {}, "GB-RCT": {}, "GB-RDB": {}, "GB-RDG": {}, "GB-RFW": {}, + "GB-RIC": {}, "GB-ROT": {}, "GB-RUT": {}, "GB-SAW": {}, "GB-SAY": {}, + "GB-SCB": {}, "GB-SCT": {}, "GB-SFK": {}, "GB-SFT": {}, "GB-SGC": {}, + "GB-SHF": {}, "GB-SHN": {}, "GB-SHR": {}, "GB-SKP": {}, "GB-SLF": {}, + "GB-SLG": {}, "GB-SLK": {}, "GB-SND": {}, "GB-SOL": {}, "GB-SOM": {}, + "GB-SOS": {}, "GB-SRY": {}, "GB-STE": {}, "GB-STG": {}, "GB-STH": {}, + "GB-STN": {}, "GB-STS": {}, "GB-STT": {}, "GB-STY": {}, "GB-SWA": {}, + "GB-SWD": {}, "GB-SWK": {}, "GB-TAM": {}, "GB-TFW": {}, "GB-THR": {}, + "GB-TOB": {}, "GB-TOF": {}, "GB-TRF": {}, "GB-TWH": {}, "GB-UKM": {}, + "GB-VGL": {}, "GB-WAR": {}, "GB-WBK": {}, "GB-WDU": {}, "GB-WFT": {}, + "GB-WGN": {}, "GB-WIL": {}, "GB-WKF": {}, "GB-WLL": {}, "GB-WLN": {}, + "GB-WLS": {}, "GB-WLV": {}, "GB-WND": {}, "GB-WNM": {}, "GB-WOK": {}, + "GB-WOR": {}, "GB-WRL": {}, "GB-WRT": {}, "GB-WRX": {}, "GB-WSM": {}, + "GB-WSX": {}, "GB-YOR": {}, "GB-ZET": {}, "GD-02": {}, "GD-03": {}, + "GD-04": {}, "GD-05": {}, "GD-06": {}, "GD-10": {}, "GE-AB": {}, + "GE-AJ": {}, "GE-GU": {}, "GE-IM": {}, "GE-KA": {}, "GE-KK": {}, + "GE-MM": {}, "GE-RL": {}, "GE-SJ": {}, "GE-SK": {}, "GE-SZ": {}, + "GE-TB": {}, "GH-AA": {}, "GH-AH": {}, "GH-AF": {}, "GH-BA": {}, "GH-BO": {}, "GH-BE": {}, "GH-CP": {}, + "GH-EP": {}, "GH-NP": {}, "GH-TV": {}, "GH-UE": {}, "GH-UW": {}, + "GH-WP": {}, "GL-AV": {}, "GL-KU": {}, "GL-QA": {}, "GL-QT": {}, "GL-QE": {}, "GL-SM": {}, + "GM-B": {}, "GM-L": {}, "GM-M": {}, "GM-N": {}, "GM-U": {}, + "GM-W": {}, "GN-B": {}, "GN-BE": {}, "GN-BF": {}, "GN-BK": {}, + "GN-C": {}, "GN-CO": {}, "GN-D": {}, "GN-DB": {}, "GN-DI": {}, + "GN-DL": {}, "GN-DU": {}, "GN-F": {}, "GN-FA": {}, "GN-FO": {}, + "GN-FR": {}, "GN-GA": {}, "GN-GU": {}, "GN-K": {}, "GN-KA": {}, + "GN-KB": {}, "GN-KD": {}, "GN-KE": {}, "GN-KN": {}, "GN-KO": {}, + "GN-KS": {}, "GN-L": {}, "GN-LA": {}, "GN-LE": {}, "GN-LO": {}, + "GN-M": {}, "GN-MC": {}, "GN-MD": {}, "GN-ML": {}, "GN-MM": {}, + "GN-N": {}, "GN-NZ": {}, "GN-PI": {}, "GN-SI": {}, "GN-TE": {}, + "GN-TO": {}, "GN-YO": {}, "GQ-AN": {}, "GQ-BN": {}, "GQ-BS": {}, + "GQ-C": {}, "GQ-CS": {}, "GQ-I": {}, "GQ-KN": {}, "GQ-LI": {}, + "GQ-WN": {}, "GR-01": {}, "GR-03": {}, "GR-04": {}, "GR-05": {}, + "GR-06": {}, "GR-07": {}, "GR-11": {}, "GR-12": {}, "GR-13": {}, + "GR-14": {}, "GR-15": {}, "GR-16": {}, "GR-17": {}, "GR-21": {}, + "GR-22": {}, "GR-23": {}, "GR-24": {}, "GR-31": {}, "GR-32": {}, + "GR-33": {}, "GR-34": {}, "GR-41": {}, "GR-42": {}, "GR-43": {}, + "GR-44": {}, "GR-51": {}, "GR-52": {}, "GR-53": {}, "GR-54": {}, + "GR-55": {}, "GR-56": {}, "GR-57": {}, "GR-58": {}, "GR-59": {}, + "GR-61": {}, "GR-62": {}, "GR-63": {}, "GR-64": {}, "GR-69": {}, + "GR-71": {}, "GR-72": {}, "GR-73": {}, "GR-81": {}, "GR-82": {}, + "GR-83": {}, "GR-84": {}, "GR-85": {}, "GR-91": {}, "GR-92": {}, + "GR-93": {}, "GR-94": {}, "GR-A": {}, "GR-A1": {}, "GR-B": {}, + "GR-C": {}, "GR-D": {}, "GR-E": {}, "GR-F": {}, "GR-G": {}, + "GR-H": {}, "GR-I": {}, "GR-J": {}, "GR-K": {}, "GR-L": {}, + "GR-M": {}, "GT-01": {}, "GT-02": {}, "GT-03": {}, "GT-04": {}, + "GT-05": {}, "GT-06": {}, "GT-07": {}, "GT-08": {}, "GT-09": {}, + "GT-10": {}, "GT-11": {}, "GT-12": {}, "GT-13": {}, "GT-14": {}, + "GT-15": {}, "GT-16": {}, "GT-17": {}, "GT-18": {}, "GT-19": {}, + "GT-20": {}, "GT-21": {}, "GT-22": {}, "GW-BA": {}, "GW-BL": {}, + "GW-BM": {}, "GW-BS": {}, "GW-CA": {}, "GW-GA": {}, "GW-L": {}, + "GW-N": {}, "GW-OI": {}, "GW-QU": {}, "GW-S": {}, "GW-TO": {}, + "GY-BA": {}, "GY-CU": {}, "GY-DE": {}, "GY-EB": {}, "GY-ES": {}, + "GY-MA": {}, "GY-PM": {}, "GY-PT": {}, "GY-UD": {}, "GY-UT": {}, + "HN-AT": {}, "HN-CH": {}, "HN-CL": {}, "HN-CM": {}, "HN-CP": {}, + "HN-CR": {}, "HN-EP": {}, "HN-FM": {}, "HN-GD": {}, "HN-IB": {}, + "HN-IN": {}, "HN-LE": {}, "HN-LP": {}, "HN-OC": {}, "HN-OL": {}, + "HN-SB": {}, "HN-VA": {}, "HN-YO": {}, "HR-01": {}, "HR-02": {}, + "HR-03": {}, "HR-04": {}, "HR-05": {}, "HR-06": {}, "HR-07": {}, + "HR-08": {}, "HR-09": {}, "HR-10": {}, "HR-11": {}, "HR-12": {}, + "HR-13": {}, "HR-14": {}, "HR-15": {}, "HR-16": {}, "HR-17": {}, + "HR-18": {}, "HR-19": {}, "HR-20": {}, "HR-21": {}, "HT-AR": {}, + "HT-CE": {}, "HT-GA": {}, "HT-ND": {}, "HT-NE": {}, "HT-NO": {}, "HT-NI": {}, + "HT-OU": {}, "HT-SD": {}, "HT-SE": {}, "HU-BA": {}, "HU-BC": {}, + "HU-BE": {}, "HU-BK": {}, "HU-BU": {}, "HU-BZ": {}, "HU-CS": {}, + "HU-DE": {}, "HU-DU": {}, "HU-EG": {}, "HU-ER": {}, "HU-FE": {}, + "HU-GS": {}, "HU-GY": {}, "HU-HB": {}, "HU-HE": {}, "HU-HV": {}, + "HU-JN": {}, "HU-KE": {}, "HU-KM": {}, "HU-KV": {}, "HU-MI": {}, + "HU-NK": {}, "HU-NO": {}, "HU-NY": {}, "HU-PE": {}, "HU-PS": {}, + "HU-SD": {}, "HU-SF": {}, "HU-SH": {}, "HU-SK": {}, "HU-SN": {}, + "HU-SO": {}, "HU-SS": {}, "HU-ST": {}, "HU-SZ": {}, "HU-TB": {}, + "HU-TO": {}, "HU-VA": {}, "HU-VE": {}, "HU-VM": {}, "HU-ZA": {}, + "HU-ZE": {}, "ID-AC": {}, "ID-BA": {}, "ID-BB": {}, "ID-BE": {}, + "ID-BT": {}, "ID-GO": {}, "ID-IJ": {}, "ID-JA": {}, "ID-JB": {}, + "ID-JI": {}, "ID-JK": {}, "ID-JT": {}, "ID-JW": {}, "ID-KA": {}, + "ID-KB": {}, "ID-KI": {}, "ID-KU": {}, "ID-KR": {}, "ID-KS": {}, + "ID-KT": {}, "ID-LA": {}, "ID-MA": {}, "ID-ML": {}, "ID-MU": {}, + "ID-NB": {}, "ID-NT": {}, "ID-NU": {}, "ID-PA": {}, "ID-PB": {}, + "ID-PE": {}, "ID-PP": {}, "ID-PS": {}, "ID-PT": {}, "ID-RI": {}, + "ID-SA": {}, "ID-SB": {}, "ID-SG": {}, "ID-SL": {}, "ID-SM": {}, + "ID-SN": {}, "ID-SR": {}, "ID-SS": {}, "ID-ST": {}, "ID-SU": {}, + "ID-YO": {}, "IE-C": {}, "IE-CE": {}, "IE-CN": {}, "IE-CO": {}, + "IE-CW": {}, "IE-D": {}, "IE-DL": {}, "IE-G": {}, "IE-KE": {}, + "IE-KK": {}, "IE-KY": {}, "IE-L": {}, "IE-LD": {}, "IE-LH": {}, + "IE-LK": {}, "IE-LM": {}, "IE-LS": {}, "IE-M": {}, "IE-MH": {}, + "IE-MN": {}, "IE-MO": {}, "IE-OY": {}, "IE-RN": {}, "IE-SO": {}, + "IE-TA": {}, "IE-U": {}, "IE-WD": {}, "IE-WH": {}, "IE-WW": {}, + "IE-WX": {}, "IL-D": {}, "IL-HA": {}, "IL-JM": {}, "IL-M": {}, + "IL-TA": {}, "IL-Z": {}, "IN-AN": {}, "IN-AP": {}, "IN-AR": {}, + "IN-AS": {}, "IN-BR": {}, "IN-CH": {}, "IN-CT": {}, "IN-DH": {}, + "IN-DL": {}, "IN-DN": {}, "IN-GA": {}, "IN-GJ": {}, "IN-HP": {}, + "IN-HR": {}, "IN-JH": {}, "IN-JK": {}, "IN-KA": {}, "IN-KL": {}, + "IN-LD": {}, "IN-MH": {}, "IN-ML": {}, "IN-MN": {}, "IN-MP": {}, + "IN-MZ": {}, "IN-NL": {}, "IN-TG": {}, "IN-OR": {}, "IN-PB": {}, "IN-PY": {}, + "IN-RJ": {}, "IN-SK": {}, "IN-TN": {}, "IN-TR": {}, "IN-UP": {}, + "IN-UT": {}, "IN-WB": {}, "IQ-AN": {}, "IQ-AR": {}, "IQ-BA": {}, + "IQ-BB": {}, "IQ-BG": {}, "IQ-DA": {}, "IQ-DI": {}, "IQ-DQ": {}, + "IQ-KA": {}, "IQ-KI": {}, "IQ-MA": {}, "IQ-MU": {}, "IQ-NA": {}, "IQ-NI": {}, + "IQ-QA": {}, "IQ-SD": {}, "IQ-SW": {}, "IQ-SU": {}, "IQ-TS": {}, "IQ-WA": {}, + "IR-00": {}, "IR-01": {}, "IR-02": {}, "IR-03": {}, "IR-04": {}, "IR-05": {}, + "IR-06": {}, "IR-07": {}, "IR-08": {}, "IR-09": {}, "IR-10": {}, "IR-11": {}, + "IR-12": {}, "IR-13": {}, "IR-14": {}, "IR-15": {}, "IR-16": {}, + "IR-17": {}, "IR-18": {}, "IR-19": {}, "IR-20": {}, "IR-21": {}, + "IR-22": {}, "IR-23": {}, "IR-24": {}, "IR-25": {}, "IR-26": {}, + "IR-27": {}, "IR-28": {}, "IR-29": {}, "IR-30": {}, "IR-31": {}, + "IS-0": {}, "IS-1": {}, "IS-2": {}, "IS-3": {}, "IS-4": {}, + "IS-5": {}, "IS-6": {}, "IS-7": {}, "IS-8": {}, "IT-21": {}, + "IT-23": {}, "IT-25": {}, "IT-32": {}, "IT-34": {}, "IT-36": {}, + "IT-42": {}, "IT-45": {}, "IT-52": {}, "IT-55": {}, "IT-57": {}, + "IT-62": {}, "IT-65": {}, "IT-67": {}, "IT-72": {}, "IT-75": {}, + "IT-77": {}, "IT-78": {}, "IT-82": {}, "IT-88": {}, "IT-AG": {}, + "IT-AL": {}, "IT-AN": {}, "IT-AO": {}, "IT-AP": {}, "IT-AQ": {}, + "IT-AR": {}, "IT-AT": {}, "IT-AV": {}, "IT-BA": {}, "IT-BG": {}, + "IT-BI": {}, "IT-BL": {}, "IT-BN": {}, "IT-BO": {}, "IT-BR": {}, + "IT-BS": {}, "IT-BT": {}, "IT-BZ": {}, "IT-CA": {}, "IT-CB": {}, + "IT-CE": {}, "IT-CH": {}, "IT-CI": {}, "IT-CL": {}, "IT-CN": {}, + "IT-CO": {}, "IT-CR": {}, "IT-CS": {}, "IT-CT": {}, "IT-CZ": {}, + "IT-EN": {}, "IT-FC": {}, "IT-FE": {}, "IT-FG": {}, "IT-FI": {}, + "IT-FM": {}, "IT-FR": {}, "IT-GE": {}, "IT-GO": {}, "IT-GR": {}, + "IT-IM": {}, "IT-IS": {}, "IT-KR": {}, "IT-LC": {}, "IT-LE": {}, + "IT-LI": {}, "IT-LO": {}, "IT-LT": {}, "IT-LU": {}, "IT-MB": {}, + "IT-MC": {}, "IT-ME": {}, "IT-MI": {}, "IT-MN": {}, "IT-MO": {}, + "IT-MS": {}, "IT-MT": {}, "IT-NA": {}, "IT-NO": {}, "IT-NU": {}, + "IT-OG": {}, "IT-OR": {}, "IT-OT": {}, "IT-PA": {}, "IT-PC": {}, + "IT-PD": {}, "IT-PE": {}, "IT-PG": {}, "IT-PI": {}, "IT-PN": {}, + "IT-PO": {}, "IT-PR": {}, "IT-PT": {}, "IT-PU": {}, "IT-PV": {}, + "IT-PZ": {}, "IT-RA": {}, "IT-RC": {}, "IT-RE": {}, "IT-RG": {}, + "IT-RI": {}, "IT-RM": {}, "IT-RN": {}, "IT-RO": {}, "IT-SA": {}, + "IT-SI": {}, "IT-SO": {}, "IT-SP": {}, "IT-SR": {}, "IT-SS": {}, + "IT-SV": {}, "IT-TA": {}, "IT-TE": {}, "IT-TN": {}, "IT-TO": {}, + "IT-TP": {}, "IT-TR": {}, "IT-TS": {}, "IT-TV": {}, "IT-UD": {}, + "IT-VA": {}, "IT-VB": {}, "IT-VC": {}, "IT-VE": {}, "IT-VI": {}, + "IT-VR": {}, "IT-VS": {}, "IT-VT": {}, "IT-VV": {}, "JM-01": {}, + "JM-02": {}, "JM-03": {}, "JM-04": {}, "JM-05": {}, "JM-06": {}, + "JM-07": {}, "JM-08": {}, "JM-09": {}, "JM-10": {}, "JM-11": {}, + "JM-12": {}, "JM-13": {}, "JM-14": {}, "JO-AJ": {}, "JO-AM": {}, + "JO-AQ": {}, "JO-AT": {}, "JO-AZ": {}, "JO-BA": {}, "JO-IR": {}, + "JO-JA": {}, "JO-KA": {}, "JO-MA": {}, "JO-MD": {}, "JO-MN": {}, + "JP-01": {}, "JP-02": {}, "JP-03": {}, "JP-04": {}, "JP-05": {}, + "JP-06": {}, "JP-07": {}, "JP-08": {}, "JP-09": {}, "JP-10": {}, + "JP-11": {}, "JP-12": {}, "JP-13": {}, "JP-14": {}, "JP-15": {}, + "JP-16": {}, "JP-17": {}, "JP-18": {}, "JP-19": {}, "JP-20": {}, + "JP-21": {}, "JP-22": {}, "JP-23": {}, "JP-24": {}, "JP-25": {}, + "JP-26": {}, "JP-27": {}, "JP-28": {}, "JP-29": {}, "JP-30": {}, + "JP-31": {}, "JP-32": {}, "JP-33": {}, "JP-34": {}, "JP-35": {}, + "JP-36": {}, "JP-37": {}, "JP-38": {}, "JP-39": {}, "JP-40": {}, + "JP-41": {}, "JP-42": {}, "JP-43": {}, "JP-44": {}, "JP-45": {}, + "JP-46": {}, "JP-47": {}, "KE-01": {}, "KE-02": {}, "KE-03": {}, + "KE-04": {}, "KE-05": {}, "KE-06": {}, "KE-07": {}, "KE-08": {}, + "KE-09": {}, "KE-10": {}, "KE-11": {}, "KE-12": {}, "KE-13": {}, + "KE-14": {}, "KE-15": {}, "KE-16": {}, "KE-17": {}, "KE-18": {}, + "KE-19": {}, "KE-20": {}, "KE-21": {}, "KE-22": {}, "KE-23": {}, + "KE-24": {}, "KE-25": {}, "KE-26": {}, "KE-27": {}, "KE-28": {}, + "KE-29": {}, "KE-30": {}, "KE-31": {}, "KE-32": {}, "KE-33": {}, + "KE-34": {}, "KE-35": {}, "KE-36": {}, "KE-37": {}, "KE-38": {}, + "KE-39": {}, "KE-40": {}, "KE-41": {}, "KE-42": {}, "KE-43": {}, + "KE-44": {}, "KE-45": {}, "KE-46": {}, "KE-47": {}, "KG-B": {}, + "KG-C": {}, "KG-GB": {}, "KG-GO": {}, "KG-J": {}, "KG-N": {}, "KG-O": {}, + "KG-T": {}, "KG-Y": {}, "KH-1": {}, "KH-10": {}, "KH-11": {}, + "KH-12": {}, "KH-13": {}, "KH-14": {}, "KH-15": {}, "KH-16": {}, + "KH-17": {}, "KH-18": {}, "KH-19": {}, "KH-2": {}, "KH-20": {}, + "KH-21": {}, "KH-22": {}, "KH-23": {}, "KH-24": {}, "KH-3": {}, + "KH-4": {}, "KH-5": {}, "KH-6": {}, "KH-7": {}, "KH-8": {}, + "KH-9": {}, "KI-G": {}, "KI-L": {}, "KI-P": {}, "KM-A": {}, + "KM-G": {}, "KM-M": {}, "KN-01": {}, "KN-02": {}, "KN-03": {}, + "KN-04": {}, "KN-05": {}, "KN-06": {}, "KN-07": {}, "KN-08": {}, + "KN-09": {}, "KN-10": {}, "KN-11": {}, "KN-12": {}, "KN-13": {}, + "KN-15": {}, "KN-K": {}, "KN-N": {}, "KP-01": {}, "KP-02": {}, + "KP-03": {}, "KP-04": {}, "KP-05": {}, "KP-06": {}, "KP-07": {}, + "KP-08": {}, "KP-09": {}, "KP-10": {}, "KP-13": {}, "KR-11": {}, + "KR-26": {}, "KR-27": {}, "KR-28": {}, "KR-29": {}, "KR-30": {}, + "KR-31": {}, "KR-41": {}, "KR-42": {}, "KR-43": {}, "KR-44": {}, + "KR-45": {}, "KR-46": {}, "KR-47": {}, "KR-48": {}, "KR-49": {}, + "KW-AH": {}, "KW-FA": {}, "KW-HA": {}, "KW-JA": {}, "KW-KU": {}, + "KW-MU": {}, "KZ-10": {}, "KZ-75": {}, "KZ-19": {}, "KZ-11": {}, + "KZ-15": {}, "KZ-71": {}, "KZ-23": {}, "KZ-27": {}, "KZ-47": {}, + "KZ-55": {}, "KZ-35": {}, "KZ-39": {}, "KZ-43": {}, "KZ-63": {}, + "KZ-79": {}, "KZ-59": {}, "KZ-61": {}, "KZ-62": {}, "KZ-31": {}, + "KZ-33": {}, "LA-AT": {}, "LA-BK": {}, "LA-BL": {}, + "LA-CH": {}, "LA-HO": {}, "LA-KH": {}, "LA-LM": {}, "LA-LP": {}, + "LA-OU": {}, "LA-PH": {}, "LA-SL": {}, "LA-SV": {}, "LA-VI": {}, + "LA-VT": {}, "LA-XA": {}, "LA-XE": {}, "LA-XI": {}, "LA-XS": {}, + "LB-AK": {}, "LB-AS": {}, "LB-BA": {}, "LB-BH": {}, "LB-BI": {}, + "LB-JA": {}, "LB-JL": {}, "LB-NA": {}, "LC-01": {}, "LC-02": {}, + "LC-03": {}, "LC-05": {}, "LC-06": {}, "LC-07": {}, "LC-08": {}, + "LC-10": {}, "LC-11": {}, "LI-01": {}, "LI-02": {}, + "LI-03": {}, "LI-04": {}, "LI-05": {}, "LI-06": {}, "LI-07": {}, + "LI-08": {}, "LI-09": {}, "LI-10": {}, "LI-11": {}, "LK-1": {}, + "LK-11": {}, "LK-12": {}, "LK-13": {}, "LK-2": {}, "LK-21": {}, + "LK-22": {}, "LK-23": {}, "LK-3": {}, "LK-31": {}, "LK-32": {}, + "LK-33": {}, "LK-4": {}, "LK-41": {}, "LK-42": {}, "LK-43": {}, + "LK-44": {}, "LK-45": {}, "LK-5": {}, "LK-51": {}, "LK-52": {}, + "LK-53": {}, "LK-6": {}, "LK-61": {}, "LK-62": {}, "LK-7": {}, + "LK-71": {}, "LK-72": {}, "LK-8": {}, "LK-81": {}, "LK-82": {}, + "LK-9": {}, "LK-91": {}, "LK-92": {}, "LR-BG": {}, "LR-BM": {}, + "LR-CM": {}, "LR-GB": {}, "LR-GG": {}, "LR-GK": {}, "LR-LO": {}, + "LR-MG": {}, "LR-MO": {}, "LR-MY": {}, "LR-NI": {}, "LR-RI": {}, + "LR-SI": {}, "LS-A": {}, "LS-B": {}, "LS-C": {}, "LS-D": {}, + "LS-E": {}, "LS-F": {}, "LS-G": {}, "LS-H": {}, "LS-J": {}, + "LS-K": {}, "LT-AL": {}, "LT-KL": {}, "LT-KU": {}, "LT-MR": {}, + "LT-PN": {}, "LT-SA": {}, "LT-TA": {}, "LT-TE": {}, "LT-UT": {}, + "LT-VL": {}, "LU-CA": {}, "LU-CL": {}, "LU-DI": {}, "LU-EC": {}, + "LU-ES": {}, "LU-GR": {}, "LU-LU": {}, "LU-ME": {}, "LU-RD": {}, + "LU-RM": {}, "LU-VD": {}, "LU-WI": {}, "LU-D": {}, "LU-G": {}, "LU-L": {}, + "LV-001": {}, "LV-111": {}, "LV-112": {}, "LV-113": {}, + "LV-002": {}, "LV-003": {}, "LV-004": {}, "LV-005": {}, "LV-006": {}, + "LV-007": {}, "LV-008": {}, "LV-009": {}, "LV-010": {}, "LV-011": {}, + "LV-012": {}, "LV-013": {}, "LV-014": {}, "LV-015": {}, "LV-016": {}, + "LV-017": {}, "LV-018": {}, "LV-019": {}, "LV-020": {}, "LV-021": {}, + "LV-022": {}, "LV-023": {}, "LV-024": {}, "LV-025": {}, "LV-026": {}, + "LV-027": {}, "LV-028": {}, "LV-029": {}, "LV-030": {}, "LV-031": {}, + "LV-032": {}, "LV-033": {}, "LV-034": {}, "LV-035": {}, "LV-036": {}, + "LV-037": {}, "LV-038": {}, "LV-039": {}, "LV-040": {}, "LV-041": {}, + "LV-042": {}, "LV-043": {}, "LV-044": {}, "LV-045": {}, "LV-046": {}, + "LV-047": {}, "LV-048": {}, "LV-049": {}, "LV-050": {}, "LV-051": {}, + "LV-052": {}, "LV-053": {}, "LV-054": {}, "LV-055": {}, "LV-056": {}, + "LV-057": {}, "LV-058": {}, "LV-059": {}, "LV-060": {}, "LV-061": {}, + "LV-062": {}, "LV-063": {}, "LV-064": {}, "LV-065": {}, "LV-066": {}, + "LV-067": {}, "LV-068": {}, "LV-069": {}, "LV-070": {}, "LV-071": {}, + "LV-072": {}, "LV-073": {}, "LV-074": {}, "LV-075": {}, "LV-076": {}, + "LV-077": {}, "LV-078": {}, "LV-079": {}, "LV-080": {}, "LV-081": {}, + "LV-082": {}, "LV-083": {}, "LV-084": {}, "LV-085": {}, "LV-086": {}, + "LV-087": {}, "LV-088": {}, "LV-089": {}, "LV-090": {}, "LV-091": {}, + "LV-092": {}, "LV-093": {}, "LV-094": {}, "LV-095": {}, "LV-096": {}, + "LV-097": {}, "LV-098": {}, "LV-099": {}, "LV-100": {}, "LV-101": {}, + "LV-102": {}, "LV-103": {}, "LV-104": {}, "LV-105": {}, "LV-106": {}, + "LV-107": {}, "LV-108": {}, "LV-109": {}, "LV-110": {}, "LV-DGV": {}, + "LV-JEL": {}, "LV-JKB": {}, "LV-JUR": {}, "LV-LPX": {}, "LV-REZ": {}, + "LV-RIX": {}, "LV-VEN": {}, "LV-VMR": {}, "LY-BA": {}, "LY-BU": {}, + "LY-DR": {}, "LY-GT": {}, "LY-JA": {}, "LY-JB": {}, "LY-JG": {}, + "LY-JI": {}, "LY-JU": {}, "LY-KF": {}, "LY-MB": {}, "LY-MI": {}, + "LY-MJ": {}, "LY-MQ": {}, "LY-NL": {}, "LY-NQ": {}, "LY-SB": {}, + "LY-SR": {}, "LY-TB": {}, "LY-WA": {}, "LY-WD": {}, "LY-WS": {}, + "LY-ZA": {}, "MA-01": {}, "MA-02": {}, "MA-03": {}, "MA-04": {}, + "MA-05": {}, "MA-06": {}, "MA-07": {}, "MA-08": {}, "MA-09": {}, + "MA-10": {}, "MA-11": {}, "MA-12": {}, "MA-13": {}, "MA-14": {}, + "MA-15": {}, "MA-16": {}, "MA-AGD": {}, "MA-AOU": {}, "MA-ASZ": {}, + "MA-AZI": {}, "MA-BEM": {}, "MA-BER": {}, "MA-BES": {}, "MA-BOD": {}, + "MA-BOM": {}, "MA-CAS": {}, "MA-CHE": {}, "MA-CHI": {}, "MA-CHT": {}, + "MA-ERR": {}, "MA-ESI": {}, "MA-ESM": {}, "MA-FAH": {}, "MA-FES": {}, + "MA-FIG": {}, "MA-GUE": {}, "MA-HAJ": {}, "MA-HAO": {}, "MA-HOC": {}, + "MA-IFR": {}, "MA-INE": {}, "MA-JDI": {}, "MA-JRA": {}, "MA-KEN": {}, + "MA-KES": {}, "MA-KHE": {}, "MA-KHN": {}, "MA-KHO": {}, "MA-LAA": {}, + "MA-LAR": {}, "MA-MED": {}, "MA-MEK": {}, "MA-MMD": {}, "MA-MMN": {}, + "MA-MOH": {}, "MA-MOU": {}, "MA-NAD": {}, "MA-NOU": {}, "MA-OUA": {}, + "MA-OUD": {}, "MA-OUJ": {}, "MA-RAB": {}, "MA-SAF": {}, "MA-SAL": {}, + "MA-SEF": {}, "MA-SET": {}, "MA-SIK": {}, "MA-SKH": {}, "MA-SYB": {}, + "MA-TAI": {}, "MA-TAO": {}, "MA-TAR": {}, "MA-TAT": {}, "MA-TAZ": {}, + "MA-TET": {}, "MA-TIZ": {}, "MA-TNG": {}, "MA-TNT": {}, "MA-ZAG": {}, + "MC-CL": {}, "MC-CO": {}, "MC-FO": {}, "MC-GA": {}, "MC-JE": {}, + "MC-LA": {}, "MC-MA": {}, "MC-MC": {}, "MC-MG": {}, "MC-MO": {}, + "MC-MU": {}, "MC-PH": {}, "MC-SD": {}, "MC-SO": {}, "MC-SP": {}, + "MC-SR": {}, "MC-VR": {}, "MD-AN": {}, "MD-BA": {}, "MD-BD": {}, + "MD-BR": {}, "MD-BS": {}, "MD-CA": {}, "MD-CL": {}, "MD-CM": {}, + "MD-CR": {}, "MD-CS": {}, "MD-CT": {}, "MD-CU": {}, "MD-DO": {}, + "MD-DR": {}, "MD-DU": {}, "MD-ED": {}, "MD-FA": {}, "MD-FL": {}, + "MD-GA": {}, "MD-GL": {}, "MD-HI": {}, "MD-IA": {}, "MD-LE": {}, + "MD-NI": {}, "MD-OC": {}, "MD-OR": {}, "MD-RE": {}, "MD-RI": {}, + "MD-SD": {}, "MD-SI": {}, "MD-SN": {}, "MD-SO": {}, "MD-ST": {}, + "MD-SV": {}, "MD-TA": {}, "MD-TE": {}, "MD-UN": {}, "ME-01": {}, + "ME-02": {}, "ME-03": {}, "ME-04": {}, "ME-05": {}, "ME-06": {}, + "ME-07": {}, "ME-08": {}, "ME-09": {}, "ME-10": {}, "ME-11": {}, + "ME-12": {}, "ME-13": {}, "ME-14": {}, "ME-15": {}, "ME-16": {}, + "ME-17": {}, "ME-18": {}, "ME-19": {}, "ME-20": {}, "ME-21": {}, "ME-24": {}, + "MG-A": {}, "MG-D": {}, "MG-F": {}, "MG-M": {}, "MG-T": {}, + "MG-U": {}, "MH-ALK": {}, "MH-ALL": {}, "MH-ARN": {}, "MH-AUR": {}, + "MH-EBO": {}, "MH-ENI": {}, "MH-JAB": {}, "MH-JAL": {}, "MH-KIL": {}, + "MH-KWA": {}, "MH-L": {}, "MH-LAE": {}, "MH-LIB": {}, "MH-LIK": {}, + "MH-MAJ": {}, "MH-MAL": {}, "MH-MEJ": {}, "MH-MIL": {}, "MH-NMK": {}, + "MH-NMU": {}, "MH-RON": {}, "MH-T": {}, "MH-UJA": {}, "MH-UTI": {}, + "MH-WTJ": {}, "MH-WTN": {}, "MK-101": {}, "MK-102": {}, "MK-103": {}, + "MK-104": {}, "MK-105": {}, + "MK-106": {}, "MK-107": {}, "MK-108": {}, "MK-109": {}, "MK-201": {}, + "MK-202": {}, "MK-205": {}, "MK-206": {}, "MK-207": {}, "MK-208": {}, + "MK-209": {}, "MK-210": {}, "MK-211": {}, "MK-301": {}, "MK-303": {}, + "MK-307": {}, "MK-308": {}, "MK-310": {}, "MK-311": {}, "MK-312": {}, + "MK-401": {}, "MK-402": {}, "MK-403": {}, "MK-404": {}, "MK-405": {}, + "MK-406": {}, "MK-408": {}, "MK-409": {}, "MK-410": {}, "MK-501": {}, + "MK-502": {}, "MK-503": {}, "MK-505": {}, "MK-506": {}, "MK-507": {}, + "MK-508": {}, "MK-509": {}, "MK-601": {}, "MK-602": {}, "MK-604": {}, + "MK-605": {}, "MK-606": {}, "MK-607": {}, "MK-608": {}, "MK-609": {}, + "MK-701": {}, "MK-702": {}, "MK-703": {}, "MK-704": {}, "MK-705": {}, + "MK-803": {}, "MK-804": {}, "MK-806": {}, "MK-807": {}, "MK-809": {}, + "MK-810": {}, "MK-811": {}, "MK-812": {}, "MK-813": {}, "MK-814": {}, + "MK-816": {}, "ML-1": {}, "ML-2": {}, "ML-3": {}, "ML-4": {}, + "ML-5": {}, "ML-6": {}, "ML-7": {}, "ML-8": {}, "ML-BKO": {}, + "MM-01": {}, "MM-02": {}, "MM-03": {}, "MM-04": {}, "MM-05": {}, + "MM-06": {}, "MM-07": {}, "MM-11": {}, "MM-12": {}, "MM-13": {}, + "MM-14": {}, "MM-15": {}, "MM-16": {}, "MM-17": {}, "MM-18": {}, "MN-035": {}, + "MN-037": {}, "MN-039": {}, "MN-041": {}, "MN-043": {}, "MN-046": {}, + "MN-047": {}, "MN-049": {}, "MN-051": {}, "MN-053": {}, "MN-055": {}, + "MN-057": {}, "MN-059": {}, "MN-061": {}, "MN-063": {}, "MN-064": {}, + "MN-065": {}, "MN-067": {}, "MN-069": {}, "MN-071": {}, "MN-073": {}, + "MN-1": {}, "MR-01": {}, "MR-02": {}, "MR-03": {}, "MR-04": {}, + "MR-05": {}, "MR-06": {}, "MR-07": {}, "MR-08": {}, "MR-09": {}, + "MR-10": {}, "MR-11": {}, "MR-12": {}, "MR-13": {}, "MR-NKC": {}, "MT-01": {}, + "MT-02": {}, "MT-03": {}, "MT-04": {}, "MT-05": {}, "MT-06": {}, + "MT-07": {}, "MT-08": {}, "MT-09": {}, "MT-10": {}, "MT-11": {}, + "MT-12": {}, "MT-13": {}, "MT-14": {}, "MT-15": {}, "MT-16": {}, + "MT-17": {}, "MT-18": {}, "MT-19": {}, "MT-20": {}, "MT-21": {}, + "MT-22": {}, "MT-23": {}, "MT-24": {}, "MT-25": {}, "MT-26": {}, + "MT-27": {}, "MT-28": {}, "MT-29": {}, "MT-30": {}, "MT-31": {}, + "MT-32": {}, "MT-33": {}, "MT-34": {}, "MT-35": {}, "MT-36": {}, + "MT-37": {}, "MT-38": {}, "MT-39": {}, "MT-40": {}, "MT-41": {}, + "MT-42": {}, "MT-43": {}, "MT-44": {}, "MT-45": {}, "MT-46": {}, + "MT-47": {}, "MT-48": {}, "MT-49": {}, "MT-50": {}, "MT-51": {}, + "MT-52": {}, "MT-53": {}, "MT-54": {}, "MT-55": {}, "MT-56": {}, + "MT-57": {}, "MT-58": {}, "MT-59": {}, "MT-60": {}, "MT-61": {}, + "MT-62": {}, "MT-63": {}, "MT-64": {}, "MT-65": {}, "MT-66": {}, + "MT-67": {}, "MT-68": {}, "MU-AG": {}, "MU-BL": {}, "MU-BR": {}, + "MU-CC": {}, "MU-CU": {}, "MU-FL": {}, "MU-GP": {}, "MU-MO": {}, + "MU-PA": {}, "MU-PL": {}, "MU-PU": {}, "MU-PW": {}, "MU-QB": {}, + "MU-RO": {}, "MU-RP": {}, "MU-RR": {}, "MU-SA": {}, "MU-VP": {}, "MV-00": {}, + "MV-01": {}, "MV-02": {}, "MV-03": {}, "MV-04": {}, "MV-05": {}, + "MV-07": {}, "MV-08": {}, "MV-12": {}, "MV-13": {}, "MV-14": {}, + "MV-17": {}, "MV-20": {}, "MV-23": {}, "MV-24": {}, "MV-25": {}, + "MV-26": {}, "MV-27": {}, "MV-28": {}, "MV-29": {}, "MV-CE": {}, + "MV-MLE": {}, "MV-NC": {}, "MV-NO": {}, "MV-SC": {}, "MV-SU": {}, + "MV-UN": {}, "MV-US": {}, "MW-BA": {}, "MW-BL": {}, "MW-C": {}, + "MW-CK": {}, "MW-CR": {}, "MW-CT": {}, "MW-DE": {}, "MW-DO": {}, + "MW-KR": {}, "MW-KS": {}, "MW-LI": {}, "MW-LK": {}, "MW-MC": {}, + "MW-MG": {}, "MW-MH": {}, "MW-MU": {}, "MW-MW": {}, "MW-MZ": {}, + "MW-N": {}, "MW-NB": {}, "MW-NE": {}, "MW-NI": {}, "MW-NK": {}, + "MW-NS": {}, "MW-NU": {}, "MW-PH": {}, "MW-RU": {}, "MW-S": {}, + "MW-SA": {}, "MW-TH": {}, "MW-ZO": {}, "MX-AGU": {}, "MX-BCN": {}, + "MX-BCS": {}, "MX-CAM": {}, "MX-CHH": {}, "MX-CHP": {}, "MX-COA": {}, + "MX-COL": {}, "MX-CMX": {}, "MX-DIF": {}, "MX-DUR": {}, "MX-GRO": {}, "MX-GUA": {}, + "MX-HID": {}, "MX-JAL": {}, "MX-MEX": {}, "MX-MIC": {}, "MX-MOR": {}, + "MX-NAY": {}, "MX-NLE": {}, "MX-OAX": {}, "MX-PUE": {}, "MX-QUE": {}, + "MX-ROO": {}, "MX-SIN": {}, "MX-SLP": {}, "MX-SON": {}, "MX-TAB": {}, + "MX-TAM": {}, "MX-TLA": {}, "MX-VER": {}, "MX-YUC": {}, "MX-ZAC": {}, + "MY-01": {}, "MY-02": {}, "MY-03": {}, "MY-04": {}, "MY-05": {}, + "MY-06": {}, "MY-07": {}, "MY-08": {}, "MY-09": {}, "MY-10": {}, + "MY-11": {}, "MY-12": {}, "MY-13": {}, "MY-14": {}, "MY-15": {}, + "MY-16": {}, "MZ-A": {}, "MZ-B": {}, "MZ-G": {}, "MZ-I": {}, + "MZ-L": {}, "MZ-MPM": {}, "MZ-N": {}, "MZ-P": {}, "MZ-Q": {}, + "MZ-S": {}, "MZ-T": {}, "NA-CA": {}, "NA-ER": {}, "NA-HA": {}, + "NA-KA": {}, "NA-KE": {}, "NA-KH": {}, "NA-KU": {}, "NA-KW": {}, "NA-OD": {}, "NA-OH": {}, + "NA-OK": {}, "NA-ON": {}, "NA-OS": {}, "NA-OT": {}, "NA-OW": {}, + "NE-1": {}, "NE-2": {}, "NE-3": {}, "NE-4": {}, "NE-5": {}, + "NE-6": {}, "NE-7": {}, "NE-8": {}, "NG-AB": {}, "NG-AD": {}, + "NG-AK": {}, "NG-AN": {}, "NG-BA": {}, "NG-BE": {}, "NG-BO": {}, + "NG-BY": {}, "NG-CR": {}, "NG-DE": {}, "NG-EB": {}, "NG-ED": {}, + "NG-EK": {}, "NG-EN": {}, "NG-FC": {}, "NG-GO": {}, "NG-IM": {}, + "NG-JI": {}, "NG-KD": {}, "NG-KE": {}, "NG-KN": {}, "NG-KO": {}, + "NG-KT": {}, "NG-KW": {}, "NG-LA": {}, "NG-NA": {}, "NG-NI": {}, + "NG-OG": {}, "NG-ON": {}, "NG-OS": {}, "NG-OY": {}, "NG-PL": {}, + "NG-RI": {}, "NG-SO": {}, "NG-TA": {}, "NG-YO": {}, "NG-ZA": {}, + "NI-AN": {}, "NI-AS": {}, "NI-BO": {}, "NI-CA": {}, "NI-CI": {}, + "NI-CO": {}, "NI-ES": {}, "NI-GR": {}, "NI-JI": {}, "NI-LE": {}, + "NI-MD": {}, "NI-MN": {}, "NI-MS": {}, "NI-MT": {}, "NI-NS": {}, + "NI-RI": {}, "NI-SJ": {}, "NL-AW": {}, "NL-BQ1": {}, "NL-BQ2": {}, + "NL-BQ3": {}, "NL-CW": {}, "NL-DR": {}, "NL-FL": {}, "NL-FR": {}, + "NL-GE": {}, "NL-GR": {}, "NL-LI": {}, "NL-NB": {}, "NL-NH": {}, + "NL-OV": {}, "NL-SX": {}, "NL-UT": {}, "NL-ZE": {}, "NL-ZH": {}, + "NO-03": {}, "NO-11": {}, "NO-15": {}, "NO-16": {}, "NO-17": {}, + "NO-18": {}, "NO-21": {}, "NO-30": {}, "NO-34": {}, "NO-38": {}, + "NO-42": {}, "NO-46": {}, "NO-50": {}, "NO-54": {}, + "NO-22": {}, "NP-1": {}, "NP-2": {}, "NP-3": {}, "NP-4": {}, + "NP-5": {}, "NP-BA": {}, "NP-BH": {}, "NP-DH": {}, "NP-GA": {}, + "NP-JA": {}, "NP-KA": {}, "NP-KO": {}, "NP-LU": {}, "NP-MA": {}, + "NP-ME": {}, "NP-NA": {}, "NP-RA": {}, "NP-SA": {}, "NP-SE": {}, + "NR-01": {}, "NR-02": {}, "NR-03": {}, "NR-04": {}, "NR-05": {}, + "NR-06": {}, "NR-07": {}, "NR-08": {}, "NR-09": {}, "NR-10": {}, + "NR-11": {}, "NR-12": {}, "NR-13": {}, "NR-14": {}, "NZ-AUK": {}, + "NZ-BOP": {}, "NZ-CAN": {}, "NZ-CIT": {}, "NZ-GIS": {}, "NZ-HKB": {}, + "NZ-MBH": {}, "NZ-MWT": {}, "NZ-N": {}, "NZ-NSN": {}, "NZ-NTL": {}, + "NZ-OTA": {}, "NZ-S": {}, "NZ-STL": {}, "NZ-TAS": {}, "NZ-TKI": {}, + "NZ-WGN": {}, "NZ-WKO": {}, "NZ-WTC": {}, "OM-BA": {}, "OM-BS": {}, "OM-BU": {}, "OM-BJ": {}, + "OM-DA": {}, "OM-MA": {}, "OM-MU": {}, "OM-SH": {}, "OM-SJ": {}, "OM-SS": {}, "OM-WU": {}, + "OM-ZA": {}, "OM-ZU": {}, "PA-1": {}, "PA-2": {}, "PA-3": {}, + "PA-4": {}, "PA-5": {}, "PA-6": {}, "PA-7": {}, "PA-8": {}, + "PA-9": {}, "PA-EM": {}, "PA-KY": {}, "PA-NB": {}, "PE-AMA": {}, + "PE-ANC": {}, "PE-APU": {}, "PE-ARE": {}, "PE-AYA": {}, "PE-CAJ": {}, + "PE-CAL": {}, "PE-CUS": {}, "PE-HUC": {}, "PE-HUV": {}, "PE-ICA": {}, + "PE-JUN": {}, "PE-LAL": {}, "PE-LAM": {}, "PE-LIM": {}, "PE-LMA": {}, + "PE-LOR": {}, "PE-MDD": {}, "PE-MOQ": {}, "PE-PAS": {}, "PE-PIU": {}, + "PE-PUN": {}, "PE-SAM": {}, "PE-TAC": {}, "PE-TUM": {}, "PE-UCA": {}, + "PG-CPK": {}, "PG-CPM": {}, "PG-EBR": {}, "PG-EHG": {}, "PG-EPW": {}, + "PG-ESW": {}, "PG-GPK": {}, "PG-MBA": {}, "PG-MPL": {}, "PG-MPM": {}, + "PG-MRL": {}, "PG-NCD": {}, "PG-NIK": {}, "PG-NPP": {}, "PG-NSB": {}, + "PG-SAN": {}, "PG-SHM": {}, "PG-WBK": {}, "PG-WHM": {}, "PG-WPD": {}, + "PH-00": {}, "PH-01": {}, "PH-02": {}, "PH-03": {}, "PH-05": {}, + "PH-06": {}, "PH-07": {}, "PH-08": {}, "PH-09": {}, "PH-10": {}, + "PH-11": {}, "PH-12": {}, "PH-13": {}, "PH-14": {}, "PH-15": {}, + "PH-40": {}, "PH-41": {}, "PH-ABR": {}, "PH-AGN": {}, "PH-AGS": {}, + "PH-AKL": {}, "PH-ALB": {}, "PH-ANT": {}, "PH-APA": {}, "PH-AUR": {}, + "PH-BAN": {}, "PH-BAS": {}, "PH-BEN": {}, "PH-BIL": {}, "PH-BOH": {}, + "PH-BTG": {}, "PH-BTN": {}, "PH-BUK": {}, "PH-BUL": {}, "PH-CAG": {}, + "PH-CAM": {}, "PH-CAN": {}, "PH-CAP": {}, "PH-CAS": {}, "PH-CAT": {}, + "PH-CAV": {}, "PH-CEB": {}, "PH-COM": {}, "PH-DAO": {}, "PH-DAS": {}, + "PH-DAV": {}, "PH-DIN": {}, "PH-EAS": {}, "PH-GUI": {}, "PH-IFU": {}, + "PH-ILI": {}, "PH-ILN": {}, "PH-ILS": {}, "PH-ISA": {}, "PH-KAL": {}, + "PH-LAG": {}, "PH-LAN": {}, "PH-LAS": {}, "PH-LEY": {}, "PH-LUN": {}, + "PH-MAD": {}, "PH-MAG": {}, "PH-MAS": {}, "PH-MDC": {}, "PH-MDR": {}, + "PH-MOU": {}, "PH-MSC": {}, "PH-MSR": {}, "PH-NCO": {}, "PH-NEC": {}, + "PH-NER": {}, "PH-NSA": {}, "PH-NUE": {}, "PH-NUV": {}, "PH-PAM": {}, + "PH-PAN": {}, "PH-PLW": {}, "PH-QUE": {}, "PH-QUI": {}, "PH-RIZ": {}, + "PH-ROM": {}, "PH-SAR": {}, "PH-SCO": {}, "PH-SIG": {}, "PH-SLE": {}, + "PH-SLU": {}, "PH-SOR": {}, "PH-SUK": {}, "PH-SUN": {}, "PH-SUR": {}, + "PH-TAR": {}, "PH-TAW": {}, "PH-WSA": {}, "PH-ZAN": {}, "PH-ZAS": {}, + "PH-ZMB": {}, "PH-ZSI": {}, "PK-BA": {}, "PK-GB": {}, "PK-IS": {}, + "PK-JK": {}, "PK-KP": {}, "PK-PB": {}, "PK-SD": {}, "PK-TA": {}, + "PL-02": {}, "PL-04": {}, "PL-06": {}, "PL-08": {}, "PL-10": {}, + "PL-12": {}, "PL-14": {}, "PL-16": {}, "PL-18": {}, "PL-20": {}, + "PL-22": {}, "PL-24": {}, "PL-26": {}, "PL-28": {}, "PL-30": {}, "PL-32": {}, + "PS-BTH": {}, "PS-DEB": {}, "PS-GZA": {}, "PS-HBN": {}, + "PS-JEM": {}, "PS-JEN": {}, "PS-JRH": {}, "PS-KYS": {}, "PS-NBS": {}, + "PS-NGZ": {}, "PS-QQA": {}, "PS-RBH": {}, "PS-RFH": {}, "PS-SLT": {}, + "PS-TBS": {}, "PS-TKM": {}, "PT-01": {}, "PT-02": {}, "PT-03": {}, + "PT-04": {}, "PT-05": {}, "PT-06": {}, "PT-07": {}, "PT-08": {}, + "PT-09": {}, "PT-10": {}, "PT-11": {}, "PT-12": {}, "PT-13": {}, + "PT-14": {}, "PT-15": {}, "PT-16": {}, "PT-17": {}, "PT-18": {}, + "PT-20": {}, "PT-30": {}, "PW-002": {}, "PW-004": {}, "PW-010": {}, + "PW-050": {}, "PW-100": {}, "PW-150": {}, "PW-212": {}, "PW-214": {}, + "PW-218": {}, "PW-222": {}, "PW-224": {}, "PW-226": {}, "PW-227": {}, + "PW-228": {}, "PW-350": {}, "PW-370": {}, "PY-1": {}, "PY-10": {}, + "PY-11": {}, "PY-12": {}, "PY-13": {}, "PY-14": {}, "PY-15": {}, + "PY-16": {}, "PY-19": {}, "PY-2": {}, "PY-3": {}, "PY-4": {}, + "PY-5": {}, "PY-6": {}, "PY-7": {}, "PY-8": {}, "PY-9": {}, + "PY-ASU": {}, "QA-DA": {}, "QA-KH": {}, "QA-MS": {}, "QA-RA": {}, + "QA-US": {}, "QA-WA": {}, "QA-ZA": {}, "RO-AB": {}, "RO-AG": {}, + "RO-AR": {}, "RO-B": {}, "RO-BC": {}, "RO-BH": {}, "RO-BN": {}, + "RO-BR": {}, "RO-BT": {}, "RO-BV": {}, "RO-BZ": {}, "RO-CJ": {}, + "RO-CL": {}, "RO-CS": {}, "RO-CT": {}, "RO-CV": {}, "RO-DB": {}, + "RO-DJ": {}, "RO-GJ": {}, "RO-GL": {}, "RO-GR": {}, "RO-HD": {}, + "RO-HR": {}, "RO-IF": {}, "RO-IL": {}, "RO-IS": {}, "RO-MH": {}, + "RO-MM": {}, "RO-MS": {}, "RO-NT": {}, "RO-OT": {}, "RO-PH": {}, + "RO-SB": {}, "RO-SJ": {}, "RO-SM": {}, "RO-SV": {}, "RO-TL": {}, + "RO-TM": {}, "RO-TR": {}, "RO-VL": {}, "RO-VN": {}, "RO-VS": {}, + "RS-00": {}, "RS-01": {}, "RS-02": {}, "RS-03": {}, "RS-04": {}, + "RS-05": {}, "RS-06": {}, "RS-07": {}, "RS-08": {}, "RS-09": {}, + "RS-10": {}, "RS-11": {}, "RS-12": {}, "RS-13": {}, "RS-14": {}, + "RS-15": {}, "RS-16": {}, "RS-17": {}, "RS-18": {}, "RS-19": {}, + "RS-20": {}, "RS-21": {}, "RS-22": {}, "RS-23": {}, "RS-24": {}, + "RS-25": {}, "RS-26": {}, "RS-27": {}, "RS-28": {}, "RS-29": {}, + "RS-KM": {}, "RS-VO": {}, "RU-AD": {}, "RU-AL": {}, "RU-ALT": {}, + "RU-AMU": {}, "RU-ARK": {}, "RU-AST": {}, "RU-BA": {}, "RU-BEL": {}, + "RU-BRY": {}, "RU-BU": {}, "RU-CE": {}, "RU-CHE": {}, "RU-CHU": {}, + "RU-CU": {}, "RU-DA": {}, "RU-IN": {}, "RU-IRK": {}, "RU-IVA": {}, + "RU-KAM": {}, "RU-KB": {}, "RU-KC": {}, "RU-KDA": {}, "RU-KEM": {}, + "RU-KGD": {}, "RU-KGN": {}, "RU-KHA": {}, "RU-KHM": {}, "RU-KIR": {}, + "RU-KK": {}, "RU-KL": {}, "RU-KLU": {}, "RU-KO": {}, "RU-KOS": {}, + "RU-KR": {}, "RU-KRS": {}, "RU-KYA": {}, "RU-LEN": {}, "RU-LIP": {}, + "RU-MAG": {}, "RU-ME": {}, "RU-MO": {}, "RU-MOS": {}, "RU-MOW": {}, + "RU-MUR": {}, "RU-NEN": {}, "RU-NGR": {}, "RU-NIZ": {}, "RU-NVS": {}, + "RU-OMS": {}, "RU-ORE": {}, "RU-ORL": {}, "RU-PER": {}, "RU-PNZ": {}, + "RU-PRI": {}, "RU-PSK": {}, "RU-ROS": {}, "RU-RYA": {}, "RU-SA": {}, + "RU-SAK": {}, "RU-SAM": {}, "RU-SAR": {}, "RU-SE": {}, "RU-SMO": {}, + "RU-SPE": {}, "RU-STA": {}, "RU-SVE": {}, "RU-TA": {}, "RU-TAM": {}, + "RU-TOM": {}, "RU-TUL": {}, "RU-TVE": {}, "RU-TY": {}, "RU-TYU": {}, + "RU-UD": {}, "RU-ULY": {}, "RU-VGG": {}, "RU-VLA": {}, "RU-VLG": {}, + "RU-VOR": {}, "RU-YAN": {}, "RU-YAR": {}, "RU-YEV": {}, "RU-ZAB": {}, + "RW-01": {}, "RW-02": {}, "RW-03": {}, "RW-04": {}, "RW-05": {}, + "SA-01": {}, "SA-02": {}, "SA-03": {}, "SA-04": {}, "SA-05": {}, + "SA-06": {}, "SA-07": {}, "SA-08": {}, "SA-09": {}, "SA-10": {}, + "SA-11": {}, "SA-12": {}, "SA-14": {}, "SB-CE": {}, "SB-CH": {}, + "SB-CT": {}, "SB-GU": {}, "SB-IS": {}, "SB-MK": {}, "SB-ML": {}, + "SB-RB": {}, "SB-TE": {}, "SB-WE": {}, "SC-01": {}, "SC-02": {}, + "SC-03": {}, "SC-04": {}, "SC-05": {}, "SC-06": {}, "SC-07": {}, + "SC-08": {}, "SC-09": {}, "SC-10": {}, "SC-11": {}, "SC-12": {}, + "SC-13": {}, "SC-14": {}, "SC-15": {}, "SC-16": {}, "SC-17": {}, + "SC-18": {}, "SC-19": {}, "SC-20": {}, "SC-21": {}, "SC-22": {}, + "SC-23": {}, "SC-24": {}, "SC-25": {}, "SD-DC": {}, "SD-DE": {}, + "SD-DN": {}, "SD-DS": {}, "SD-DW": {}, "SD-GD": {}, "SD-GK": {}, "SD-GZ": {}, + "SD-KA": {}, "SD-KH": {}, "SD-KN": {}, "SD-KS": {}, "SD-NB": {}, + "SD-NO": {}, "SD-NR": {}, "SD-NW": {}, "SD-RS": {}, "SD-SI": {}, + "SE-AB": {}, "SE-AC": {}, "SE-BD": {}, "SE-C": {}, "SE-D": {}, + "SE-E": {}, "SE-F": {}, "SE-G": {}, "SE-H": {}, "SE-I": {}, + "SE-K": {}, "SE-M": {}, "SE-N": {}, "SE-O": {}, "SE-S": {}, + "SE-T": {}, "SE-U": {}, "SE-W": {}, "SE-X": {}, "SE-Y": {}, + "SE-Z": {}, "SG-01": {}, "SG-02": {}, "SG-03": {}, "SG-04": {}, + "SG-05": {}, "SH-AC": {}, "SH-HL": {}, "SH-TA": {}, "SI-001": {}, + "SI-002": {}, "SI-003": {}, "SI-004": {}, "SI-005": {}, "SI-006": {}, + "SI-007": {}, "SI-008": {}, "SI-009": {}, "SI-010": {}, "SI-011": {}, + "SI-012": {}, "SI-013": {}, "SI-014": {}, "SI-015": {}, "SI-016": {}, + "SI-017": {}, "SI-018": {}, "SI-019": {}, "SI-020": {}, "SI-021": {}, + "SI-022": {}, "SI-023": {}, "SI-024": {}, "SI-025": {}, "SI-026": {}, + "SI-027": {}, "SI-028": {}, "SI-029": {}, "SI-030": {}, "SI-031": {}, + "SI-032": {}, "SI-033": {}, "SI-034": {}, "SI-035": {}, "SI-036": {}, + "SI-037": {}, "SI-038": {}, "SI-039": {}, "SI-040": {}, "SI-041": {}, + "SI-042": {}, "SI-043": {}, "SI-044": {}, "SI-045": {}, "SI-046": {}, + "SI-047": {}, "SI-048": {}, "SI-049": {}, "SI-050": {}, "SI-051": {}, + "SI-052": {}, "SI-053": {}, "SI-054": {}, "SI-055": {}, "SI-056": {}, + "SI-057": {}, "SI-058": {}, "SI-059": {}, "SI-060": {}, "SI-061": {}, + "SI-062": {}, "SI-063": {}, "SI-064": {}, "SI-065": {}, "SI-066": {}, + "SI-067": {}, "SI-068": {}, "SI-069": {}, "SI-070": {}, "SI-071": {}, + "SI-072": {}, "SI-073": {}, "SI-074": {}, "SI-075": {}, "SI-076": {}, + "SI-077": {}, "SI-078": {}, "SI-079": {}, "SI-080": {}, "SI-081": {}, + "SI-082": {}, "SI-083": {}, "SI-084": {}, "SI-085": {}, "SI-086": {}, + "SI-087": {}, "SI-088": {}, "SI-089": {}, "SI-090": {}, "SI-091": {}, + "SI-092": {}, "SI-093": {}, "SI-094": {}, "SI-095": {}, "SI-096": {}, + "SI-097": {}, "SI-098": {}, "SI-099": {}, "SI-100": {}, "SI-101": {}, + "SI-102": {}, "SI-103": {}, "SI-104": {}, "SI-105": {}, "SI-106": {}, + "SI-107": {}, "SI-108": {}, "SI-109": {}, "SI-110": {}, "SI-111": {}, + "SI-112": {}, "SI-113": {}, "SI-114": {}, "SI-115": {}, "SI-116": {}, + "SI-117": {}, "SI-118": {}, "SI-119": {}, "SI-120": {}, "SI-121": {}, + "SI-122": {}, "SI-123": {}, "SI-124": {}, "SI-125": {}, "SI-126": {}, + "SI-127": {}, "SI-128": {}, "SI-129": {}, "SI-130": {}, "SI-131": {}, + "SI-132": {}, "SI-133": {}, "SI-134": {}, "SI-135": {}, "SI-136": {}, + "SI-137": {}, "SI-138": {}, "SI-139": {}, "SI-140": {}, "SI-141": {}, + "SI-142": {}, "SI-143": {}, "SI-144": {}, "SI-146": {}, "SI-147": {}, + "SI-148": {}, "SI-149": {}, "SI-150": {}, "SI-151": {}, "SI-152": {}, + "SI-153": {}, "SI-154": {}, "SI-155": {}, "SI-156": {}, "SI-157": {}, + "SI-158": {}, "SI-159": {}, "SI-160": {}, "SI-161": {}, "SI-162": {}, + "SI-163": {}, "SI-164": {}, "SI-165": {}, "SI-166": {}, "SI-167": {}, + "SI-168": {}, "SI-169": {}, "SI-170": {}, "SI-171": {}, "SI-172": {}, + "SI-173": {}, "SI-174": {}, "SI-175": {}, "SI-176": {}, "SI-177": {}, + "SI-178": {}, "SI-179": {}, "SI-180": {}, "SI-181": {}, "SI-182": {}, + "SI-183": {}, "SI-184": {}, "SI-185": {}, "SI-186": {}, "SI-187": {}, + "SI-188": {}, "SI-189": {}, "SI-190": {}, "SI-191": {}, "SI-192": {}, + "SI-193": {}, "SI-194": {}, "SI-195": {}, "SI-196": {}, "SI-197": {}, + "SI-198": {}, "SI-199": {}, "SI-200": {}, "SI-201": {}, "SI-202": {}, + "SI-203": {}, "SI-204": {}, "SI-205": {}, "SI-206": {}, "SI-207": {}, + "SI-208": {}, "SI-209": {}, "SI-210": {}, "SI-211": {}, "SI-212": {}, "SI-213": {}, "SK-BC": {}, + "SK-BL": {}, "SK-KI": {}, "SK-NI": {}, "SK-PV": {}, "SK-TA": {}, + "SK-TC": {}, "SK-ZI": {}, "SL-E": {}, "SL-N": {}, "SL-S": {}, + "SL-W": {}, "SM-01": {}, "SM-02": {}, "SM-03": {}, "SM-04": {}, + "SM-05": {}, "SM-06": {}, "SM-07": {}, "SM-08": {}, "SM-09": {}, + "SN-DB": {}, "SN-DK": {}, "SN-FK": {}, "SN-KA": {}, "SN-KD": {}, + "SN-KE": {}, "SN-KL": {}, "SN-LG": {}, "SN-MT": {}, "SN-SE": {}, + "SN-SL": {}, "SN-TC": {}, "SN-TH": {}, "SN-ZG": {}, "SO-AW": {}, + "SO-BK": {}, "SO-BN": {}, "SO-BR": {}, "SO-BY": {}, "SO-GA": {}, + "SO-GE": {}, "SO-HI": {}, "SO-JD": {}, "SO-JH": {}, "SO-MU": {}, + "SO-NU": {}, "SO-SA": {}, "SO-SD": {}, "SO-SH": {}, "SO-SO": {}, + "SO-TO": {}, "SO-WO": {}, "SR-BR": {}, "SR-CM": {}, "SR-CR": {}, + "SR-MA": {}, "SR-NI": {}, "SR-PM": {}, "SR-PR": {}, "SR-SA": {}, + "SR-SI": {}, "SR-WA": {}, "SS-BN": {}, "SS-BW": {}, "SS-EC": {}, + "SS-EE8": {}, "SS-EE": {}, "SS-EW": {}, "SS-JG": {}, "SS-LK": {}, "SS-NU": {}, + "SS-UY": {}, "SS-WR": {}, "ST-01": {}, "ST-P": {}, "ST-S": {}, "SV-AH": {}, + "SV-CA": {}, "SV-CH": {}, "SV-CU": {}, "SV-LI": {}, "SV-MO": {}, + "SV-PA": {}, "SV-SA": {}, "SV-SM": {}, "SV-SO": {}, "SV-SS": {}, + "SV-SV": {}, "SV-UN": {}, "SV-US": {}, "SY-DI": {}, "SY-DR": {}, + "SY-DY": {}, "SY-HA": {}, "SY-HI": {}, "SY-HL": {}, "SY-HM": {}, + "SY-ID": {}, "SY-LA": {}, "SY-QU": {}, "SY-RA": {}, "SY-RD": {}, + "SY-SU": {}, "SY-TA": {}, "SZ-HH": {}, "SZ-LU": {}, "SZ-MA": {}, + "SZ-SH": {}, "TD-BA": {}, "TD-BG": {}, "TD-BO": {}, "TD-CB": {}, + "TD-EN": {}, "TD-GR": {}, "TD-HL": {}, "TD-KA": {}, "TD-LC": {}, + "TD-LO": {}, "TD-LR": {}, "TD-MA": {}, "TD-MC": {}, "TD-ME": {}, + "TD-MO": {}, "TD-ND": {}, "TD-OD": {}, "TD-SA": {}, "TD-SI": {}, + "TD-TA": {}, "TD-TI": {}, "TD-WF": {}, "TG-C": {}, "TG-K": {}, + "TG-M": {}, "TG-P": {}, "TG-S": {}, "TH-10": {}, "TH-11": {}, + "TH-12": {}, "TH-13": {}, "TH-14": {}, "TH-15": {}, "TH-16": {}, + "TH-17": {}, "TH-18": {}, "TH-19": {}, "TH-20": {}, "TH-21": {}, + "TH-22": {}, "TH-23": {}, "TH-24": {}, "TH-25": {}, "TH-26": {}, + "TH-27": {}, "TH-30": {}, "TH-31": {}, "TH-32": {}, "TH-33": {}, + "TH-34": {}, "TH-35": {}, "TH-36": {}, "TH-37": {}, "TH-38": {}, "TH-39": {}, + "TH-40": {}, "TH-41": {}, "TH-42": {}, "TH-43": {}, "TH-44": {}, + "TH-45": {}, "TH-46": {}, "TH-47": {}, "TH-48": {}, "TH-49": {}, + "TH-50": {}, "TH-51": {}, "TH-52": {}, "TH-53": {}, "TH-54": {}, + "TH-55": {}, "TH-56": {}, "TH-57": {}, "TH-58": {}, "TH-60": {}, + "TH-61": {}, "TH-62": {}, "TH-63": {}, "TH-64": {}, "TH-65": {}, + "TH-66": {}, "TH-67": {}, "TH-70": {}, "TH-71": {}, "TH-72": {}, + "TH-73": {}, "TH-74": {}, "TH-75": {}, "TH-76": {}, "TH-77": {}, + "TH-80": {}, "TH-81": {}, "TH-82": {}, "TH-83": {}, "TH-84": {}, + "TH-85": {}, "TH-86": {}, "TH-90": {}, "TH-91": {}, "TH-92": {}, + "TH-93": {}, "TH-94": {}, "TH-95": {}, "TH-96": {}, "TH-S": {}, + "TJ-GB": {}, "TJ-KT": {}, "TJ-SU": {}, "TJ-DU": {}, "TJ-RA": {}, "TL-AL": {}, "TL-AN": {}, + "TL-BA": {}, "TL-BO": {}, "TL-CO": {}, "TL-DI": {}, "TL-ER": {}, + "TL-LA": {}, "TL-LI": {}, "TL-MF": {}, "TL-MT": {}, "TL-OE": {}, + "TL-VI": {}, "TM-A": {}, "TM-B": {}, "TM-D": {}, "TM-L": {}, + "TM-M": {}, "TM-S": {}, "TN-11": {}, "TN-12": {}, "TN-13": {}, + "TN-14": {}, "TN-21": {}, "TN-22": {}, "TN-23": {}, "TN-31": {}, + "TN-32": {}, "TN-33": {}, "TN-34": {}, "TN-41": {}, "TN-42": {}, + "TN-43": {}, "TN-51": {}, "TN-52": {}, "TN-53": {}, "TN-61": {}, + "TN-71": {}, "TN-72": {}, "TN-73": {}, "TN-81": {}, "TN-82": {}, + "TN-83": {}, "TO-01": {}, "TO-02": {}, "TO-03": {}, "TO-04": {}, + "TO-05": {}, "TR-01": {}, "TR-02": {}, "TR-03": {}, "TR-04": {}, + "TR-05": {}, "TR-06": {}, "TR-07": {}, "TR-08": {}, "TR-09": {}, + "TR-10": {}, "TR-11": {}, "TR-12": {}, "TR-13": {}, "TR-14": {}, + "TR-15": {}, "TR-16": {}, "TR-17": {}, "TR-18": {}, "TR-19": {}, + "TR-20": {}, "TR-21": {}, "TR-22": {}, "TR-23": {}, "TR-24": {}, + "TR-25": {}, "TR-26": {}, "TR-27": {}, "TR-28": {}, "TR-29": {}, + "TR-30": {}, "TR-31": {}, "TR-32": {}, "TR-33": {}, "TR-34": {}, + "TR-35": {}, "TR-36": {}, "TR-37": {}, "TR-38": {}, "TR-39": {}, + "TR-40": {}, "TR-41": {}, "TR-42": {}, "TR-43": {}, "TR-44": {}, + "TR-45": {}, "TR-46": {}, "TR-47": {}, "TR-48": {}, "TR-49": {}, + "TR-50": {}, "TR-51": {}, "TR-52": {}, "TR-53": {}, "TR-54": {}, + "TR-55": {}, "TR-56": {}, "TR-57": {}, "TR-58": {}, "TR-59": {}, + "TR-60": {}, "TR-61": {}, "TR-62": {}, "TR-63": {}, "TR-64": {}, + "TR-65": {}, "TR-66": {}, "TR-67": {}, "TR-68": {}, "TR-69": {}, + "TR-70": {}, "TR-71": {}, "TR-72": {}, "TR-73": {}, "TR-74": {}, + "TR-75": {}, "TR-76": {}, "TR-77": {}, "TR-78": {}, "TR-79": {}, + "TR-80": {}, "TR-81": {}, "TT-ARI": {}, "TT-CHA": {}, "TT-CTT": {}, + "TT-DMN": {}, "TT-ETO": {}, "TT-MRC": {}, "TT-TOB": {}, "TT-PED": {}, "TT-POS": {}, "TT-PRT": {}, + "TT-PTF": {}, "TT-RCM": {}, "TT-SFO": {}, "TT-SGE": {}, "TT-SIP": {}, + "TT-SJL": {}, "TT-TUP": {}, "TT-WTO": {}, "TV-FUN": {}, "TV-NIT": {}, + "TV-NKF": {}, "TV-NKL": {}, "TV-NMA": {}, "TV-NMG": {}, "TV-NUI": {}, + "TV-VAI": {}, "TW-CHA": {}, "TW-CYI": {}, "TW-CYQ": {}, "TW-KIN": {}, "TW-HSQ": {}, + "TW-HSZ": {}, "TW-HUA": {}, "TW-LIE": {}, "TW-ILA": {}, "TW-KEE": {}, "TW-KHH": {}, + "TW-KHQ": {}, "TW-MIA": {}, "TW-NAN": {}, "TW-NWT": {}, "TW-PEN": {}, "TW-PIF": {}, + "TW-TAO": {}, "TW-TNN": {}, "TW-TNQ": {}, "TW-TPE": {}, "TW-TPQ": {}, + "TW-TTT": {}, "TW-TXG": {}, "TW-TXQ": {}, "TW-YUN": {}, "TZ-01": {}, + "TZ-02": {}, "TZ-03": {}, "TZ-04": {}, "TZ-05": {}, "TZ-06": {}, + "TZ-07": {}, "TZ-08": {}, "TZ-09": {}, "TZ-10": {}, "TZ-11": {}, + "TZ-12": {}, "TZ-13": {}, "TZ-14": {}, "TZ-15": {}, "TZ-16": {}, + "TZ-17": {}, "TZ-18": {}, "TZ-19": {}, "TZ-20": {}, "TZ-21": {}, + "TZ-22": {}, "TZ-23": {}, "TZ-24": {}, "TZ-25": {}, "TZ-26": {}, "TZ-27": {}, "TZ-28": {}, "TZ-29": {}, "TZ-30": {}, "TZ-31": {}, + "UA-05": {}, "UA-07": {}, "UA-09": {}, "UA-12": {}, "UA-14": {}, + "UA-18": {}, "UA-21": {}, "UA-23": {}, "UA-26": {}, "UA-30": {}, + "UA-32": {}, "UA-35": {}, "UA-40": {}, "UA-43": {}, "UA-46": {}, + "UA-48": {}, "UA-51": {}, "UA-53": {}, "UA-56": {}, "UA-59": {}, + "UA-61": {}, "UA-63": {}, "UA-65": {}, "UA-68": {}, "UA-71": {}, + "UA-74": {}, "UA-77": {}, "UG-101": {}, "UG-102": {}, "UG-103": {}, + "UG-104": {}, "UG-105": {}, "UG-106": {}, "UG-107": {}, "UG-108": {}, + "UG-109": {}, "UG-110": {}, "UG-111": {}, "UG-112": {}, "UG-113": {}, + "UG-114": {}, "UG-115": {}, "UG-116": {}, "UG-201": {}, "UG-202": {}, + "UG-203": {}, "UG-204": {}, "UG-205": {}, "UG-206": {}, "UG-207": {}, + "UG-208": {}, "UG-209": {}, "UG-210": {}, "UG-211": {}, "UG-212": {}, + "UG-213": {}, "UG-214": {}, "UG-215": {}, "UG-216": {}, "UG-217": {}, + "UG-218": {}, "UG-219": {}, "UG-220": {}, "UG-221": {}, "UG-222": {}, + "UG-223": {}, "UG-224": {}, "UG-301": {}, "UG-302": {}, "UG-303": {}, + "UG-304": {}, "UG-305": {}, "UG-306": {}, "UG-307": {}, "UG-308": {}, + "UG-309": {}, "UG-310": {}, "UG-311": {}, "UG-312": {}, "UG-313": {}, + "UG-314": {}, "UG-315": {}, "UG-316": {}, "UG-317": {}, "UG-318": {}, + "UG-319": {}, "UG-320": {}, "UG-321": {}, "UG-401": {}, "UG-402": {}, + "UG-403": {}, "UG-404": {}, "UG-405": {}, "UG-406": {}, "UG-407": {}, + "UG-408": {}, "UG-409": {}, "UG-410": {}, "UG-411": {}, "UG-412": {}, + "UG-413": {}, "UG-414": {}, "UG-415": {}, "UG-416": {}, "UG-417": {}, + "UG-418": {}, "UG-419": {}, "UG-C": {}, "UG-E": {}, "UG-N": {}, + "UG-W": {}, "UG-322": {}, "UG-323": {}, "UG-420": {}, "UG-117": {}, + "UG-118": {}, "UG-225": {}, "UG-120": {}, "UG-226": {}, + "UG-121": {}, "UG-122": {}, "UG-227": {}, "UG-421": {}, + "UG-325": {}, "UG-228": {}, "UG-123": {}, "UG-422": {}, + "UG-326": {}, "UG-229": {}, "UG-124": {}, "UG-423": {}, + "UG-230": {}, "UG-327": {}, "UG-424": {}, "UG-328": {}, + "UG-425": {}, "UG-426": {}, "UG-330": {}, + "UM-67": {}, "UM-71": {}, "UM-76": {}, "UM-79": {}, + "UM-81": {}, "UM-84": {}, "UM-86": {}, "UM-89": {}, "UM-95": {}, + "US-AK": {}, "US-AL": {}, "US-AR": {}, "US-AS": {}, "US-AZ": {}, + "US-CA": {}, "US-CO": {}, "US-CT": {}, "US-DC": {}, "US-DE": {}, + "US-FL": {}, "US-GA": {}, "US-GU": {}, "US-HI": {}, "US-IA": {}, + "US-ID": {}, "US-IL": {}, "US-IN": {}, "US-KS": {}, "US-KY": {}, + "US-LA": {}, "US-MA": {}, "US-MD": {}, "US-ME": {}, "US-MI": {}, + "US-MN": {}, "US-MO": {}, "US-MP": {}, "US-MS": {}, "US-MT": {}, + "US-NC": {}, "US-ND": {}, "US-NE": {}, "US-NH": {}, "US-NJ": {}, + "US-NM": {}, "US-NV": {}, "US-NY": {}, "US-OH": {}, "US-OK": {}, + "US-OR": {}, "US-PA": {}, "US-PR": {}, "US-RI": {}, "US-SC": {}, + "US-SD": {}, "US-TN": {}, "US-TX": {}, "US-UM": {}, "US-UT": {}, + "US-VA": {}, "US-VI": {}, "US-VT": {}, "US-WA": {}, "US-WI": {}, + "US-WV": {}, "US-WY": {}, "UY-AR": {}, "UY-CA": {}, "UY-CL": {}, + "UY-CO": {}, "UY-DU": {}, "UY-FD": {}, "UY-FS": {}, "UY-LA": {}, + "UY-MA": {}, "UY-MO": {}, "UY-PA": {}, "UY-RN": {}, "UY-RO": {}, + "UY-RV": {}, "UY-SA": {}, "UY-SJ": {}, "UY-SO": {}, "UY-TA": {}, + "UY-TT": {}, "UZ-AN": {}, "UZ-BU": {}, "UZ-FA": {}, "UZ-JI": {}, + "UZ-NG": {}, "UZ-NW": {}, "UZ-QA": {}, "UZ-QR": {}, "UZ-SA": {}, + "UZ-SI": {}, "UZ-SU": {}, "UZ-TK": {}, "UZ-TO": {}, "UZ-XO": {}, + "VC-01": {}, "VC-02": {}, "VC-03": {}, "VC-04": {}, "VC-05": {}, + "VC-06": {}, "VE-A": {}, "VE-B": {}, "VE-C": {}, "VE-D": {}, + "VE-E": {}, "VE-F": {}, "VE-G": {}, "VE-H": {}, "VE-I": {}, + "VE-J": {}, "VE-K": {}, "VE-L": {}, "VE-M": {}, "VE-N": {}, + "VE-O": {}, "VE-P": {}, "VE-R": {}, "VE-S": {}, "VE-T": {}, + "VE-U": {}, "VE-V": {}, "VE-W": {}, "VE-X": {}, "VE-Y": {}, + "VE-Z": {}, "VN-01": {}, "VN-02": {}, "VN-03": {}, "VN-04": {}, + "VN-05": {}, "VN-06": {}, "VN-07": {}, "VN-09": {}, "VN-13": {}, + "VN-14": {}, "VN-15": {}, "VN-18": {}, "VN-20": {}, "VN-21": {}, + "VN-22": {}, "VN-23": {}, "VN-24": {}, "VN-25": {}, "VN-26": {}, + "VN-27": {}, "VN-28": {}, "VN-29": {}, "VN-30": {}, "VN-31": {}, + "VN-32": {}, "VN-33": {}, "VN-34": {}, "VN-35": {}, "VN-36": {}, + "VN-37": {}, "VN-39": {}, "VN-40": {}, "VN-41": {}, "VN-43": {}, + "VN-44": {}, "VN-45": {}, "VN-46": {}, "VN-47": {}, "VN-49": {}, + "VN-50": {}, "VN-51": {}, "VN-52": {}, "VN-53": {}, "VN-54": {}, + "VN-55": {}, "VN-56": {}, "VN-57": {}, "VN-58": {}, "VN-59": {}, + "VN-61": {}, "VN-63": {}, "VN-66": {}, "VN-67": {}, "VN-68": {}, + "VN-69": {}, "VN-70": {}, "VN-71": {}, "VN-72": {}, "VN-73": {}, + "VN-CT": {}, "VN-DN": {}, "VN-HN": {}, "VN-HP": {}, "VN-SG": {}, + "VU-MAP": {}, "VU-PAM": {}, "VU-SAM": {}, "VU-SEE": {}, "VU-TAE": {}, + "VU-TOB": {}, "WF-SG": {}, "WF-UV": {}, "WS-AA": {}, "WS-AL": {}, "WS-AT": {}, "WS-FA": {}, + "WS-GE": {}, "WS-GI": {}, "WS-PA": {}, "WS-SA": {}, "WS-TU": {}, + "WS-VF": {}, "WS-VS": {}, "YE-AB": {}, "YE-AD": {}, "YE-AM": {}, + "YE-BA": {}, "YE-DA": {}, "YE-DH": {}, "YE-HD": {}, "YE-HJ": {}, "YE-HU": {}, + "YE-IB": {}, "YE-JA": {}, "YE-LA": {}, "YE-MA": {}, "YE-MR": {}, + "YE-MU": {}, "YE-MW": {}, "YE-RA": {}, "YE-SA": {}, "YE-SD": {}, "YE-SH": {}, + "YE-SN": {}, "YE-TA": {}, "ZA-EC": {}, "ZA-FS": {}, "ZA-GP": {}, + "ZA-LP": {}, "ZA-MP": {}, "ZA-NC": {}, "ZA-NW": {}, "ZA-WC": {}, + "ZA-ZN": {}, "ZA-KZN": {}, "ZM-01": {}, "ZM-02": {}, "ZM-03": {}, "ZM-04": {}, + "ZM-05": {}, "ZM-06": {}, "ZM-07": {}, "ZM-08": {}, "ZM-09": {}, "ZM-10": {}, + "ZW-BU": {}, "ZW-HA": {}, "ZW-MA": {}, "ZW-MC": {}, "ZW-ME": {}, + "ZW-MI": {}, "ZW-MN": {}, "ZW-MS": {}, "ZW-MV": {}, "ZW-MW": {}, } diff --git a/vendor/github.com/go-playground/validator/v10/currency_codes.go b/vendor/github.com/go-playground/validator/v10/currency_codes.go index a5cd9b18..d0317f89 100644 --- a/vendor/github.com/go-playground/validator/v10/currency_codes.go +++ b/vendor/github.com/go-playground/validator/v10/currency_codes.go @@ -1,79 +1,79 @@ package validator -var iso4217 = map[string]bool{ - "AFN": true, "EUR": true, "ALL": true, "DZD": true, "USD": true, - "AOA": true, "XCD": true, "ARS": true, "AMD": true, "AWG": true, - "AUD": true, "AZN": true, "BSD": true, "BHD": true, "BDT": true, - "BBD": true, "BYN": true, "BZD": true, "XOF": true, "BMD": true, - "INR": true, "BTN": true, "BOB": true, "BOV": true, "BAM": true, - "BWP": true, "NOK": true, "BRL": true, "BND": true, "BGN": true, - "BIF": true, "CVE": true, "KHR": true, "XAF": true, "CAD": true, - "KYD": true, "CLP": true, "CLF": true, "CNY": true, "COP": true, - "COU": true, "KMF": true, "CDF": true, "NZD": true, "CRC": true, - "HRK": true, "CUP": true, "CUC": true, "ANG": true, "CZK": true, - "DKK": true, "DJF": true, "DOP": true, "EGP": true, "SVC": true, - "ERN": true, "SZL": true, "ETB": true, "FKP": true, "FJD": true, - "XPF": true, "GMD": true, "GEL": true, "GHS": true, "GIP": true, - "GTQ": true, "GBP": true, "GNF": true, "GYD": true, "HTG": true, - "HNL": true, "HKD": true, "HUF": true, "ISK": true, "IDR": true, - "XDR": true, "IRR": true, "IQD": true, "ILS": true, "JMD": true, - "JPY": true, "JOD": true, "KZT": true, "KES": true, "KPW": true, - "KRW": true, "KWD": true, "KGS": true, "LAK": true, "LBP": true, - "LSL": true, "ZAR": true, "LRD": true, "LYD": true, "CHF": true, - "MOP": true, "MKD": true, "MGA": true, "MWK": true, "MYR": true, - "MVR": true, "MRU": true, "MUR": true, "XUA": true, "MXN": true, - "MXV": true, "MDL": true, "MNT": true, "MAD": true, "MZN": true, - "MMK": true, "NAD": true, "NPR": true, "NIO": true, "NGN": true, - "OMR": true, "PKR": true, "PAB": true, "PGK": true, "PYG": true, - "PEN": true, "PHP": true, "PLN": true, "QAR": true, "RON": true, - "RUB": true, "RWF": true, "SHP": true, "WST": true, "STN": true, - "SAR": true, "RSD": true, "SCR": true, "SLL": true, "SGD": true, - "XSU": true, "SBD": true, "SOS": true, "SSP": true, "LKR": true, - "SDG": true, "SRD": true, "SEK": true, "CHE": true, "CHW": true, - "SYP": true, "TWD": true, "TJS": true, "TZS": true, "THB": true, - "TOP": true, "TTD": true, "TND": true, "TRY": true, "TMT": true, - "UGX": true, "UAH": true, "AED": true, "USN": true, "UYU": true, - "UYI": true, "UYW": true, "UZS": true, "VUV": true, "VES": true, - "VND": true, "YER": true, "ZMW": true, "ZWL": true, "XBA": true, - "XBB": true, "XBC": true, "XBD": true, "XTS": true, "XXX": true, - "XAU": true, "XPD": true, "XPT": true, "XAG": true, +var iso4217 = map[string]struct{}{ + "AFN": {}, "EUR": {}, "ALL": {}, "DZD": {}, "USD": {}, + "AOA": {}, "XCD": {}, "ARS": {}, "AMD": {}, "AWG": {}, + "AUD": {}, "AZN": {}, "BSD": {}, "BHD": {}, "BDT": {}, + "BBD": {}, "BYN": {}, "BZD": {}, "XOF": {}, "BMD": {}, + "INR": {}, "BTN": {}, "BOB": {}, "BOV": {}, "BAM": {}, + "BWP": {}, "NOK": {}, "BRL": {}, "BND": {}, "BGN": {}, + "BIF": {}, "CVE": {}, "KHR": {}, "XAF": {}, "CAD": {}, + "KYD": {}, "CLP": {}, "CLF": {}, "CNY": {}, "COP": {}, + "COU": {}, "KMF": {}, "CDF": {}, "NZD": {}, "CRC": {}, + "HRK": {}, "CUP": {}, "CUC": {}, "ANG": {}, "CZK": {}, + "DKK": {}, "DJF": {}, "DOP": {}, "EGP": {}, "SVC": {}, + "ERN": {}, "SZL": {}, "ETB": {}, "FKP": {}, "FJD": {}, + "XPF": {}, "GMD": {}, "GEL": {}, "GHS": {}, "GIP": {}, + "GTQ": {}, "GBP": {}, "GNF": {}, "GYD": {}, "HTG": {}, + "HNL": {}, "HKD": {}, "HUF": {}, "ISK": {}, "IDR": {}, + "XDR": {}, "IRR": {}, "IQD": {}, "ILS": {}, "JMD": {}, + "JPY": {}, "JOD": {}, "KZT": {}, "KES": {}, "KPW": {}, + "KRW": {}, "KWD": {}, "KGS": {}, "LAK": {}, "LBP": {}, + "LSL": {}, "ZAR": {}, "LRD": {}, "LYD": {}, "CHF": {}, + "MOP": {}, "MKD": {}, "MGA": {}, "MWK": {}, "MYR": {}, + "MVR": {}, "MRU": {}, "MUR": {}, "XUA": {}, "MXN": {}, + "MXV": {}, "MDL": {}, "MNT": {}, "MAD": {}, "MZN": {}, + "MMK": {}, "NAD": {}, "NPR": {}, "NIO": {}, "NGN": {}, + "OMR": {}, "PKR": {}, "PAB": {}, "PGK": {}, "PYG": {}, + "PEN": {}, "PHP": {}, "PLN": {}, "QAR": {}, "RON": {}, + "RUB": {}, "RWF": {}, "SHP": {}, "WST": {}, "STN": {}, + "SAR": {}, "RSD": {}, "SCR": {}, "SLL": {}, "SGD": {}, + "XSU": {}, "SBD": {}, "SOS": {}, "SSP": {}, "LKR": {}, + "SDG": {}, "SRD": {}, "SEK": {}, "CHE": {}, "CHW": {}, + "SYP": {}, "TWD": {}, "TJS": {}, "TZS": {}, "THB": {}, + "TOP": {}, "TTD": {}, "TND": {}, "TRY": {}, "TMT": {}, + "UGX": {}, "UAH": {}, "AED": {}, "USN": {}, "UYU": {}, + "UYI": {}, "UYW": {}, "UZS": {}, "VUV": {}, "VES": {}, + "VND": {}, "YER": {}, "ZMW": {}, "ZWL": {}, "XBA": {}, + "XBB": {}, "XBC": {}, "XBD": {}, "XTS": {}, "XXX": {}, + "XAU": {}, "XPD": {}, "XPT": {}, "XAG": {}, } -var iso4217_numeric = map[int]bool{ - 8: true, 12: true, 32: true, 36: true, 44: true, - 48: true, 50: true, 51: true, 52: true, 60: true, - 64: true, 68: true, 72: true, 84: true, 90: true, - 96: true, 104: true, 108: true, 116: true, 124: true, - 132: true, 136: true, 144: true, 152: true, 156: true, - 170: true, 174: true, 188: true, 191: true, 192: true, - 203: true, 208: true, 214: true, 222: true, 230: true, - 232: true, 238: true, 242: true, 262: true, 270: true, - 292: true, 320: true, 324: true, 328: true, 332: true, - 340: true, 344: true, 348: true, 352: true, 356: true, - 360: true, 364: true, 368: true, 376: true, 388: true, - 392: true, 398: true, 400: true, 404: true, 408: true, - 410: true, 414: true, 417: true, 418: true, 422: true, - 426: true, 430: true, 434: true, 446: true, 454: true, - 458: true, 462: true, 480: true, 484: true, 496: true, - 498: true, 504: true, 512: true, 516: true, 524: true, - 532: true, 533: true, 548: true, 554: true, 558: true, - 566: true, 578: true, 586: true, 590: true, 598: true, - 600: true, 604: true, 608: true, 634: true, 643: true, - 646: true, 654: true, 682: true, 690: true, 694: true, - 702: true, 704: true, 706: true, 710: true, 728: true, - 748: true, 752: true, 756: true, 760: true, 764: true, - 776: true, 780: true, 784: true, 788: true, 800: true, - 807: true, 818: true, 826: true, 834: true, 840: true, - 858: true, 860: true, 882: true, 886: true, 901: true, - 927: true, 928: true, 929: true, 930: true, 931: true, - 932: true, 933: true, 934: true, 936: true, 938: true, - 940: true, 941: true, 943: true, 944: true, 946: true, - 947: true, 948: true, 949: true, 950: true, 951: true, - 952: true, 953: true, 955: true, 956: true, 957: true, - 958: true, 959: true, 960: true, 961: true, 962: true, - 963: true, 964: true, 965: true, 967: true, 968: true, - 969: true, 970: true, 971: true, 972: true, 973: true, - 975: true, 976: true, 977: true, 978: true, 979: true, - 980: true, 981: true, 984: true, 985: true, 986: true, - 990: true, 994: true, 997: true, 999: true, +var iso4217_numeric = map[int]struct{}{ + 8: {}, 12: {}, 32: {}, 36: {}, 44: {}, + 48: {}, 50: {}, 51: {}, 52: {}, 60: {}, + 64: {}, 68: {}, 72: {}, 84: {}, 90: {}, + 96: {}, 104: {}, 108: {}, 116: {}, 124: {}, + 132: {}, 136: {}, 144: {}, 152: {}, 156: {}, + 170: {}, 174: {}, 188: {}, 191: {}, 192: {}, + 203: {}, 208: {}, 214: {}, 222: {}, 230: {}, + 232: {}, 238: {}, 242: {}, 262: {}, 270: {}, + 292: {}, 320: {}, 324: {}, 328: {}, 332: {}, + 340: {}, 344: {}, 348: {}, 352: {}, 356: {}, + 360: {}, 364: {}, 368: {}, 376: {}, 388: {}, + 392: {}, 398: {}, 400: {}, 404: {}, 408: {}, + 410: {}, 414: {}, 417: {}, 418: {}, 422: {}, + 426: {}, 430: {}, 434: {}, 446: {}, 454: {}, + 458: {}, 462: {}, 480: {}, 484: {}, 496: {}, + 498: {}, 504: {}, 512: {}, 516: {}, 524: {}, + 532: {}, 533: {}, 548: {}, 554: {}, 558: {}, + 566: {}, 578: {}, 586: {}, 590: {}, 598: {}, + 600: {}, 604: {}, 608: {}, 634: {}, 643: {}, + 646: {}, 654: {}, 682: {}, 690: {}, 694: {}, + 702: {}, 704: {}, 706: {}, 710: {}, 728: {}, + 748: {}, 752: {}, 756: {}, 760: {}, 764: {}, + 776: {}, 780: {}, 784: {}, 788: {}, 800: {}, + 807: {}, 818: {}, 826: {}, 834: {}, 840: {}, + 858: {}, 860: {}, 882: {}, 886: {}, 901: {}, + 927: {}, 928: {}, 929: {}, 930: {}, 931: {}, + 932: {}, 933: {}, 934: {}, 936: {}, 938: {}, + 940: {}, 941: {}, 943: {}, 944: {}, 946: {}, + 947: {}, 948: {}, 949: {}, 950: {}, 951: {}, + 952: {}, 953: {}, 955: {}, 956: {}, 957: {}, + 958: {}, 959: {}, 960: {}, 961: {}, 962: {}, + 963: {}, 964: {}, 965: {}, 967: {}, 968: {}, + 969: {}, 970: {}, 971: {}, 972: {}, 973: {}, + 975: {}, 976: {}, 977: {}, 978: {}, 979: {}, + 980: {}, 981: {}, 984: {}, 985: {}, 986: {}, + 990: {}, 994: {}, 997: {}, 999: {}, } diff --git a/vendor/github.com/go-playground/validator/v10/doc.go b/vendor/github.com/go-playground/validator/v10/doc.go index b284c379..e7a241fb 100644 --- a/vendor/github.com/go-playground/validator/v10/doc.go +++ b/vendor/github.com/go-playground/validator/v10/doc.go @@ -7,7 +7,7 @@ and has the ability to dive into arrays and maps of any type. see more examples https://github.com/go-playground/validator/tree/master/_examples -Singleton +# Singleton Validator is designed to be thread-safe and used as a singleton instance. It caches information about your struct and validations, @@ -15,7 +15,7 @@ in essence only parsing your validation tags once per struct type. Using multiple instances neglects the benefit of caching. The not thread-safe functions are explicitly marked as such in the documentation. -Validation Functions Return Type error +# Validation Functions Return Type error Doing things this way is actually the way the standard library does, see the file.Open method here: @@ -34,7 +34,7 @@ if the error returned is not nil, and if it's not check if error is InvalidValidationError ( if necessary, most of the time it isn't ) type cast it to type ValidationErrors like so err.(validator.ValidationErrors). -Custom Validation Functions +# Custom Validation Functions Custom Validation functions can be added. Example: @@ -52,21 +52,21 @@ Custom Validation functions can be added. Example: // NOTES: using the same tag name as an existing function // will overwrite the existing one -Cross-Field Validation +# Cross-Field Validation Cross-Field Validation can be done via the following tags: - - eqfield - - nefield - - gtfield - - gtefield - - ltfield - - ltefield - - eqcsfield - - necsfield - - gtcsfield - - gtecsfield - - ltcsfield - - ltecsfield + - eqfield + - nefield + - gtfield + - gtefield + - ltfield + - ltefield + - eqcsfield + - necsfield + - gtcsfield + - gtecsfield + - ltcsfield + - ltecsfield If, however, some custom cross-field validation is required, it can be done using a custom validation. @@ -106,7 +106,7 @@ used "eqcsfield" it could be multiple levels down. Example: // whatever you pass, struct, field... // when calling validate.Field(field, tag) val will be nil -Multiple Validators +# Multiple Validators Multiple validators on a field will process in the order defined. Example: @@ -124,7 +124,7 @@ Bad Validator definitions are not handled by the library. Example: // this definition of min max will never succeed -Using Validator Tags +# Using Validator Tags Baked In Cross-Field validation only compares fields on the same struct. If Cross-Field + Cross-Struct validation is needed you should implement your @@ -146,24 +146,22 @@ use the UTF-8 hex representation 0x7C, which is replaced in the code as a pipe, so the above will become excludesall=0x7C type Test struct { - Field `validate:"excludesall=|"` // BAD! Do not include a a pipe! + Field `validate:"excludesall=|"` // BAD! Do not include a pipe! Field `validate:"excludesall=0x7C"` // GOOD! Use the UTF-8 hex representation. } - -Baked In Validators and Tags +# Baked In Validators and Tags Here is a list of the current built in validators: - -Skip Field +# Skip Field Tells the validation to skip this struct field; this is particularly handy in ignoring embedded structs from being validated. (Usage: -) - Usage: - + Usage: - -Or Operator +# Or Operator This is the 'or' operator allowing multiple validators to be used and accepted. (Usage: rgb|rgba) <-- this would allow either rgb or rgba @@ -172,7 +170,7 @@ colors to be accepted. This can also be combined with 'and' for example Usage: | -StructOnly +# StructOnly When a field that is a nested struct is encountered, and contains this flag any validation on the nested struct will be run, but none of the nested @@ -182,13 +180,13 @@ NOTE: only "required" and "omitempty" can be used on a struct itself. Usage: structonly -NoStructLevel +# NoStructLevel Same as structonly tag except that any struct level validations will not run. Usage: nostructlevel -Omit Empty +# Omit Empty Allows conditional validation, for example if a field is not set with a value (Determined by the "required" validator) then other validation @@ -196,7 +194,14 @@ such as min or max won't run, but if a value is set validation will run. Usage: omitempty -Dive +# Omit Nil + +Allows to skip the validation if the value is nil (same as omitempty, but +only for the nil-values). + + Usage: omitnil + +# Dive This tells the validator to dive into a slice, array or map and validate that level of the slice, array or map with the validation tags that follow. @@ -232,33 +237,33 @@ require another 'keys' and 'endkeys' tag. These tags are only valid for maps. Example #1 - map[string]string with validation tag "gt=0,dive,keys,eg=1|eq=2,endkeys,required" + map[string]string with validation tag "gt=0,dive,keys,eq=1|eq=2,endkeys,required" // gt=0 will be applied to the map itself - // eg=1|eq=2 will be applied to the map keys + // eq=1|eq=2 will be applied to the map keys // required will be applied to map values Example #2 map[[2]string]string with validation tag "gt=0,dive,keys,dive,eq=1|eq=2,endkeys,required" // gt=0 will be applied to the map itself - // eg=1|eq=2 will be applied to each array element in the the map keys + // eq=1|eq=2 will be applied to each array element in the map keys // required will be applied to map values -Required +# Required This validates that the value is not the data types default zero value. For numbers ensures value is not zero. For strings ensures value is -not "". For slices, maps, pointers, interfaces, channels and functions -ensures the value is not nil. +not "". For booleans ensures value is not false. For slices, maps, pointers, interfaces, channels and functions +ensures the value is not nil. For structs ensures value is not the zero value when using WithRequiredStructEnabled. Usage: required -Required If +# Required If The field under validation must be present and not empty only if all the other specified fields are equal to the value following the specified field. For strings ensures value is not "". For slices, maps, pointers, -interfaces, channels and functions ensures the value is not nil. +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. Usage: required_if @@ -270,12 +275,12 @@ Examples: // require the field if the Field1 and Field2 is equal to the value respectively: Usage: required_if=Field1 foo Field2 bar -Required Unless +# Required Unless The field under validation must be present and not empty unless all the other specified fields are equal to the value following the specified field. For strings ensures value is not "". For slices, maps, pointers, -interfaces, channels and functions ensures the value is not nil. +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. Usage: required_unless @@ -287,12 +292,12 @@ Examples: // require the field unless the Field1 and Field2 is equal to the value respectively: Usage: required_unless=Field1 foo Field2 bar -Required With +# Required With The field under validation must be present and not empty only if any of the other specified fields are present. For strings ensures value is not "". For slices, maps, pointers, interfaces, channels and functions -ensures the value is not nil. +ensures the value is not nil. For structs ensures value is not the zero value. Usage: required_with @@ -304,12 +309,12 @@ Examples: // require the field if the Field1 or Field2 is present: Usage: required_with=Field1 Field2 -Required With All +# Required With All The field under validation must be present and not empty only if all of the other specified fields are present. For strings ensures value is not "". For slices, maps, pointers, interfaces, channels and functions -ensures the value is not nil. +ensures the value is not nil. For structs ensures value is not the zero value. Usage: required_with_all @@ -318,12 +323,12 @@ Example: // require the field if the Field1 and Field2 is present: Usage: required_with_all=Field1 Field2 -Required Without +# Required Without The field under validation must be present and not empty only when any of the other specified fields are not present. For strings ensures value is not "". For slices, maps, pointers, interfaces, channels and functions -ensures the value is not nil. +ensures the value is not nil. For structs ensures value is not the zero value. Usage: required_without @@ -335,12 +340,12 @@ Examples: // require the field if the Field1 or Field2 is not present: Usage: required_without=Field1 Field2 -Required Without All +# Required Without All The field under validation must be present and not empty only when all of the other specified fields are not present. For strings ensures value is not "". For slices, maps, pointers, interfaces, channels and functions -ensures the value is not nil. +ensures the value is not nil. For structs ensures value is not the zero value. Usage: required_without_all @@ -349,14 +354,48 @@ Example: // require the field if the Field1 and Field2 is not present: Usage: required_without_all=Field1 Field2 -Is Default +# Excluded If + +The field under validation must not be present or not empty only if all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: excluded_if + +Examples: + + // exclude the field if the Field1 is equal to the parameter given: + Usage: excluded_if=Field1 foobar + + // exclude the field if the Field1 and Field2 is equal to the value respectively: + Usage: excluded_if=Field1 foo Field2 bar + +# Excluded Unless + +The field under validation must not be present or empty unless all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: excluded_unless + +Examples: + + // exclude the field unless the Field1 is equal to the parameter given: + Usage: excluded_unless=Field1 foobar + + // exclude the field unless the Field1 and Field2 is equal to the value respectively: + Usage: excluded_unless=Field1 foo Field2 bar + +# Is Default This validates that the value is the default value and is almost the opposite of required. Usage: isdefault -Length +# Length For numbers, length will ensure that the value is equal to the parameter given. For strings, it checks that @@ -374,7 +413,7 @@ in the parameter. Usage: len=1h30m -Maximum +# Maximum For numbers, max will ensure that the value is less than or equal to the parameter given. For strings, it checks @@ -392,7 +431,7 @@ duration given in the parameter. Usage: max=1h30m -Minimum +# Minimum For numbers, min will ensure that the value is greater or equal to the parameter given. For strings, it checks that @@ -410,7 +449,7 @@ the duration given in the parameter. Usage: min=1h30m -Equals +# Equals For strings & numbers, eq will ensure that the value is equal to the parameter given. For slices, arrays, and maps, @@ -427,7 +466,7 @@ in the parameter. Usage: eq=1h30m -Not Equal +# Not Equal For strings & numbers, ne will ensure that the value is not equal to the parameter given. For slices, arrays, and maps, @@ -444,19 +483,26 @@ given in the parameter. Usage: ne=1h30m -One Of +# One Of For strings, ints, and uints, oneof will ensure that the value is one of the values in the parameter. The parameter should be a list of values separated by whitespace. Values may be strings or numbers. To match strings with spaces in them, include -the target string between single quotes. +the target string between single quotes. Kind of like an 'enum'. + + Usage: oneof=red green + oneof='red green' 'blue yellow' + oneof=5 7 9 + +# One Of Case Insensitive - Usage: oneof=red green - oneof='red green' 'blue yellow' - oneof=5 7 9 +Works the same as oneof but is case insensitive and therefore only accepts strings. -Greater Than + Usage: oneofci=red green + oneofci='red green' 'blue yellow' + +# Greater Than For numbers, this will ensure that the value is greater than the parameter given. For strings, it checks that the string length @@ -480,7 +526,7 @@ given in the parameter. Usage: gt=1h30m -Greater Than or Equal +# Greater Than or Equal Same as 'min' above. Kept both to make terminology with 'len' easier. @@ -501,7 +547,7 @@ the duration given in the parameter. Usage: gte=1h30m -Less Than +# Less Than For numbers, this will ensure that the value is less than the parameter given. For strings, it checks that the string length is less than that number of @@ -524,7 +570,7 @@ in the parameter. Usage: lt=1h30m -Less Than or Equal +# Less Than or Equal Same as 'max' above. Kept both to make terminology with 'len' easier. @@ -545,7 +591,7 @@ duration given in the parameter. Usage: lte=1h30m -Field Equals Another Field +# Field Equals Another Field This will validate the field value against another fields value either within a struct or passed in field. @@ -567,7 +613,7 @@ to the top level struct. Usage: eqcsfield=InnerStructField.Field) -Field Does Not Equal Another Field +# Field Does Not Equal Another Field This will validate the field value against another fields value either within a struct or passed in field. @@ -589,7 +635,7 @@ relative to the top level struct. Usage: necsfield=InnerStructField.Field -Field Greater Than Another Field +# Field Greater Than Another Field Only valid for Numbers, time.Duration and time.Time types, this will validate the field value against another fields value either within a struct or passed in @@ -605,14 +651,14 @@ Example #2: // Validating by field: validate.VarWithValue(start, end, "gtfield") -Field Greater Than Another Relative Field +# Field Greater Than Another Relative Field This does the same as gtfield except that it validates the field provided relative to the top level struct. Usage: gtcsfield=InnerStructField.Field -Field Greater Than or Equal To Another Field +# Field Greater Than or Equal To Another Field Only valid for Numbers, time.Duration and time.Time types, this will validate the field value against another fields value either within a struct or passed in @@ -628,14 +674,14 @@ Example #2: // Validating by field: validate.VarWithValue(start, end, "gtefield") -Field Greater Than or Equal To Another Relative Field +# Field Greater Than or Equal To Another Relative Field This does the same as gtefield except that it validates the field provided relative to the top level struct. Usage: gtecsfield=InnerStructField.Field -Less Than Another Field +# Less Than Another Field Only valid for Numbers, time.Duration and time.Time types, this will validate the field value against another fields value either within a struct or passed in @@ -651,14 +697,14 @@ Example #2: // Validating by field: validate.VarWithValue(start, end, "ltfield") -Less Than Another Relative Field +# Less Than Another Relative Field This does the same as ltfield except that it validates the field provided relative to the top level struct. Usage: ltcsfield=InnerStructField.Field -Less Than or Equal To Another Field +# Less Than or Equal To Another Field Only valid for Numbers, time.Duration and time.Time types, this will validate the field value against another fields value either within a struct or passed in @@ -674,14 +720,14 @@ Example #2: // Validating by field: validate.VarWithValue(start, end, "ltefield") -Less Than or Equal To Another Relative Field +# Less Than or Equal To Another Relative Field This does the same as ltefield except that it validates the field provided relative to the top level struct. Usage: ltecsfield=InnerStructField.Field -Field Contains Another Field +# Field Contains Another Field This does the same as contains except for struct fields. It should only be used with string types. See the behavior of reflect.Value.String() for behavior on @@ -689,7 +735,7 @@ other types. Usage: containsfield=InnerStructField.Field -Field Excludes Another Field +# Field Excludes Another Field This does the same as excludes except for struct fields. It should only be used with string types. See the behavior of reflect.Value.String() for behavior on @@ -697,7 +743,7 @@ other types. Usage: excludesfield=InnerStructField.Field -Unique +# Unique For arrays & slices, unique will ensure that there are no duplicates. For maps, unique will ensure that there are no duplicate values. @@ -710,44 +756,44 @@ in a field of the struct specified via a parameter. // For slices of struct: Usage: unique=field -Alpha Only +# Alpha Only This validates that a string value contains ASCII alpha characters only Usage: alpha -Alphanumeric +# Alphanumeric This validates that a string value contains ASCII alphanumeric characters only Usage: alphanum -Alpha Unicode +# Alpha Unicode This validates that a string value contains unicode alpha characters only Usage: alphaunicode -Alphanumeric Unicode +# Alphanumeric Unicode This validates that a string value contains unicode alphanumeric characters only Usage: alphanumunicode -Boolean +# Boolean This validates that a string value can successfully be parsed into a boolean with strconv.ParseBool Usage: boolean -Number +# Number This validates that a string value contains number values only. For integers or float it returns true. Usage: number -Numeric +# Numeric This validates that a string value contains a basic numeric value. basic excludes exponents etc... @@ -755,63 +801,63 @@ for integers or float it returns true. Usage: numeric -Hexadecimal String +# Hexadecimal String This validates that a string value contains a valid hexadecimal. Usage: hexadecimal -Hexcolor String +# Hexcolor String This validates that a string value contains a valid hex color including hashtag (#) - Usage: hexcolor + Usage: hexcolor -Lowercase String +# Lowercase String This validates that a string value contains only lowercase characters. An empty string is not a valid lowercase string. Usage: lowercase -Uppercase String +# Uppercase String This validates that a string value contains only uppercase characters. An empty string is not a valid uppercase string. Usage: uppercase -RGB String +# RGB String This validates that a string value contains a valid rgb color Usage: rgb -RGBA String +# RGBA String This validates that a string value contains a valid rgba color Usage: rgba -HSL String +# HSL String This validates that a string value contains a valid hsl color Usage: hsl -HSLA String +# HSLA String This validates that a string value contains a valid hsla color Usage: hsla -E.164 Phone Number String +# E.164 Phone Number String This validates that a string value contains a valid E.164 Phone number https://en.wikipedia.org/wiki/E.164 (ex. +1123456789) Usage: e164 -E-mail String +# E-mail String This validates that a string value contains a valid email This may not conform to all possibilities of any rfc standard, but neither @@ -819,19 +865,19 @@ does any email provider accept all possibilities. Usage: email -JSON String +# JSON String This validates that a string value is valid JSON Usage: json -JWT String +# JWT String This validates that a string value is a valid JWT Usage: jwt -File path +# File This validates that a string value contains a valid file path and that the file exists on the machine. @@ -839,7 +885,23 @@ This is done using os.Stat, which is a platform independent function. Usage: file -URL String +# Image path + +This validates that a string value contains a valid file path and that +the file exists on the machine and is an image. +This is done using os.Stat and github.com/gabriel-vasile/mimetype + + Usage: image + +# File Path + +This validates that a string value contains a valid file path but does not +validate the existence of that file. +This is done using os.Stat, which is a platform independent function. + + Usage: filepath + +# URL String This validates that a string value contains a valid url This will accept any url the golang request uri accepts but must contain @@ -847,21 +909,30 @@ a schema for example http:// or rtmp:// Usage: url -URI String +# URI String This validates that a string value contains a valid uri This will accept any uri the golang request uri accepts Usage: uri -Urn RFC 2141 String +# Urn RFC 2141 String -This validataes that a string value contains a valid URN +This validates that a string value contains a valid URN according to the RFC 2141 spec. Usage: urn_rfc2141 -Base64 String +# Base32 String + +This validates that a string value contains a valid bas324 value. +Although an empty string is valid base32 this will report an empty string +as an error, if you wish to accept an empty string as valid you can use +this with the omitempty tag. + + Usage: base32 + +# Base64 String This validates that a string value contains a valid base64 value. Although an empty string is valid base64 this will report an empty string @@ -870,17 +941,27 @@ this with the omitempty tag. Usage: base64 -Base64URL String +# Base64URL String This validates that a string value contains a valid base64 URL safe value -according the the RFC4648 spec. +according the RFC4648 spec. Although an empty string is a valid base64 URL safe value, this will report an empty string as an error, if you wish to accept an empty string as valid you can use this with the omitempty tag. Usage: base64url -Bitcoin Address +# Base64RawURL String + +This validates that a string value contains a valid base64 URL safe value, +but without = padding, according the RFC4648 spec, section 3.2. +Although an empty string is a valid base64 URL safe value, this will report +an empty string as an error, if you wish to accept an empty string as valid +you can use this with the omitempty tag. + + Usage: base64rawurl + +# Bitcoin Address This validates that a string value contains a valid bitcoin address. The format of the string is checked to ensure it matches one of the three formats @@ -892,270 +973,276 @@ Bitcoin Bech32 Address (segwit) This validates that a string value contains a valid bitcoin Bech32 address as defined by bip-0173 (https://github.com/bitcoin/bips/blob/master/bip-0173.mediawiki) -Special thanks to Pieter Wuille for providng reference implementations. +Special thanks to Pieter Wuille for providing reference implementations. Usage: btc_addr_bech32 -Ethereum Address +# Ethereum Address This validates that a string value contains a valid ethereum address. The format of the string is checked to ensure it matches the standard Ethereum address format. Usage: eth_addr -Contains +# Contains This validates that a string value contains the substring value. Usage: contains=@ -Contains Any +# Contains Any This validates that a string value contains any Unicode code points in the substring value. Usage: containsany=!@#? -Contains Rune +# Contains Rune This validates that a string value contains the supplied rune value. Usage: containsrune=@ -Excludes +# Excludes This validates that a string value does not contain the substring value. Usage: excludes=@ -Excludes All +# Excludes All This validates that a string value does not contain any Unicode code points in the substring value. Usage: excludesall=!@#? -Excludes Rune +# Excludes Rune This validates that a string value does not contain the supplied rune value. Usage: excludesrune=@ -Starts With +# Starts With This validates that a string value starts with the supplied string value Usage: startswith=hello -Ends With +# Ends With This validates that a string value ends with the supplied string value Usage: endswith=goodbye -Does Not Start With +# Does Not Start With This validates that a string value does not start with the supplied string value Usage: startsnotwith=hello -Does Not End With +# Does Not End With This validates that a string value does not end with the supplied string value Usage: endsnotwith=goodbye -International Standard Book Number +# International Standard Book Number This validates that a string value contains a valid isbn10 or isbn13 value. Usage: isbn -International Standard Book Number 10 +# International Standard Book Number 10 This validates that a string value contains a valid isbn10 value. Usage: isbn10 -International Standard Book Number 13 +# International Standard Book Number 13 This validates that a string value contains a valid isbn13 value. Usage: isbn13 -Universally Unique Identifier UUID +# Universally Unique Identifier UUID This validates that a string value contains a valid UUID. Uppercase UUID values will not pass - use `uuid_rfc4122` instead. Usage: uuid -Universally Unique Identifier UUID v3 +# Universally Unique Identifier UUID v3 This validates that a string value contains a valid version 3 UUID. Uppercase UUID values will not pass - use `uuid3_rfc4122` instead. Usage: uuid3 -Universally Unique Identifier UUID v4 +# Universally Unique Identifier UUID v4 This validates that a string value contains a valid version 4 UUID. Uppercase UUID values will not pass - use `uuid4_rfc4122` instead. Usage: uuid4 -Universally Unique Identifier UUID v5 +# Universally Unique Identifier UUID v5 This validates that a string value contains a valid version 5 UUID. Uppercase UUID values will not pass - use `uuid5_rfc4122` instead. Usage: uuid5 -Universally Unique Lexicographically Sortable Identifier ULID +# Universally Unique Lexicographically Sortable Identifier ULID This validates that a string value contains a valid ULID value. Usage: ulid -ASCII +# ASCII This validates that a string value contains only ASCII characters. NOTE: if the string is blank, this validates as true. Usage: ascii -Printable ASCII +# Printable ASCII This validates that a string value contains only printable ASCII characters. NOTE: if the string is blank, this validates as true. Usage: printascii -Multi-Byte Characters +# Multi-Byte Characters This validates that a string value contains one or more multibyte characters. NOTE: if the string is blank, this validates as true. Usage: multibyte -Data URL +# Data URL This validates that a string value contains a valid DataURI. NOTE: this will also validate that the data portion is valid base64 Usage: datauri -Latitude +# Latitude This validates that a string value contains a valid latitude. Usage: latitude -Longitude +# Longitude This validates that a string value contains a valid longitude. Usage: longitude -Social Security Number SSN +# Employeer Identification Number EIN + +This validates that a string value contains a valid U.S. Employer Identification Number. + + Usage: ein + +# Social Security Number SSN This validates that a string value contains a valid U.S. Social Security Number. Usage: ssn -Internet Protocol Address IP +# Internet Protocol Address IP This validates that a string value contains a valid IP Address. Usage: ip -Internet Protocol Address IPv4 +# Internet Protocol Address IPv4 This validates that a string value contains a valid v4 IP Address. Usage: ipv4 -Internet Protocol Address IPv6 +# Internet Protocol Address IPv6 This validates that a string value contains a valid v6 IP Address. Usage: ipv6 -Classless Inter-Domain Routing CIDR +# Classless Inter-Domain Routing CIDR This validates that a string value contains a valid CIDR Address. Usage: cidr -Classless Inter-Domain Routing CIDRv4 +# Classless Inter-Domain Routing CIDRv4 This validates that a string value contains a valid v4 CIDR Address. Usage: cidrv4 -Classless Inter-Domain Routing CIDRv6 +# Classless Inter-Domain Routing CIDRv6 This validates that a string value contains a valid v6 CIDR Address. Usage: cidrv6 -Transmission Control Protocol Address TCP +# Transmission Control Protocol Address TCP This validates that a string value contains a valid resolvable TCP Address. Usage: tcp_addr -Transmission Control Protocol Address TCPv4 +# Transmission Control Protocol Address TCPv4 This validates that a string value contains a valid resolvable v4 TCP Address. Usage: tcp4_addr -Transmission Control Protocol Address TCPv6 +# Transmission Control Protocol Address TCPv6 This validates that a string value contains a valid resolvable v6 TCP Address. Usage: tcp6_addr -User Datagram Protocol Address UDP +# User Datagram Protocol Address UDP This validates that a string value contains a valid resolvable UDP Address. Usage: udp_addr -User Datagram Protocol Address UDPv4 +# User Datagram Protocol Address UDPv4 This validates that a string value contains a valid resolvable v4 UDP Address. Usage: udp4_addr -User Datagram Protocol Address UDPv6 +# User Datagram Protocol Address UDPv6 This validates that a string value contains a valid resolvable v6 UDP Address. Usage: udp6_addr -Internet Protocol Address IP +# Internet Protocol Address IP This validates that a string value contains a valid resolvable IP Address. Usage: ip_addr -Internet Protocol Address IPv4 +# Internet Protocol Address IPv4 This validates that a string value contains a valid resolvable v4 IP Address. Usage: ip4_addr -Internet Protocol Address IPv6 +# Internet Protocol Address IPv6 This validates that a string value contains a valid resolvable v6 IP Address. Usage: ip6_addr -Unix domain socket end point Address +# Unix domain socket end point Address This validates that a string value contains a valid Unix Address. Usage: unix_addr -Media Access Control Address MAC +# Media Access Control Address MAC This validates that a string value contains a valid MAC Address. @@ -1165,13 +1252,13 @@ Note: See Go's ParseMAC for accepted formats and types: http://golang.org/src/net/mac.go?s=866:918#L29 -Hostname RFC 952 +# Hostname RFC 952 This validates that a string value is a valid Hostname according to RFC 952 https://tools.ietf.org/html/rfc952 Usage: hostname -Hostname RFC 1123 +# Hostname RFC 1123 This validates that a string value is a valid Hostname according to RFC 1123 https://tools.ietf.org/html/rfc1123 @@ -1183,28 +1270,28 @@ This validates that a string value contains a valid FQDN. Usage: fqdn -HTML Tags +# HTML Tags This validates that a string value appears to be an HTML element tag including those described at https://developer.mozilla.org/en-US/docs/Web/HTML/Element Usage: html -HTML Encoded +# HTML Encoded This validates that a string value is a proper character reference in decimal or hexadecimal format Usage: html_encoded -URL Encoded +# URL Encoded This validates that a string value is percent-encoded (URL encoded) according to https://tools.ietf.org/html/rfc3986#section-2.1 Usage: url_encoded -Directory +# Directory This validates that a string value contains a valid directory and that it exists on the machine. @@ -1212,42 +1299,52 @@ This is done using os.Stat, which is a platform independent function. Usage: dir -HostPort +# Directory Path + +This validates that a string value contains a valid directory but does +not validate the existence of that directory. +This is done using os.Stat, which is a platform independent function. +It is safest to suffix the string with os.PathSeparator if the directory +may not exist at the time of validation. + + Usage: dirpath + +# HostPort This validates that a string value contains a valid DNS hostname and port that -can be used to valiate fields typically passed to sockets and connections. +can be used to validate fields typically passed to sockets and connections. Usage: hostname_port -Datetime +# Datetime This validates that a string value is a valid datetime based on the supplied datetime format. Supplied format must match the official Go time format layout as documented in https://golang.org/pkg/time/ Usage: datetime=2006-01-02 -Iso3166-1 alpha-2 +# Iso3166-1 alpha-2 This validates that a string value is a valid country code based on iso3166-1 alpha-2 standard. see: https://www.iso.org/iso-3166-country-codes.html Usage: iso3166_1_alpha2 -Iso3166-1 alpha-3 +# Iso3166-1 alpha-3 This validates that a string value is a valid country code based on iso3166-1 alpha-3 standard. see: https://www.iso.org/iso-3166-country-codes.html Usage: iso3166_1_alpha3 -Iso3166-1 alpha-numeric +# Iso3166-1 alpha-numeric This validates that a string value is a valid country code based on iso3166-1 alpha-numeric standard. see: https://www.iso.org/iso-3166-country-codes.html Usage: iso3166_1_alpha3 -BCP 47 Language Tag +# BCP 47 Language Tag This validates that a string value is a valid BCP 47 language tag, as parsed by language.Parse. More information on https://pkg.go.dev/golang.org/x/text/language @@ -1261,14 +1358,14 @@ More information on https://www.iso.org/standard/60390.html Usage: bic -RFC 1035 label +# RFC 1035 label This validates that a string value is a valid dns RFC 1035 label, defined in RFC 1035. More information on https://datatracker.ietf.org/doc/html/rfc1035 Usage: dns_rfc1035_label -TimeZone +# TimeZone This validates that a string value is a valid time zone based on the time zone database present on the system. Although empty value and Local value are allowed by time.LoadLocation golang function, they are not allowed by this validator. @@ -1276,15 +1373,61 @@ More information on https://golang.org/pkg/time/#LoadLocation Usage: timezone -Semantic Version +# Semantic Version This validates that a string value is a valid semver version, defined in Semantic Versioning 2.0.0. More information on https://semver.org/ Usage: semver -Alias Validators and Tags +# CVE Identifier + +This validates that a string value is a valid cve id, defined in cve mitre. +More information on https://cve.mitre.org/ + + Usage: cve + +# Credit Card + +This validates that a string value contains a valid credit card number using Luhn algorithm. + Usage: credit_card + +# Luhn Checksum + + Usage: luhn_checksum + +This validates that a string or (u)int value contains a valid checksum using the Luhn algorithm. + +# MongoDB + +This validates that a string is a valid 24 character hexadecimal string or valid connection string. + + Usage: mongodb + mongodb_connection_string + +Example: + + type Test struct { + ObjectIdField string `validate:"mongodb"` + ConnectionStringField string `validate:"mongodb_connection_string"` + } + +# Cron + +This validates that a string value contains a valid cron expression. + + Usage: cron + +# SpiceDb ObjectID/Permission/Object Type + +This validates that a string is valid for use with SpiceDb for the indicated purpose. If no purpose is given, a purpose of 'id' is assumed. + + Usage: spicedb=id|permission|type + +# Alias Validators and Tags + +Alias Validators and Tags NOTE: When returning an error, the tag returned in "FieldError" will be the alias tag unless the dive tag is part of the alias. Everything after the dive tag is not reported as the alias tag. Also, the "ActualTag" in the before @@ -1314,7 +1457,7 @@ Validator notes: And the best reason, you can submit a pull request and we can keep on adding to the validation library of this package! -Non standard validators +# Non standard validators A collection of validation rules that are frequently needed but are more complex than the ones found in the baked in validators. @@ -1343,7 +1486,7 @@ Here is a list of the current non standard validators: Usage: notblank -Panics +# Panics This package panics when bad input is provided, this is by design, bad code like that should not make it to production. diff --git a/vendor/github.com/go-playground/validator/v10/errors.go b/vendor/github.com/go-playground/validator/v10/errors.go index 9a1b1abe..be2676e9 100644 --- a/vendor/github.com/go-playground/validator/v10/errors.go +++ b/vendor/github.com/go-playground/validator/v10/errors.go @@ -44,12 +44,9 @@ func (ve ValidationErrors) Error() string { buff := bytes.NewBufferString("") - var fe *fieldError - for i := 0; i < len(ve); i++ { - fe = ve[i].(*fieldError) - buff.WriteString(fe.Error()) + buff.WriteString(ve[i].Error()) buff.WriteString("\n") } @@ -260,15 +257,19 @@ func (fe *fieldError) Error() string { // NOTE: if no registered translation can be found, it returns the original // untranslated error message. func (fe *fieldError) Translate(ut ut.Translator) string { + var fn TranslationFunc m, ok := fe.v.transTagFunc[ut] if !ok { return fe.Error() } - fn, ok := m[fe.tag] + fn, ok = m[fe.tag] if !ok { - return fe.Error() + fn, ok = m[fe.actualTag] + if !ok { + return fe.Error() + } } return fn(ut, fe) diff --git a/vendor/github.com/go-playground/validator/v10/options.go b/vendor/github.com/go-playground/validator/v10/options.go new file mode 100644 index 00000000..86a0db21 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/options.go @@ -0,0 +1,26 @@ +package validator + +// Option represents a configurations option to be applied to validator during initialization. +type Option func(*Validate) + +// WithRequiredStructEnabled enables required tag on non-pointer structs to be applied instead of ignored. +// +// This was made opt-in behaviour in order to maintain backward compatibility with the behaviour previous +// to being able to apply struct level validations on struct fields directly. +// +// It is recommended you enabled this as it will be the default behaviour in v11+ +func WithRequiredStructEnabled() Option { + return func(v *Validate) { + v.requiredStructEnabled = true + } +} + +// WithPrivateFieldValidation activates validation for unexported fields via the use of the `unsafe` package. +// +// By opting into this feature you are acknowledging that you are aware of the risks and accept any current or future +// consequences of using this feature. +func WithPrivateFieldValidation() Option { + return func(v *Validate) { + v.privateFieldValidation = true + } +} diff --git a/vendor/github.com/go-playground/validator/v10/postcode_regexes.go b/vendor/github.com/go-playground/validator/v10/postcode_regexes.go index e7e7b687..326b8f75 100644 --- a/vendor/github.com/go-playground/validator/v10/postcode_regexes.go +++ b/vendor/github.com/go-playground/validator/v10/postcode_regexes.go @@ -1,6 +1,9 @@ package validator -import "regexp" +import ( + "regexp" + "sync" +) var postCodePatternDict = map[string]string{ "GB": `^GIR[ ]?0AA|((AB|AL|B|BA|BB|BD|BH|BL|BN|BR|BS|BT|CA|CB|CF|CH|CM|CO|CR|CT|CV|CW|DA|DD|DE|DG|DH|DL|DN|DT|DY|E|EC|EH|EN|EX|FK|FY|G|GL|GY|GU|HA|HD|HG|HP|HR|HS|HU|HX|IG|IM|IP|IV|JE|KA|KT|KW|KY|L|LA|LD|LE|LL|LN|LS|LU|M|ME|MK|ML|N|NE|NG|NN|NP|NR|NW|OL|OX|PA|PE|PH|PL|PO|PR|RG|RH|RM|S|SA|SE|SG|SK|SL|SM|SN|SO|SP|SR|SS|ST|SW|SY|TA|TD|TF|TN|TQ|TR|TS|TW|UB|W|WA|WC|WD|WF|WN|WR|WS|WV|YO|ZE)(\d[\dA-Z]?[ ]?\d[ABD-HJLN-UW-Z]{2}))|BFPO[ ]?\d{1,4}$`, @@ -164,9 +167,12 @@ var postCodePatternDict = map[string]string{ "YT": `^976\d{2}$`, } -var postCodeRegexDict = map[string]*regexp.Regexp{} +var ( + postcodeRegexInit sync.Once + postCodeRegexDict = map[string]*regexp.Regexp{} +) -func init() { +func initPostcodes() { for countryCode, pattern := range postCodePatternDict { postCodeRegexDict[countryCode] = regexp.MustCompile(pattern) } diff --git a/vendor/github.com/go-playground/validator/v10/regexes.go b/vendor/github.com/go-playground/validator/v10/regexes.go index 48e51d57..93909b2e 100644 --- a/vendor/github.com/go-playground/validator/v10/regexes.go +++ b/vendor/github.com/go-playground/validator/v10/regexes.go @@ -1,6 +1,9 @@ package validator -import "regexp" +import ( + "regexp" + "sync" +) const ( alphaRegexString = "^[a-zA-Z]+$" @@ -17,10 +20,13 @@ const ( hslaRegexString = "^hsla\\(\\s*(?:0|[1-9]\\d?|[12]\\d\\d|3[0-5]\\d|360)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0.[1-9]*)|[01])\\s*\\)$" emailRegexString = "^(?:(?:(?:(?:[a-zA-Z]|\\d|[!#\\$%&'\\*\\+\\-\\/=\\?\\^_`{\\|}~]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])+(?:\\.([a-zA-Z]|\\d|[!#\\$%&'\\*\\+\\-\\/=\\?\\^_`{\\|}~]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])+)*)|(?:(?:\\x22)(?:(?:(?:(?:\\x20|\\x09)*(?:\\x0d\\x0a))?(?:\\x20|\\x09)+)?(?:(?:[\\x01-\\x08\\x0b\\x0c\\x0e-\\x1f\\x7f]|\\x21|[\\x23-\\x5b]|[\\x5d-\\x7e]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[\\x01-\\x09\\x0b\\x0c\\x0d-\\x7f]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}]))))*(?:(?:(?:\\x20|\\x09)*(?:\\x0d\\x0a))?(\\x20|\\x09)+)?(?:\\x22))))@(?:(?:(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])(?:[a-zA-Z]|\\d|-|\\.|~|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])*(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])))\\.)+(?:(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])(?:[a-zA-Z]|\\d|-|\\.|~|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])*(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])))\\.?$" e164RegexString = "^\\+[1-9]?[0-9]{7,14}$" + base32RegexString = "^(?:[A-Z2-7]{8})*(?:[A-Z2-7]{2}={6}|[A-Z2-7]{4}={4}|[A-Z2-7]{5}={3}|[A-Z2-7]{7}=|[A-Z2-7]{8})$" base64RegexString = "^(?:[A-Za-z0-9+\\/]{4})*(?:[A-Za-z0-9+\\/]{2}==|[A-Za-z0-9+\\/]{3}=|[A-Za-z0-9+\\/]{4})$" base64URLRegexString = "^(?:[A-Za-z0-9-_]{4})*(?:[A-Za-z0-9-_]{2}==|[A-Za-z0-9-_]{3}=|[A-Za-z0-9-_]{4})$" + base64RawURLRegexString = "^(?:[A-Za-z0-9-_]{4})*(?:[A-Za-z0-9-_]{2,4})$" iSBN10RegexString = "^(?:[0-9]{9}X|[0-9]{10})$" iSBN13RegexString = "^(?:(?:97(?:8|9))[0-9]{10})$" + iSSNRegexString = "^(?:[0-9]{4}-[0-9]{3}[0-9X])$" uUID3RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-3[0-9a-f]{3}-[0-9a-f]{4}-[0-9a-f]{12}$" uUID4RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-4[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$" uUID5RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-5[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$" @@ -29,7 +35,17 @@ const ( uUID4RFC4122RegexString = "^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-4[0-9a-fA-F]{3}-[89abAB][0-9a-fA-F]{3}-[0-9a-fA-F]{12}$" uUID5RFC4122RegexString = "^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-5[0-9a-fA-F]{3}-[89abAB][0-9a-fA-F]{3}-[0-9a-fA-F]{12}$" uUIDRFC4122RegexString = "^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{12}$" - uLIDRegexString = "^[A-HJKMNP-TV-Z0-9]{26}$" + uLIDRegexString = "^(?i)[A-HJKMNP-TV-Z0-9]{26}$" + md4RegexString = "^[0-9a-f]{32}$" + md5RegexString = "^[0-9a-f]{32}$" + sha256RegexString = "^[0-9a-f]{64}$" + sha384RegexString = "^[0-9a-f]{96}$" + sha512RegexString = "^[0-9a-f]{128}$" + ripemd128RegexString = "^[0-9a-f]{32}$" + ripemd160RegexString = "^[0-9a-f]{40}$" + tiger128RegexString = "^[0-9a-f]{32}$" + tiger160RegexString = "^[0-9a-f]{40}$" + tiger192RegexString = "^[0-9a-f]{48}$" aSCIIRegexString = "^[\x00-\x7F]*$" printableASCIIRegexString = "^[\x20-\x7E]*$" multibyteRegexString = "[^\x00-\x7F]" @@ -37,12 +53,12 @@ const ( latitudeRegexString = "^[-+]?([1-8]?\\d(\\.\\d+)?|90(\\.0+)?)$" longitudeRegexString = "^[-+]?(180(\\.0+)?|((1[0-7]\\d)|([1-9]?\\d))(\\.\\d+)?)$" sSNRegexString = `^[0-9]{3}[ -]?(0[1-9]|[1-9][0-9])[ -]?([1-9][0-9]{3}|[0-9][1-9][0-9]{2}|[0-9]{2}[1-9][0-9]|[0-9]{3}[1-9])$` - hostnameRegexStringRFC952 = `^[a-zA-Z]([a-zA-Z0-9\-]+[\.]?)*[a-zA-Z0-9]$` // https://tools.ietf.org/html/rfc952 - hostnameRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9_-]{0,62}){1}(\.[a-zA-Z0-9_]{1}[a-zA-Z0-9_-]{0,62})*?$` // accepts hostname starting with a digit https://tools.ietf.org/html/rfc1123 - fqdnRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9_-]{0,62})(\.[a-zA-Z0-9_]{1}[a-zA-Z0-9_-]{0,62})*?(\.[a-zA-Z]{1}[a-zA-Z0-9]{0,62})\.?$` // same as hostnameRegexStringRFC1123 but must contain a non numerical TLD (possibly ending with '.') - btcAddressRegexString = `^[13][a-km-zA-HJ-NP-Z1-9]{25,34}$` // bitcoin address - btcAddressUpperRegexStringBech32 = `^BC1[02-9AC-HJ-NP-Z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 - btcAddressLowerRegexStringBech32 = `^bc1[02-9ac-hj-np-z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 + hostnameRegexStringRFC952 = `^[a-zA-Z]([a-zA-Z0-9\-]+[\.]?)*[a-zA-Z0-9]$` // https://tools.ietf.org/html/rfc952 + hostnameRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62}){1}(\.[a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62})*?$` // accepts hostname starting with a digit https://tools.ietf.org/html/rfc1123 + fqdnRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62})(\.[a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62})*?(\.[a-zA-Z]{1}[a-zA-Z0-9]{0,62})\.?$` // same as hostnameRegexStringRFC1123 but must contain a non numerical TLD (possibly ending with '.') + btcAddressRegexString = `^[13][a-km-zA-HJ-NP-Z1-9]{25,34}$` // bitcoin address + btcAddressUpperRegexStringBech32 = `^BC1[02-9AC-HJ-NP-Z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 + btcAddressLowerRegexStringBech32 = `^bc1[02-9ac-hj-np-z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 ethAddressRegexString = `^0x[0-9a-fA-F]{40}$` ethAddressUpperRegexString = `^0x[0-9A-F]{40}$` ethAddressLowerRegexString = `^0x[0-9a-f]{40}$` @@ -53,59 +69,97 @@ const ( splitParamsRegexString = `'[^']*'|\S+` bicRegexString = `^[A-Za-z]{6}[A-Za-z0-9]{2}([A-Za-z0-9]{3})?$` semverRegexString = `^(0|[1-9]\d*)\.(0|[1-9]\d*)\.(0|[1-9]\d*)(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?$` // numbered capture groups https://semver.org/ - dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9]){0,62}$" + dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9])?$" + cveRegexString = `^CVE-(1999|2\d{3})-(0[^0]\d{2}|0\d[^0]\d{1}|0\d{2}[^0]|[1-9]{1}\d{3,})$` // CVE Format Id https://cve.mitre.org/cve/identifiers/syntaxchange.html + mongodbIdRegexString = "^[a-f\\d]{24}$" + mongodbConnStringRegexString = "^mongodb(\\+srv)?:\\/\\/(([a-zA-Z\\d]+):([a-zA-Z\\d$:\\/?#\\[\\]@]+)@)?(([a-z\\d.-]+)(:[\\d]+)?)((,(([a-z\\d.-]+)(:(\\d+))?))*)?(\\/[a-zA-Z-_]{1,64})?(\\?(([a-zA-Z]+)=([a-zA-Z\\d]+))(&(([a-zA-Z\\d]+)=([a-zA-Z\\d]+))?)*)?$" + cronRegexString = `(@(annually|yearly|monthly|weekly|daily|hourly|reboot))|(@every (\d+(ns|us|µs|ms|s|m|h))+)|((((\d+,)+\d+|((\*|\d+)(\/|-)\d+)|\d+|\*) ?){5,7})` + spicedbIDRegexString = `^(([a-zA-Z0-9/_|\-=+]{1,})|\*)$` + spicedbPermissionRegexString = "^([a-z][a-z0-9_]{1,62}[a-z0-9])?$" + spicedbTypeRegexString = "^([a-z][a-z0-9_]{1,61}[a-z0-9]/)?[a-z][a-z0-9_]{1,62}[a-z0-9]$" + einRegexString = "^(\\d{2}-\\d{7})$" ) +func lazyRegexCompile(str string) func() *regexp.Regexp { + var regex *regexp.Regexp + var once sync.Once + return func() *regexp.Regexp { + once.Do(func() { + regex = regexp.MustCompile(str) + }) + return regex + } +} + var ( - alphaRegex = regexp.MustCompile(alphaRegexString) - alphaNumericRegex = regexp.MustCompile(alphaNumericRegexString) - alphaUnicodeRegex = regexp.MustCompile(alphaUnicodeRegexString) - alphaUnicodeNumericRegex = regexp.MustCompile(alphaUnicodeNumericRegexString) - numericRegex = regexp.MustCompile(numericRegexString) - numberRegex = regexp.MustCompile(numberRegexString) - hexadecimalRegex = regexp.MustCompile(hexadecimalRegexString) - hexColorRegex = regexp.MustCompile(hexColorRegexString) - rgbRegex = regexp.MustCompile(rgbRegexString) - rgbaRegex = regexp.MustCompile(rgbaRegexString) - hslRegex = regexp.MustCompile(hslRegexString) - hslaRegex = regexp.MustCompile(hslaRegexString) - e164Regex = regexp.MustCompile(e164RegexString) - emailRegex = regexp.MustCompile(emailRegexString) - base64Regex = regexp.MustCompile(base64RegexString) - base64URLRegex = regexp.MustCompile(base64URLRegexString) - iSBN10Regex = regexp.MustCompile(iSBN10RegexString) - iSBN13Regex = regexp.MustCompile(iSBN13RegexString) - uUID3Regex = regexp.MustCompile(uUID3RegexString) - uUID4Regex = regexp.MustCompile(uUID4RegexString) - uUID5Regex = regexp.MustCompile(uUID5RegexString) - uUIDRegex = regexp.MustCompile(uUIDRegexString) - uUID3RFC4122Regex = regexp.MustCompile(uUID3RFC4122RegexString) - uUID4RFC4122Regex = regexp.MustCompile(uUID4RFC4122RegexString) - uUID5RFC4122Regex = regexp.MustCompile(uUID5RFC4122RegexString) - uUIDRFC4122Regex = regexp.MustCompile(uUIDRFC4122RegexString) - uLIDRegex = regexp.MustCompile(uLIDRegexString) - aSCIIRegex = regexp.MustCompile(aSCIIRegexString) - printableASCIIRegex = regexp.MustCompile(printableASCIIRegexString) - multibyteRegex = regexp.MustCompile(multibyteRegexString) - dataURIRegex = regexp.MustCompile(dataURIRegexString) - latitudeRegex = regexp.MustCompile(latitudeRegexString) - longitudeRegex = regexp.MustCompile(longitudeRegexString) - sSNRegex = regexp.MustCompile(sSNRegexString) - hostnameRegexRFC952 = regexp.MustCompile(hostnameRegexStringRFC952) - hostnameRegexRFC1123 = regexp.MustCompile(hostnameRegexStringRFC1123) - fqdnRegexRFC1123 = regexp.MustCompile(fqdnRegexStringRFC1123) - btcAddressRegex = regexp.MustCompile(btcAddressRegexString) - btcUpperAddressRegexBech32 = regexp.MustCompile(btcAddressUpperRegexStringBech32) - btcLowerAddressRegexBech32 = regexp.MustCompile(btcAddressLowerRegexStringBech32) - ethAddressRegex = regexp.MustCompile(ethAddressRegexString) - ethAddressRegexUpper = regexp.MustCompile(ethAddressUpperRegexString) - ethAddressRegexLower = regexp.MustCompile(ethAddressLowerRegexString) - uRLEncodedRegex = regexp.MustCompile(uRLEncodedRegexString) - hTMLEncodedRegex = regexp.MustCompile(hTMLEncodedRegexString) - hTMLRegex = regexp.MustCompile(hTMLRegexString) - jWTRegex = regexp.MustCompile(jWTRegexString) - splitParamsRegex = regexp.MustCompile(splitParamsRegexString) - bicRegex = regexp.MustCompile(bicRegexString) - semverRegex = regexp.MustCompile(semverRegexString) - dnsRegexRFC1035Label = regexp.MustCompile(dnsRegexStringRFC1035Label) + alphaRegex = lazyRegexCompile(alphaRegexString) + alphaNumericRegex = lazyRegexCompile(alphaNumericRegexString) + alphaUnicodeRegex = lazyRegexCompile(alphaUnicodeRegexString) + alphaUnicodeNumericRegex = lazyRegexCompile(alphaUnicodeNumericRegexString) + numericRegex = lazyRegexCompile(numericRegexString) + numberRegex = lazyRegexCompile(numberRegexString) + hexadecimalRegex = lazyRegexCompile(hexadecimalRegexString) + hexColorRegex = lazyRegexCompile(hexColorRegexString) + rgbRegex = lazyRegexCompile(rgbRegexString) + rgbaRegex = lazyRegexCompile(rgbaRegexString) + hslRegex = lazyRegexCompile(hslRegexString) + hslaRegex = lazyRegexCompile(hslaRegexString) + e164Regex = lazyRegexCompile(e164RegexString) + emailRegex = lazyRegexCompile(emailRegexString) + base32Regex = lazyRegexCompile(base32RegexString) + base64Regex = lazyRegexCompile(base64RegexString) + base64URLRegex = lazyRegexCompile(base64URLRegexString) + base64RawURLRegex = lazyRegexCompile(base64RawURLRegexString) + iSBN10Regex = lazyRegexCompile(iSBN10RegexString) + iSBN13Regex = lazyRegexCompile(iSBN13RegexString) + iSSNRegex = lazyRegexCompile(iSSNRegexString) + uUID3Regex = lazyRegexCompile(uUID3RegexString) + uUID4Regex = lazyRegexCompile(uUID4RegexString) + uUID5Regex = lazyRegexCompile(uUID5RegexString) + uUIDRegex = lazyRegexCompile(uUIDRegexString) + uUID3RFC4122Regex = lazyRegexCompile(uUID3RFC4122RegexString) + uUID4RFC4122Regex = lazyRegexCompile(uUID4RFC4122RegexString) + uUID5RFC4122Regex = lazyRegexCompile(uUID5RFC4122RegexString) + uUIDRFC4122Regex = lazyRegexCompile(uUIDRFC4122RegexString) + uLIDRegex = lazyRegexCompile(uLIDRegexString) + md4Regex = lazyRegexCompile(md4RegexString) + md5Regex = lazyRegexCompile(md5RegexString) + sha256Regex = lazyRegexCompile(sha256RegexString) + sha384Regex = lazyRegexCompile(sha384RegexString) + sha512Regex = lazyRegexCompile(sha512RegexString) + ripemd128Regex = lazyRegexCompile(ripemd128RegexString) + ripemd160Regex = lazyRegexCompile(ripemd160RegexString) + tiger128Regex = lazyRegexCompile(tiger128RegexString) + tiger160Regex = lazyRegexCompile(tiger160RegexString) + tiger192Regex = lazyRegexCompile(tiger192RegexString) + aSCIIRegex = lazyRegexCompile(aSCIIRegexString) + printableASCIIRegex = lazyRegexCompile(printableASCIIRegexString) + multibyteRegex = lazyRegexCompile(multibyteRegexString) + dataURIRegex = lazyRegexCompile(dataURIRegexString) + latitudeRegex = lazyRegexCompile(latitudeRegexString) + longitudeRegex = lazyRegexCompile(longitudeRegexString) + sSNRegex = lazyRegexCompile(sSNRegexString) + hostnameRegexRFC952 = lazyRegexCompile(hostnameRegexStringRFC952) + hostnameRegexRFC1123 = lazyRegexCompile(hostnameRegexStringRFC1123) + fqdnRegexRFC1123 = lazyRegexCompile(fqdnRegexStringRFC1123) + btcAddressRegex = lazyRegexCompile(btcAddressRegexString) + btcUpperAddressRegexBech32 = lazyRegexCompile(btcAddressUpperRegexStringBech32) + btcLowerAddressRegexBech32 = lazyRegexCompile(btcAddressLowerRegexStringBech32) + ethAddressRegex = lazyRegexCompile(ethAddressRegexString) + uRLEncodedRegex = lazyRegexCompile(uRLEncodedRegexString) + hTMLEncodedRegex = lazyRegexCompile(hTMLEncodedRegexString) + hTMLRegex = lazyRegexCompile(hTMLRegexString) + jWTRegex = lazyRegexCompile(jWTRegexString) + splitParamsRegex = lazyRegexCompile(splitParamsRegexString) + bicRegex = lazyRegexCompile(bicRegexString) + semverRegex = lazyRegexCompile(semverRegexString) + dnsRegexRFC1035Label = lazyRegexCompile(dnsRegexStringRFC1035Label) + cveRegex = lazyRegexCompile(cveRegexString) + mongodbIdRegex = lazyRegexCompile(mongodbIdRegexString) + mongodbConnectionRegex = lazyRegexCompile(mongodbConnStringRegexString) + cronRegex = lazyRegexCompile(cronRegexString) + spicedbIDRegex = lazyRegexCompile(spicedbIDRegexString) + spicedbPermissionRegex = lazyRegexCompile(spicedbPermissionRegexString) + spicedbTypeRegex = lazyRegexCompile(spicedbTypeRegexString) + einRegex = lazyRegexCompile(einRegexString) ) diff --git a/vendor/github.com/go-playground/validator/v10/struct_level.go b/vendor/github.com/go-playground/validator/v10/struct_level.go index c0d89cfb..fa7af9dd 100644 --- a/vendor/github.com/go-playground/validator/v10/struct_level.go +++ b/vendor/github.com/go-playground/validator/v10/struct_level.go @@ -46,9 +46,9 @@ type StructLevel interface { // // NOTES: // - // fieldName and altName get appended to the existing namespace that - // validator is on. e.g. pass 'FirstName' or 'Names[0]' depending - // on the nesting + // fieldName and structFieldName get appended to the existing + // namespace that validator is on. e.g. pass 'FirstName' or + // 'Names[0]' depending on the nesting // // tag can be an existing validation tag or just something you make up // and process on the flip side it's up to you. @@ -62,7 +62,7 @@ type StructLevel interface { // existing namespace that validator is on. // e.g. pass 'User.FirstName' or 'Users[0].FirstName' depending // on the nesting. most of the time they will be blank, unless you validate - // at a level lower the the current field depth + // at a level lower the current field depth ReportValidationErrors(relativeNamespace, relativeActualNamespace string, errs ValidationErrors) } @@ -74,7 +74,7 @@ var _ StructLevel = new(validate) // if not is a nested struct. // // this is only called when within Struct and Field Level validation and -// should not be relied upon for an acurate value otherwise. +// should not be relied upon for an accurate value otherwise. func (v *validate) Top() reflect.Value { return v.top } @@ -85,7 +85,7 @@ func (v *validate) Top() reflect.Value { // if not is a nested struct. // // this is only called when within Struct and Field Level validation and -// should not be relied upon for an acurate value otherwise. +// should not be relied upon for an accurate value otherwise. func (v *validate) Parent() reflect.Value { return v.slflParent } diff --git a/vendor/github.com/go-playground/validator/v10/util.go b/vendor/github.com/go-playground/validator/v10/util.go index 56420f43..9285223a 100644 --- a/vendor/github.com/go-playground/validator/v10/util.go +++ b/vendor/github.com/go-playground/validator/v10/util.go @@ -1,7 +1,9 @@ package validator import ( + "fmt" "reflect" + "regexp" "strconv" "strings" "time" @@ -82,7 +84,7 @@ BEGIN: fld := namespace var ns string - if typ != timeType { + if !typ.ConvertibleTo(timeType) { idx := strings.Index(namespace, namespaceSeparator) @@ -234,7 +236,7 @@ func asInt(param string) int64 { func asIntFromTimeDuration(param string) int64 { d, err := time.ParseDuration(param) if err != nil { - // attempt parsing as an an integer assuming nanosecond precision + // attempt parsing as an integer assuming nanosecond precision return asInt(param) } return int64(d) @@ -261,13 +263,19 @@ func asUint(param string) uint64 { return i } -// asFloat returns the parameter as a float64 +// asFloat64 returns the parameter as a float64 // or panics if it can't convert -func asFloat(param string) float64 { - +func asFloat64(param string) float64 { i, err := strconv.ParseFloat(param, 64) panicIf(err) + return i +} +// asFloat32 returns the parameter as a float32 +// or panics if it can't convert +func asFloat32(param string) float64 { + i, err := strconv.ParseFloat(param, 32) + panicIf(err) return i } @@ -286,3 +294,19 @@ func panicIf(err error) { panic(err.Error()) } } + +// Checks if field value matches regex. If fl.Field can be cast to Stringer, it uses the Stringer interfaces +// String() return value. Otherwise, it uses fl.Field's String() value. +func fieldMatchesRegexByStringerValOrString(regexFn func() *regexp.Regexp, fl FieldLevel) bool { + regex := regexFn() + switch fl.Field().Kind() { + case reflect.String: + return regex.MatchString(fl.Field().String()) + default: + if stringer, ok := fl.Field().Interface().(fmt.Stringer); ok { + return regex.MatchString(stringer.String()) + } else { + return regex.MatchString(fl.Field().String()) + } + } +} diff --git a/vendor/github.com/go-playground/validator/v10/validator.go b/vendor/github.com/go-playground/validator/v10/validator.go index 2a4fad02..d7c2e658 100644 --- a/vendor/github.com/go-playground/validator/v10/validator.go +++ b/vendor/github.com/go-playground/validator/v10/validator.go @@ -5,6 +5,7 @@ import ( "fmt" "reflect" "strconv" + "unsafe" ) // per validate construct @@ -99,6 +100,8 @@ func (v *validate) traverseField(ctx context.Context, parent reflect.Value, curr current, kind, v.fldIsPointer = v.extractTypeInternal(current, false) + var isNestedStruct bool + switch kind { case reflect.Ptr, reflect.Interface, reflect.Invalid: @@ -110,6 +113,14 @@ func (v *validate) traverseField(ctx context.Context, parent reflect.Value, curr return } + if ct.typeof == typeOmitNil && (kind != reflect.Invalid && current.IsNil()) { + return + } + + if ct.typeof == typeOmitZero { + return + } + if ct.hasTag { if kind == reflect.Invalid { v.str1 = string(append(ns, cf.altName...)) @@ -150,7 +161,7 @@ func (v *validate) traverseField(ctx context.Context, parent reflect.Value, curr structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: current.Type(), @@ -160,86 +171,61 @@ func (v *validate) traverseField(ctx context.Context, parent reflect.Value, curr } } - case reflect.Struct: - - typ = current.Type() - - if typ != timeType { - - if ct != nil { - - if ct.typeof == typeStructOnly { - goto CONTINUE - } else if ct.typeof == typeIsDefault { - // set Field Level fields - v.slflParent = parent - v.flField = current - v.cf = cf - v.ct = ct - - if !ct.fn(ctx, v) { - v.str1 = string(append(ns, cf.altName...)) - - if v.v.hasTagNameFunc { - v.str2 = string(append(structNs, cf.name...)) - } else { - v.str2 = v.str1 - } - - v.errs = append(v.errs, - &fieldError{ - v: v.v, - tag: ct.aliasTag, - actualTag: ct.tag, - ns: v.str1, - structNs: v.str2, - fieldLen: uint8(len(cf.altName)), - structfieldLen: uint8(len(cf.name)), - value: current.Interface(), - param: ct.param, - kind: kind, - typ: typ, - }, - ) - return - } - } - - ct = ct.next - } - - if ct != nil && ct.typeof == typeNoStructLevel { - return - } - - CONTINUE: - // if len == 0 then validating using 'Var' or 'VarWithValue' - // Var - doesn't make much sense to do it that way, should call 'Struct', but no harm... - // VarWithField - this allows for validating against each field within the struct against a specific value - // pretty handy in certain situations - if len(cf.name) > 0 { - ns = append(append(ns, cf.altName...), '.') - structNs = append(append(structNs, cf.name...), '.') - } - - v.validateStruct(ctx, parent, current, typ, ns, structNs, ct) + if kind == reflect.Invalid { return } - } - if ct == nil || !ct.hasTag { - return + case reflect.Struct: + isNestedStruct = !current.Type().ConvertibleTo(timeType) + // For backward compatibility before struct level validation tags were supported + // as there were a number of projects relying on `required` not failing on non-pointer + // structs. Since it's basically nonsensical to use `required` with a non-pointer struct + // are explicitly skipping the required validation for it. This WILL be removed in the + // next major version. + if isNestedStruct && !v.v.requiredStructEnabled && ct != nil && ct.tag == requiredTag { + ct = ct.next + } } typ = current.Type() OUTER: for { - if ct == nil { + if ct == nil || !ct.hasTag || (isNestedStruct && len(cf.name) == 0) { + // isNestedStruct check here + if isNestedStruct { + // if len == 0 then validating using 'Var' or 'VarWithValue' + // Var - doesn't make much sense to do it that way, should call 'Struct', but no harm... + // VarWithField - this allows for validating against each field within the struct against a specific value + // pretty handy in certain situations + if len(cf.name) > 0 { + ns = append(append(ns, cf.altName...), '.') + structNs = append(append(structNs, cf.name...), '.') + } + + v.validateStruct(ctx, parent, current, typ, ns, structNs, ct) + } return } switch ct.typeof { + case typeNoStructLevel: + return + + case typeStructOnly: + if isNestedStruct { + // if len == 0 then validating using 'Var' or 'VarWithValue' + // Var - doesn't make much sense to do it that way, should call 'Struct', but no harm... + // VarWithField - this allows for validating against each field within the struct against a specific value + // pretty handy in certain situations + if len(cf.name) > 0 { + ns = append(append(ns, cf.altName...), '.') + structNs = append(append(structNs, cf.name...), '.') + } + + v.validateStruct(ctx, parent, current, typ, ns, structNs, ct) + } + return case typeOmitEmpty: @@ -256,6 +242,39 @@ OUTER: ct = ct.next continue + case typeOmitZero: + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + if !hasNotZeroValue(v) { + return + } + + ct = ct.next + continue + + case typeOmitNil: + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + switch field := v.Field(); field.Kind() { + case reflect.Slice, reflect.Map, reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: + if field.IsNil() { + return + } + default: + if v.fldIsPointer && field.Interface() == nil { + return + } + } + + ct = ct.next + continue + case typeEndKeys: return @@ -355,6 +374,10 @@ OUTER: v.ct = ct if ct.fn(ctx, v) { + if ct.isBlockEnd { + ct = ct.next + continue OUTER + } // drain rest of the 'or' values, then continue or leave for { @@ -362,12 +385,17 @@ OUTER: ct = ct.next if ct == nil { - return + continue OUTER } if ct.typeof != typeOr { continue OUTER } + + if ct.isBlockEnd { + ct = ct.next + continue OUTER + } } } @@ -400,7 +428,7 @@ OUTER: structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: typ, @@ -420,7 +448,7 @@ OUTER: structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: typ, @@ -443,7 +471,6 @@ OUTER: v.ct = ct if !ct.fn(ctx, v) { - v.str1 = string(append(ns, cf.altName...)) if v.v.hasTagNameFunc { @@ -461,7 +488,7 @@ OUTER: structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: typ, @@ -475,3 +502,26 @@ OUTER: } } + +func getValue(val reflect.Value) interface{} { + if val.CanInterface() { + return val.Interface() + } + + if val.CanAddr() { + return reflect.NewAt(val.Type(), unsafe.Pointer(val.UnsafeAddr())).Elem().Interface() + } + + switch val.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return val.Int() + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return val.Uint() + case reflect.Complex64, reflect.Complex128: + return val.Complex() + case reflect.Float32, reflect.Float64: + return val.Float() + default: + return val.String() + } +} diff --git a/vendor/github.com/go-playground/validator/v10/validator_instance.go b/vendor/github.com/go-playground/validator/v10/validator_instance.go index 973964fc..779f689a 100644 --- a/vendor/github.com/go-playground/validator/v10/validator_instance.go +++ b/vendor/github.com/go-playground/validator/v10/validator_instance.go @@ -21,7 +21,9 @@ const ( tagKeySeparator = "=" structOnlyTag = "structonly" noStructLevelTag = "nostructlevel" + omitzero = "omitzero" omitempty = "omitempty" + omitnil = "omitnil" isdefault = "isdefault" requiredWithoutAllTag = "required_without_all" requiredWithoutTag = "required_without" @@ -29,10 +31,13 @@ const ( requiredWithAllTag = "required_with_all" requiredIfTag = "required_if" requiredUnlessTag = "required_unless" + skipUnlessTag = "skip_unless" excludedWithoutAllTag = "excluded_without_all" excludedWithoutTag = "excluded_without" excludedWithTag = "excluded_with" excludedWithAllTag = "excluded_with_all" + excludedIfTag = "excluded_if" + excludedUnlessTag = "excluded_unless" skipValidationTag = "-" diveTag = "dive" keysTag = "keys" @@ -50,12 +55,14 @@ var ( timeDurationType = reflect.TypeOf(time.Duration(0)) timeType = reflect.TypeOf(time.Time{}) + byteSliceType = reflect.TypeOf([]byte{}) + defaultCField = &cField{namesEqual: true} ) // FilterFunc is the type used to filter fields using // StructFiltered(...) function. -// returning true results in the field being filtered/skiped from +// returning true results in the field being filtered/skipped from // validation type FilterFunc func(ns []byte) bool @@ -68,24 +75,27 @@ type CustomTypeFunc func(field reflect.Value) interface{} type TagNameFunc func(field reflect.StructField) string type internalValidationFuncWrapper struct { - fn FuncCtx - runValidatinOnNil bool + fn FuncCtx + runValidationOnNil bool } // Validate contains the validator settings and cache type Validate struct { - tagName string - pool *sync.Pool - hasCustomFuncs bool - hasTagNameFunc bool - tagNameFunc TagNameFunc - structLevelFuncs map[reflect.Type]StructLevelFuncCtx - customFuncs map[reflect.Type]CustomTypeFunc - aliases map[string]string - validations map[string]internalValidationFuncWrapper - transTagFunc map[ut.Translator]map[string]TranslationFunc // map[]map[]TranslationFunc - tagCache *tagCache - structCache *structCache + tagName string + pool *sync.Pool + tagNameFunc TagNameFunc + structLevelFuncs map[reflect.Type]StructLevelFuncCtx + customFuncs map[reflect.Type]CustomTypeFunc + aliases map[string]string + validations map[string]internalValidationFuncWrapper + transTagFunc map[ut.Translator]map[string]TranslationFunc // map[]map[]TranslationFunc + rules map[reflect.Type]map[string]string + tagCache *tagCache + structCache *structCache + hasCustomFuncs bool + hasTagNameFunc bool + requiredStructEnabled bool + privateFieldValidation bool } // New returns a new instance of 'validate' with sane defaults. @@ -93,7 +103,7 @@ type Validate struct { // It caches information about your struct and validations, // in essence only parsing your validation tags once per struct type. // Using multiple instances neglects the benefit of caching. -func New() *Validate { +func New(options ...Option) *Validate { tc := new(tagCache) tc.m.Store(make(map[string]*cTag)) @@ -120,7 +130,8 @@ func New() *Validate { switch k { // these require that even if the value is nil that the validation should run, omitempty still overrides this behaviour case requiredIfTag, requiredUnlessTag, requiredWithTag, requiredWithAllTag, requiredWithoutTag, requiredWithoutAllTag, - excludedWithTag, excludedWithAllTag, excludedWithoutTag, excludedWithoutAllTag: + excludedIfTag, excludedUnlessTag, excludedWithTag, excludedWithAllTag, excludedWithoutTag, excludedWithoutAllTag, + skipUnlessTag: _ = v.registerValidation(k, wrapFunc(val), true, true) default: // no need to error check here, baked in will always be valid @@ -139,6 +150,9 @@ func New() *Validate { }, } + for _, o := range options { + o(v) + } return v } @@ -148,19 +162,28 @@ func (v *Validate) SetTagName(name string) { } // ValidateMapCtx validates a map using a map of validation rules and allows passing of contextual -// validation validation information via context.Context. +// validation information via context.Context. func (v Validate) ValidateMapCtx(ctx context.Context, data map[string]interface{}, rules map[string]interface{}) map[string]interface{} { errs := make(map[string]interface{}) for field, rule := range rules { - if reflect.ValueOf(rule).Kind() == reflect.Map && reflect.ValueOf(data[field]).Kind() == reflect.Map { - err := v.ValidateMapCtx(ctx, data[field].(map[string]interface{}), rule.(map[string]interface{})) - if len(err) > 0 { - errs[field] = err + if ruleObj, ok := rule.(map[string]interface{}); ok { + if dataObj, ok := data[field].(map[string]interface{}); ok { + err := v.ValidateMapCtx(ctx, dataObj, ruleObj) + if len(err) > 0 { + errs[field] = err + } + } else if dataObjs, ok := data[field].([]map[string]interface{}); ok { + for _, obj := range dataObjs { + err := v.ValidateMapCtx(ctx, obj, ruleObj) + if len(err) > 0 { + errs[field] = err + } + } + } else { + errs[field] = errors.New("The field: '" + field + "' is not a map to dive") } - } else if reflect.ValueOf(rule).Kind() == reflect.Map { - errs[field] = errors.New("The field: '" + field + "' is not a map to dive") - } else { - err := v.VarCtx(ctx, data[field], rule.(string)) + } else if ruleStr, ok := rule.(string); ok { + err := v.VarCtx(ctx, data[field], ruleStr) if err != nil { errs[field] = err } @@ -169,7 +192,7 @@ func (v Validate) ValidateMapCtx(ctx context.Context, data map[string]interface{ return errs } -// ValidateMap validates map data form a map of tags +// ValidateMap validates map data from a map of tags func (v *Validate) ValidateMap(data map[string]interface{}, rules map[string]interface{}) map[string]interface{} { return v.ValidateMapCtx(context.Background(), data, rules) } @@ -178,13 +201,14 @@ func (v *Validate) ValidateMap(data map[string]interface{}, rules map[string]int // // eg. to use the names which have been specified for JSON representations of structs, rather than normal Go field names: // -// validate.RegisterTagNameFunc(func(fld reflect.StructField) string { -// name := strings.SplitN(fld.Tag.Get("json"), ",", 2)[0] -// if name == "-" { -// return "" -// } -// return name -// }) +// validate.RegisterTagNameFunc(func(fld reflect.StructField) string { +// name := strings.SplitN(fld.Tag.Get("json"), ",", 2)[0] +// // skip if tag key says it should be ignored +// if name == "-" { +// return "" +// } +// return name +// }) func (v *Validate) RegisterTagNameFunc(fn TagNameFunc) { v.tagNameFunc = fn v.hasTagNameFunc = true @@ -222,7 +246,7 @@ func (v *Validate) registerValidation(tag string, fn FuncCtx, bakedIn bool, nilC if !bakedIn && (ok || strings.ContainsAny(tag, restrictedTagChars)) { panic(fmt.Sprintf(restrictedTagErr, tag)) } - v.validations[tag] = internalValidationFuncWrapper{fn: fn, runValidatinOnNil: nilCheckable} + v.validations[tag] = internalValidationFuncWrapper{fn: fn, runValidationOnNil: nilCheckable} return nil } @@ -271,6 +295,34 @@ func (v *Validate) RegisterStructValidationCtx(fn StructLevelFuncCtx, types ...i } } +// RegisterStructValidationMapRules registers validate map rules. +// Be aware that map validation rules supersede those defined on a/the struct if present. +// +// NOTE: this method is not thread-safe it is intended that these all be registered prior to any validation +func (v *Validate) RegisterStructValidationMapRules(rules map[string]string, types ...interface{}) { + if v.rules == nil { + v.rules = make(map[reflect.Type]map[string]string) + } + + deepCopyRules := make(map[string]string) + for i, rule := range rules { + deepCopyRules[i] = rule + } + + for _, t := range types { + typ := reflect.TypeOf(t) + + if typ.Kind() == reflect.Ptr { + typ = typ.Elem() + } + + if typ.Kind() != reflect.Struct { + continue + } + v.rules[typ] = deepCopyRules + } +} + // RegisterCustomTypeFunc registers a CustomTypeFunc against a number of types // // NOTE: this method is not thread-safe it is intended that these all be registered prior to any validation @@ -331,7 +383,7 @@ func (v *Validate) StructCtx(ctx context.Context, s interface{}) (err error) { val = val.Elem() } - if val.Kind() != reflect.Struct || val.Type() == timeType { + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { return &InvalidValidationError{Type: reflect.TypeOf(s)} } @@ -376,7 +428,7 @@ func (v *Validate) StructFilteredCtx(ctx context.Context, s interface{}, fn Filt val = val.Elem() } - if val.Kind() != reflect.Struct || val.Type() == timeType { + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { return &InvalidValidationError{Type: reflect.TypeOf(s)} } @@ -410,7 +462,7 @@ func (v *Validate) StructPartial(s interface{}, fields ...string) error { } // StructPartialCtx validates the fields passed in only, ignoring all others and allows passing of contextual -// validation validation information via context.Context +// validation information via context.Context // Fields may be provided in a namespaced fashion relative to the struct provided // eg. NestedStruct.Field or NestedArrayField[0].Struct.Name // @@ -424,7 +476,7 @@ func (v *Validate) StructPartialCtx(ctx context.Context, s interface{}, fields . val = val.Elem() } - if val.Kind() != reflect.Struct || val.Type() == timeType { + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { return &InvalidValidationError{Type: reflect.TypeOf(s)} } @@ -500,7 +552,7 @@ func (v *Validate) StructExcept(s interface{}, fields ...string) error { } // StructExceptCtx validates all fields except the ones passed in and allows passing of contextual -// validation validation information via context.Context +// validation information via context.Context // Fields may be provided in a namespaced fashion relative to the struct provided // i.e. NestedStruct.Field or NestedArrayField[0].Struct.Name // @@ -514,7 +566,7 @@ func (v *Validate) StructExceptCtx(ctx context.Context, s interface{}, fields .. val = val.Elem() } - if val.Kind() != reflect.Struct || val.Type() == timeType { + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { return &InvalidValidationError{Type: reflect.TypeOf(s)} } @@ -572,7 +624,7 @@ func (v *Validate) Var(field interface{}, tag string) error { } // VarCtx validates a single variable using tag style validation and allows passing of contextual -// validation validation information via context.Context. +// validation information via context.Context. // eg. // var i int // validate.Var(i, "gt=1,lt=10") @@ -591,6 +643,7 @@ func (v *Validate) VarCtx(ctx context.Context, field interface{}, tag string) (e } ctag := v.fetchCacheTag(tag) + val := reflect.ValueOf(field) vd := v.pool.Get().(*validate) vd.top = val @@ -624,7 +677,7 @@ func (v *Validate) VarWithValue(field interface{}, other interface{}, tag string } // VarWithValueCtx validates a single variable, against another variable/field's value using tag style validation and -// allows passing of contextual validation validation information via context.Context. +// allows passing of contextual validation information via context.Context. // eg. // s1 := "abcd" // s2 := "abcd" diff --git a/vendor/github.com/goccy/go-json/.golangci.yml b/vendor/github.com/goccy/go-json/.golangci.yml index 57ae5a52..977accaa 100644 --- a/vendor/github.com/goccy/go-json/.golangci.yml +++ b/vendor/github.com/goccy/go-json/.golangci.yml @@ -56,6 +56,9 @@ linters: - cyclop - containedctx - revive + - nosnakecase + - exhaustruct + - depguard issues: exclude-rules: diff --git a/vendor/github.com/goccy/go-json/CHANGELOG.md b/vendor/github.com/goccy/go-json/CHANGELOG.md index 9139b9b2..d09bb89c 100644 --- a/vendor/github.com/goccy/go-json/CHANGELOG.md +++ b/vendor/github.com/goccy/go-json/CHANGELOG.md @@ -1,3 +1,89 @@ +# v0.10.2 - 2023/03/20 + +### New features + +* Support DebugDOT option for debugging encoder ( #440 ) + +### Fix bugs + +* Fix combination of embedding structure and omitempty option ( #442 ) + +# v0.10.1 - 2023/03/13 + +### Fix bugs + +* Fix checkptr error for array decoder ( #415 ) +* Fix added buffer size check when decoding key ( #430 ) +* Fix handling of anonymous fields other than struct ( #431 ) +* Fix to not optimize when lower conversion can't handle byte-by-byte ( #432 ) +* Fix a problem that MarshalIndent does not work when UnorderedMap is specified ( #435 ) +* Fix mapDecoder.DecodeStream() for empty objects containing whitespace ( #425 ) +* Fix an issue that could not set the correct NextField for fields in the embedded structure ( #438 ) + +# v0.10.0 - 2022/11/29 + +### New features + +* Support JSON Path ( #250 ) + +### Fix bugs + +* Fix marshaler for map's key ( #409 ) + +# v0.9.11 - 2022/08/18 + +### Fix bugs + +* Fix unexpected behavior when buffer ends with backslash ( #383 ) +* Fix stream decoding of escaped character ( #387 ) + +# v0.9.10 - 2022/07/15 + +### Fix bugs + +* Fix boundary exception of type caching ( #382 ) + +# v0.9.9 - 2022/07/15 + +### Fix bugs + +* Fix encoding of directed interface with typed nil ( #377 ) +* Fix embedded primitive type encoding using alias ( #378 ) +* Fix slice/array type encoding with types implementing MarshalJSON ( #379 ) +* Fix unicode decoding when the expected buffer state is not met after reading ( #380 ) + +# v0.9.8 - 2022/06/30 + +### Fix bugs + +* Fix decoding of surrogate-pair ( #365 ) +* Fix handling of embedded primitive type ( #366 ) +* Add validation of escape sequence for decoder ( #367 ) +* Fix stream tokenizing respecting UseNumber ( #369 ) +* Fix encoding when struct pointer type that implements Marshal JSON is embedded ( #375 ) + +### Improve performance + +* Improve performance of linkRecursiveCode ( #368 ) + +# v0.9.7 - 2022/04/22 + +### Fix bugs + +#### Encoder + +* Add filtering process for encoding on slow path ( #355 ) +* Fix encoding of interface{} with pointer type ( #363 ) + +#### Decoder + +* Fix map key decoder that implements UnmarshalJSON ( #353 ) +* Fix decoding of []uint8 type ( #361 ) + +### New features + +* Add DebugWith option for encoder ( #356 ) + # v0.9.6 - 2022/03/22 ### Fix bugs diff --git a/vendor/github.com/goccy/go-json/Makefile b/vendor/github.com/goccy/go-json/Makefile index 363563ab..c030577d 100644 --- a/vendor/github.com/goccy/go-json/Makefile +++ b/vendor/github.com/goccy/go-json/Makefile @@ -22,7 +22,7 @@ cover-html: cover .PHONY: lint lint: golangci-lint - golangci-lint run + $(BIN_DIR)/golangci-lint run golangci-lint: | $(BIN_DIR) @{ \ @@ -30,7 +30,7 @@ golangci-lint: | $(BIN_DIR) GOLANGCI_LINT_TMP_DIR=$$(mktemp -d); \ cd $$GOLANGCI_LINT_TMP_DIR; \ go mod init tmp; \ - GOBIN=$(BIN_DIR) go get github.com/golangci/golangci-lint/cmd/golangci-lint@v1.36.0; \ + GOBIN=$(BIN_DIR) go install github.com/golangci/golangci-lint/cmd/golangci-lint@v1.54.2; \ rm -rf $$GOLANGCI_LINT_TMP_DIR; \ } diff --git a/vendor/github.com/goccy/go-json/README.md b/vendor/github.com/goccy/go-json/README.md index 56862377..7bacc54f 100644 --- a/vendor/github.com/goccy/go-json/README.md +++ b/vendor/github.com/goccy/go-json/README.md @@ -184,7 +184,7 @@ func Marshal(v interface{}) ([]byte, error) { `json.Marshal` and `json.Unmarshal` receive `interface{}` value and they perform type determination dynamically to process. In normal case, you need to use the `reflect` library to determine the type dynamically, but since `reflect.Type` is defined as `interface`, when you call the method of `reflect.Type`, The reflect's argument is escaped. -Therefore, the arguments for `Marshal` and `Unmarshal` are always escape to the heap. +Therefore, the arguments for `Marshal` and `Unmarshal` are always escaped to the heap. However, `go-json` can use the feature of `reflect.Type` while avoiding escaping. `reflect.Type` is defined as `interface`, but in reality `reflect.Type` is implemented only by the structure `rtype` defined in the `reflect` package. diff --git a/vendor/github.com/goccy/go-json/decode.go b/vendor/github.com/goccy/go-json/decode.go index d99749d0..74c6ac3b 100644 --- a/vendor/github.com/goccy/go-json/decode.go +++ b/vendor/github.com/goccy/go-json/decode.go @@ -83,6 +83,37 @@ func unmarshalContext(ctx context.Context, data []byte, v interface{}, optFuncs return validateEndBuf(src, cursor) } +var ( + pathDecoder = decoder.NewPathDecoder() +) + +func extractFromPath(path *Path, data []byte, optFuncs ...DecodeOptionFunc) ([][]byte, error) { + if path.path.RootSelectorOnly { + return [][]byte{data}, nil + } + src := make([]byte, len(data)+1) // append nul byte to the end + copy(src, data) + + ctx := decoder.TakeRuntimeContext() + ctx.Buf = src + ctx.Option.Flags = 0 + ctx.Option.Flags |= decoder.PathOption + ctx.Option.Path = path.path + for _, optFunc := range optFuncs { + optFunc(ctx.Option) + } + paths, cursor, err := pathDecoder.DecodePath(ctx, 0, 0) + if err != nil { + decoder.ReleaseRuntimeContext(ctx) + return nil, err + } + decoder.ReleaseRuntimeContext(ctx) + if err := validateEndBuf(src, cursor); err != nil { + return nil, err + } + return paths, nil +} + func unmarshalNoEscape(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { src := make([]byte, len(data)+1) // append nul byte to the end copy(src, data) diff --git a/vendor/github.com/goccy/go-json/encode.go b/vendor/github.com/goccy/go-json/encode.go index 4bd899f3..c5173825 100644 --- a/vendor/github.com/goccy/go-json/encode.go +++ b/vendor/github.com/goccy/go-json/encode.go @@ -52,7 +52,7 @@ func (e *Encoder) EncodeContext(ctx context.Context, v interface{}, optFuncs ... rctx.Option.Flag |= encoder.ContextOption rctx.Option.Context = ctx - err := e.encodeWithOption(rctx, v, optFuncs...) + err := e.encodeWithOption(rctx, v, optFuncs...) //nolint: contextcheck encoder.ReleaseRuntimeContext(rctx) return err @@ -120,7 +120,7 @@ func marshalContext(ctx context.Context, v interface{}, optFuncs ...EncodeOption optFunc(rctx.Option) } - buf, err := encode(rctx, v) + buf, err := encode(rctx, v) //nolint: contextcheck if err != nil { encoder.ReleaseRuntimeContext(rctx) return nil, err diff --git a/vendor/github.com/goccy/go-json/error.go b/vendor/github.com/goccy/go-json/error.go index 94c1339a..5b2dcee5 100644 --- a/vendor/github.com/goccy/go-json/error.go +++ b/vendor/github.com/goccy/go-json/error.go @@ -37,3 +37,5 @@ type UnmarshalTypeError = errors.UnmarshalTypeError type UnsupportedTypeError = errors.UnsupportedTypeError type UnsupportedValueError = errors.UnsupportedValueError + +type PathError = errors.PathError diff --git a/vendor/github.com/goccy/go-json/internal/decoder/anonymous_field.go b/vendor/github.com/goccy/go-json/internal/decoder/anonymous_field.go index 030cb7a9..b6876cf0 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/anonymous_field.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/anonymous_field.go @@ -35,3 +35,7 @@ func (d *anonymousFieldDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p = *(*unsafe.Pointer)(p) return d.dec.Decode(ctx, cursor, depth, unsafe.Pointer(uintptr(p)+d.offset)) } + +func (d *anonymousFieldDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return d.dec.DecodePath(ctx, cursor, depth) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/array.go b/vendor/github.com/goccy/go-json/internal/decoder/array.go index 21f1fd58..4b23ed43 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/array.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/array.go @@ -1,6 +1,7 @@ package decoder import ( + "fmt" "unsafe" "github.com/goccy/go-json/internal/errors" @@ -18,7 +19,9 @@ type arrayDecoder struct { } func newArrayDecoder(dec Decoder, elemType *runtime.Type, alen int, structName, fieldName string) *arrayDecoder { - zeroValue := *(*unsafe.Pointer)(unsafe_New(elemType)) + // workaround to avoid checkptr errors. cannot use `*(*unsafe.Pointer)(unsafe_New(elemType))` directly. + zeroValuePtr := unsafe_New(elemType) + zeroValue := **(**unsafe.Pointer)(unsafe.Pointer(&zeroValuePtr)) return &arrayDecoder{ valueDecoder: dec, elemType: elemType, @@ -167,3 +170,7 @@ func (d *arrayDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe } } } + +func (d *arrayDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: array decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/assign.go b/vendor/github.com/goccy/go-json/internal/decoder/assign.go new file mode 100644 index 00000000..c53e6ad9 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/assign.go @@ -0,0 +1,438 @@ +package decoder + +import ( + "fmt" + "reflect" + "strconv" +) + +var ( + nilValue = reflect.ValueOf(nil) +) + +func AssignValue(src, dst reflect.Value) error { + if dst.Type().Kind() != reflect.Ptr { + return fmt.Errorf("invalid dst type. required pointer type: %T", dst.Type()) + } + casted, err := castValue(dst.Elem().Type(), src) + if err != nil { + return err + } + dst.Elem().Set(casted) + return nil +} + +func castValue(t reflect.Type, v reflect.Value) (reflect.Value, error) { + switch t.Kind() { + case reflect.Int: + vv, err := castInt(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(int(vv.Int())), nil + case reflect.Int8: + vv, err := castInt(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(int8(vv.Int())), nil + case reflect.Int16: + vv, err := castInt(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(int16(vv.Int())), nil + case reflect.Int32: + vv, err := castInt(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(int32(vv.Int())), nil + case reflect.Int64: + return castInt(v) + case reflect.Uint: + vv, err := castUint(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(uint(vv.Uint())), nil + case reflect.Uint8: + vv, err := castUint(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(uint8(vv.Uint())), nil + case reflect.Uint16: + vv, err := castUint(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(uint16(vv.Uint())), nil + case reflect.Uint32: + vv, err := castUint(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(uint32(vv.Uint())), nil + case reflect.Uint64: + return castUint(v) + case reflect.Uintptr: + vv, err := castUint(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(uintptr(vv.Uint())), nil + case reflect.String: + return castString(v) + case reflect.Bool: + return castBool(v) + case reflect.Float32: + vv, err := castFloat(v) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(float32(vv.Float())), nil + case reflect.Float64: + return castFloat(v) + case reflect.Array: + return castArray(t, v) + case reflect.Slice: + return castSlice(t, v) + case reflect.Map: + return castMap(t, v) + case reflect.Struct: + return castStruct(t, v) + } + return v, nil +} + +func castInt(v reflect.Value) (reflect.Value, error) { + switch v.Type().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return v, nil + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return reflect.ValueOf(int64(v.Uint())), nil + case reflect.String: + i64, err := strconv.ParseInt(v.String(), 10, 64) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(i64), nil + case reflect.Bool: + if v.Bool() { + return reflect.ValueOf(int64(1)), nil + } + return reflect.ValueOf(int64(0)), nil + case reflect.Float32, reflect.Float64: + return reflect.ValueOf(int64(v.Float())), nil + case reflect.Array: + if v.Len() > 0 { + return castInt(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to int64 from empty array") + case reflect.Slice: + if v.Len() > 0 { + return castInt(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to int64 from empty slice") + case reflect.Interface: + return castInt(reflect.ValueOf(v.Interface())) + case reflect.Map: + return nilValue, fmt.Errorf("failed to cast to int64 from map") + case reflect.Struct: + return nilValue, fmt.Errorf("failed to cast to int64 from struct") + case reflect.Ptr: + return castInt(v.Elem()) + } + return nilValue, fmt.Errorf("failed to cast to int64 from %s", v.Type().Kind()) +} + +func castUint(v reflect.Value) (reflect.Value, error) { + switch v.Type().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return reflect.ValueOf(uint64(v.Int())), nil + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return v, nil + case reflect.String: + u64, err := strconv.ParseUint(v.String(), 10, 64) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(u64), nil + case reflect.Bool: + if v.Bool() { + return reflect.ValueOf(uint64(1)), nil + } + return reflect.ValueOf(uint64(0)), nil + case reflect.Float32, reflect.Float64: + return reflect.ValueOf(uint64(v.Float())), nil + case reflect.Array: + if v.Len() > 0 { + return castUint(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to uint64 from empty array") + case reflect.Slice: + if v.Len() > 0 { + return castUint(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to uint64 from empty slice") + case reflect.Interface: + return castUint(reflect.ValueOf(v.Interface())) + case reflect.Map: + return nilValue, fmt.Errorf("failed to cast to uint64 from map") + case reflect.Struct: + return nilValue, fmt.Errorf("failed to cast to uint64 from struct") + case reflect.Ptr: + return castUint(v.Elem()) + } + return nilValue, fmt.Errorf("failed to cast to uint64 from %s", v.Type().Kind()) +} + +func castString(v reflect.Value) (reflect.Value, error) { + switch v.Type().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return reflect.ValueOf(fmt.Sprint(v.Int())), nil + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return reflect.ValueOf(fmt.Sprint(v.Uint())), nil + case reflect.String: + return v, nil + case reflect.Bool: + if v.Bool() { + return reflect.ValueOf("true"), nil + } + return reflect.ValueOf("false"), nil + case reflect.Float32, reflect.Float64: + return reflect.ValueOf(fmt.Sprint(v.Float())), nil + case reflect.Array: + if v.Len() > 0 { + return castString(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to string from empty array") + case reflect.Slice: + if v.Len() > 0 { + return castString(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to string from empty slice") + case reflect.Interface: + return castString(reflect.ValueOf(v.Interface())) + case reflect.Map: + return nilValue, fmt.Errorf("failed to cast to string from map") + case reflect.Struct: + return nilValue, fmt.Errorf("failed to cast to string from struct") + case reflect.Ptr: + return castString(v.Elem()) + } + return nilValue, fmt.Errorf("failed to cast to string from %s", v.Type().Kind()) +} + +func castBool(v reflect.Value) (reflect.Value, error) { + switch v.Type().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + switch v.Int() { + case 0: + return reflect.ValueOf(false), nil + case 1: + return reflect.ValueOf(true), nil + } + return nilValue, fmt.Errorf("failed to cast to bool from %d", v.Int()) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + switch v.Uint() { + case 0: + return reflect.ValueOf(false), nil + case 1: + return reflect.ValueOf(true), nil + } + return nilValue, fmt.Errorf("failed to cast to bool from %d", v.Uint()) + case reflect.String: + b, err := strconv.ParseBool(v.String()) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(b), nil + case reflect.Bool: + return v, nil + case reflect.Float32, reflect.Float64: + switch v.Float() { + case 0: + return reflect.ValueOf(false), nil + case 1: + return reflect.ValueOf(true), nil + } + return nilValue, fmt.Errorf("failed to cast to bool from %f", v.Float()) + case reflect.Array: + if v.Len() > 0 { + return castBool(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to string from empty array") + case reflect.Slice: + if v.Len() > 0 { + return castBool(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to string from empty slice") + case reflect.Interface: + return castBool(reflect.ValueOf(v.Interface())) + case reflect.Map: + return nilValue, fmt.Errorf("failed to cast to string from map") + case reflect.Struct: + return nilValue, fmt.Errorf("failed to cast to string from struct") + case reflect.Ptr: + return castBool(v.Elem()) + } + return nilValue, fmt.Errorf("failed to cast to bool from %s", v.Type().Kind()) +} + +func castFloat(v reflect.Value) (reflect.Value, error) { + switch v.Type().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return reflect.ValueOf(float64(v.Int())), nil + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return reflect.ValueOf(float64(v.Uint())), nil + case reflect.String: + f64, err := strconv.ParseFloat(v.String(), 64) + if err != nil { + return nilValue, err + } + return reflect.ValueOf(f64), nil + case reflect.Bool: + if v.Bool() { + return reflect.ValueOf(float64(1)), nil + } + return reflect.ValueOf(float64(0)), nil + case reflect.Float32, reflect.Float64: + return v, nil + case reflect.Array: + if v.Len() > 0 { + return castFloat(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to float64 from empty array") + case reflect.Slice: + if v.Len() > 0 { + return castFloat(v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to float64 from empty slice") + case reflect.Interface: + return castFloat(reflect.ValueOf(v.Interface())) + case reflect.Map: + return nilValue, fmt.Errorf("failed to cast to float64 from map") + case reflect.Struct: + return nilValue, fmt.Errorf("failed to cast to float64 from struct") + case reflect.Ptr: + return castFloat(v.Elem()) + } + return nilValue, fmt.Errorf("failed to cast to float64 from %s", v.Type().Kind()) +} + +func castArray(t reflect.Type, v reflect.Value) (reflect.Value, error) { + kind := v.Type().Kind() + if kind == reflect.Interface { + return castArray(t, reflect.ValueOf(v.Interface())) + } + if kind != reflect.Slice && kind != reflect.Array { + return nilValue, fmt.Errorf("failed to cast to array from %s", kind) + } + if t.Elem() == v.Type().Elem() { + return v, nil + } + if t.Len() != v.Len() { + return nilValue, fmt.Errorf("failed to cast [%d]array from slice of %d length", t.Len(), v.Len()) + } + ret := reflect.New(t).Elem() + for i := 0; i < v.Len(); i++ { + vv, err := castValue(t.Elem(), v.Index(i)) + if err != nil { + return nilValue, err + } + ret.Index(i).Set(vv) + } + return ret, nil +} + +func castSlice(t reflect.Type, v reflect.Value) (reflect.Value, error) { + kind := v.Type().Kind() + if kind == reflect.Interface { + return castSlice(t, reflect.ValueOf(v.Interface())) + } + if kind != reflect.Slice && kind != reflect.Array { + return nilValue, fmt.Errorf("failed to cast to slice from %s", kind) + } + if t.Elem() == v.Type().Elem() { + return v, nil + } + ret := reflect.MakeSlice(t, v.Len(), v.Len()) + for i := 0; i < v.Len(); i++ { + vv, err := castValue(t.Elem(), v.Index(i)) + if err != nil { + return nilValue, err + } + ret.Index(i).Set(vv) + } + return ret, nil +} + +func castMap(t reflect.Type, v reflect.Value) (reflect.Value, error) { + ret := reflect.MakeMap(t) + switch v.Type().Kind() { + case reflect.Map: + iter := v.MapRange() + for iter.Next() { + key, err := castValue(t.Key(), iter.Key()) + if err != nil { + return nilValue, err + } + value, err := castValue(t.Elem(), iter.Value()) + if err != nil { + return nilValue, err + } + ret.SetMapIndex(key, value) + } + return ret, nil + case reflect.Interface: + return castMap(t, reflect.ValueOf(v.Interface())) + case reflect.Slice: + if v.Len() > 0 { + return castMap(t, v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to map from empty slice") + } + return nilValue, fmt.Errorf("failed to cast to map from %s", v.Type().Kind()) +} + +func castStruct(t reflect.Type, v reflect.Value) (reflect.Value, error) { + ret := reflect.New(t).Elem() + switch v.Type().Kind() { + case reflect.Map: + iter := v.MapRange() + for iter.Next() { + key := iter.Key() + k, err := castString(key) + if err != nil { + return nilValue, err + } + fieldName := k.String() + field, ok := t.FieldByName(fieldName) + if ok { + value, err := castValue(field.Type, iter.Value()) + if err != nil { + return nilValue, err + } + ret.FieldByName(fieldName).Set(value) + } + } + return ret, nil + case reflect.Struct: + for i := 0; i < v.Type().NumField(); i++ { + name := v.Type().Field(i).Name + ret.FieldByName(name).Set(v.FieldByName(name)) + } + return ret, nil + case reflect.Interface: + return castStruct(t, reflect.ValueOf(v.Interface())) + case reflect.Slice: + if v.Len() > 0 { + return castStruct(t, v.Index(0)) + } + return nilValue, fmt.Errorf("failed to cast to struct from empty slice") + default: + return nilValue, fmt.Errorf("failed to cast to struct from %s", v.Type().Kind()) + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/bool.go b/vendor/github.com/goccy/go-json/internal/decoder/bool.go index 455042a5..ba6cf5bc 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/bool.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/bool.go @@ -1,6 +1,7 @@ package decoder import ( + "fmt" "unsafe" "github.com/goccy/go-json/internal/errors" @@ -76,3 +77,7 @@ func (d *boolDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe. } return 0, errors.ErrUnexpectedEndOfJSON("bool", cursor) } + +func (d *boolDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: bool decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/bytes.go b/vendor/github.com/goccy/go-json/internal/decoder/bytes.go index 92c7dcf6..939bf432 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/bytes.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/bytes.go @@ -2,6 +2,7 @@ package decoder import ( "encoding/base64" + "fmt" "unsafe" "github.com/goccy/go-json/internal/errors" @@ -78,6 +79,10 @@ func (d *bytesDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe return cursor, nil } +func (d *bytesDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: []byte decoder does not support decode path") +} + func (d *bytesDecoder) decodeStreamBinary(s *Stream, depth int64, p unsafe.Pointer) ([]byte, error) { c := s.skipWhiteSpace() if c == '[' { diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile.go b/vendor/github.com/goccy/go-json/internal/decoder/compile.go index bf17d1b2..8ad50936 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile.go @@ -5,6 +5,7 @@ import ( "fmt" "reflect" "strings" + "sync" "sync/atomic" "unicode" "unsafe" @@ -17,22 +18,27 @@ var ( typeAddr *runtime.TypeAddr cachedDecoderMap unsafe.Pointer // map[uintptr]decoder cachedDecoder []Decoder + initOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift) +func initDecoder() { + initOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadDecoderMap() map[uintptr]Decoder { + initDecoder() p := atomic.LoadPointer(&cachedDecoderMap) return *(*map[uintptr]Decoder)(unsafe.Pointer(&p)) } func storeDecoder(typ uintptr, dec Decoder, m map[uintptr]Decoder) { + initDecoder() newDecoderMap := make(map[uintptr]Decoder, len(m)+1) newDecoderMap[typ] = dec @@ -393,7 +399,25 @@ func compileStruct(typ *runtime.Type, structName, fieldName string, structTypeTo } allFields = append(allFields, fieldSet) } + } else { + fieldSet := &structFieldSet{ + dec: pdec, + offset: field.Offset, + isTaggedKey: tag.IsTaggedKey, + key: field.Name, + keyLen: int64(len(field.Name)), + } + allFields = append(allFields, fieldSet) + } + } else { + fieldSet := &structFieldSet{ + dec: dec, + offset: field.Offset, + isTaggedKey: tag.IsTaggedKey, + key: field.Name, + keyLen: int64(len(field.Name)), } + allFields = append(allFields, fieldSet) } } else { if tag.IsString && isStringTagSupportedType(runtime.Type2RType(field.Type)) { diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go index eb7e2b13..025ca85b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go @@ -10,6 +10,7 @@ import ( ) func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go index 49cdda4a..023b817c 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go @@ -13,6 +13,7 @@ import ( var decMu sync.RWMutex func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/float.go b/vendor/github.com/goccy/go-json/internal/decoder/float.go index dfb7168d..9b2eb8b3 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/float.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/float.go @@ -156,3 +156,15 @@ func (d *floatDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe d.op(p, f64) return cursor, nil } + +func (d *floatDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + buf := ctx.Buf + bytes, c, err := d.decodeByte(buf, cursor) + if err != nil { + return nil, 0, err + } + if bytes == nil { + return [][]byte{nullbytes}, c, nil + } + return [][]byte{bytes}, c, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/func.go b/vendor/github.com/goccy/go-json/internal/decoder/func.go index ee356371..4cc12ca8 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/func.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/func.go @@ -2,6 +2,7 @@ package decoder import ( "bytes" + "fmt" "unsafe" "github.com/goccy/go-json/internal/errors" @@ -139,3 +140,7 @@ func (d *funcDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe. } return cursor, errors.ErrInvalidBeginningOfValue(buf[cursor], cursor) } + +func (d *funcDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: func decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/int.go b/vendor/github.com/goccy/go-json/internal/decoder/int.go index 509b753d..1a7f0819 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/int.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/int.go @@ -240,3 +240,7 @@ func (d *intDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.P d.op(p, i64) return cursor, nil } + +func (d *intDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: int decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/interface.go b/vendor/github.com/goccy/go-json/internal/decoder/interface.go index 4dbb4be4..45c69ab8 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/interface.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/interface.go @@ -94,6 +94,7 @@ func (d *interfaceDecoder) numDecoder(s *Stream) Decoder { var ( emptyInterfaceType = runtime.Type2RType(reflect.TypeOf((*interface{})(nil)).Elem()) + EmptyInterfaceType = emptyInterfaceType interfaceMapType = runtime.Type2RType( reflect.TypeOf((*map[string]interface{})(nil)).Elem(), ) @@ -456,3 +457,72 @@ func (d *interfaceDecoder) decodeEmptyInterface(ctx *RuntimeContext, cursor, dep } return cursor, errors.ErrInvalidBeginningOfValue(buf[cursor], cursor) } + +func NewPathDecoder() Decoder { + ifaceDecoder := &interfaceDecoder{ + typ: emptyInterfaceType, + structName: "", + fieldName: "", + floatDecoder: newFloatDecoder("", "", func(p unsafe.Pointer, v float64) { + *(*interface{})(p) = v + }), + numberDecoder: newNumberDecoder("", "", func(p unsafe.Pointer, v json.Number) { + *(*interface{})(p) = v + }), + stringDecoder: newStringDecoder("", ""), + } + ifaceDecoder.sliceDecoder = newSliceDecoder( + ifaceDecoder, + emptyInterfaceType, + emptyInterfaceType.Size(), + "", "", + ) + ifaceDecoder.mapDecoder = newMapDecoder( + interfaceMapType, + stringType, + ifaceDecoder.stringDecoder, + interfaceMapType.Elem(), + ifaceDecoder, + "", "", + ) + return ifaceDecoder +} + +var ( + truebytes = []byte("true") + falsebytes = []byte("false") +) + +func (d *interfaceDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + switch buf[cursor] { + case '{': + return d.mapDecoder.DecodePath(ctx, cursor, depth) + case '[': + return d.sliceDecoder.DecodePath(ctx, cursor, depth) + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return d.floatDecoder.DecodePath(ctx, cursor, depth) + case '"': + return d.stringDecoder.DecodePath(ctx, cursor, depth) + case 't': + if err := validateTrue(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return [][]byte{truebytes}, cursor, nil + case 'f': + if err := validateFalse(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 5 + return [][]byte{falsebytes}, cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return [][]byte{nullbytes}, cursor, nil + } + return nil, cursor, errors.ErrInvalidBeginningOfValue(buf[cursor], cursor) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/invalid.go b/vendor/github.com/goccy/go-json/internal/decoder/invalid.go index 1ef50a7d..4c9721b0 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/invalid.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/invalid.go @@ -43,3 +43,13 @@ func (d *invalidDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsa Field: d.fieldName, } } + +func (d *invalidDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, &errors.UnmarshalTypeError{ + Value: "object", + Type: runtime.RType2Type(d.typ), + Offset: cursor, + Struct: d.structName, + Field: d.fieldName, + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/map.go b/vendor/github.com/goccy/go-json/internal/decoder/map.go index cb55ef00..07a9caea 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/map.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/map.go @@ -88,7 +88,7 @@ func (d *mapDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) erro mapValue = makemap(d.mapType, 0) } s.cursor++ - if s.equalChar('}') { + if s.skipWhiteSpace() == '}' { *(*unsafe.Pointer)(p) = mapValue s.cursor++ return nil @@ -185,3 +185,96 @@ func (d *mapDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.P cursor++ } } + +func (d *mapDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + buf := ctx.Buf + depth++ + if depth > maxDecodeNestingDepth { + return nil, 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + + cursor = skipWhiteSpace(buf, cursor) + buflen := int64(len(buf)) + if buflen < 2 { + return nil, 0, errors.ErrExpected("{} for map", cursor) + } + switch buf[cursor] { + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return [][]byte{nullbytes}, cursor, nil + case '{': + default: + return nil, 0, errors.ErrExpected("{ character for map value", cursor) + } + cursor++ + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == '}' { + cursor++ + return nil, cursor, nil + } + keyDecoder, ok := d.keyDecoder.(*stringDecoder) + if !ok { + return nil, 0, &errors.UnmarshalTypeError{ + Value: "string", + Type: reflect.TypeOf(""), + Offset: cursor, + Struct: d.structName, + Field: d.fieldName, + } + } + ret := [][]byte{} + for { + key, keyCursor, err := keyDecoder.decodeByte(buf, cursor) + if err != nil { + return nil, 0, err + } + cursor = skipWhiteSpace(buf, keyCursor) + if buf[cursor] != ':' { + return nil, 0, errors.ErrExpected("colon after object key", cursor) + } + cursor++ + child, found, err := ctx.Option.Path.Field(string(key)) + if err != nil { + return nil, 0, err + } + if found { + if child != nil { + oldPath := ctx.Option.Path.node + ctx.Option.Path.node = child + paths, c, err := d.valueDecoder.DecodePath(ctx, cursor, depth) + if err != nil { + return nil, 0, err + } + ctx.Option.Path.node = oldPath + ret = append(ret, paths...) + cursor = c + } else { + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return nil, 0, err + } + ret = append(ret, buf[start:end]) + cursor = end + } + } else { + c, err := skipValue(buf, cursor, depth) + if err != nil { + return nil, 0, err + } + cursor = c + } + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == '}' { + cursor++ + return ret, cursor, nil + } + if buf[cursor] != ',' { + return nil, 0, errors.ErrExpected("comma after object value", cursor) + } + cursor++ + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/number.go b/vendor/github.com/goccy/go-json/internal/decoder/number.go index bf63773e..10e5435e 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/number.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/number.go @@ -51,6 +51,17 @@ func (d *numberDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsaf return cursor, nil } +func (d *numberDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + bytes, c, err := d.decodeByte(ctx.Buf, cursor) + if err != nil { + return nil, 0, err + } + if bytes == nil { + return [][]byte{nullbytes}, c, nil + } + return [][]byte{bytes}, c, nil +} + func (d *numberDecoder) decodeStreamByte(s *Stream) ([]byte, error) { start := s.cursor for { diff --git a/vendor/github.com/goccy/go-json/internal/decoder/option.go b/vendor/github.com/goccy/go-json/internal/decoder/option.go index e41f876b..502f772e 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/option.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/option.go @@ -7,9 +7,11 @@ type OptionFlags uint8 const ( FirstWinOption OptionFlags = 1 << iota ContextOption + PathOption ) type Option struct { Flags OptionFlags Context context.Context + Path *Path } diff --git a/vendor/github.com/goccy/go-json/internal/decoder/path.go b/vendor/github.com/goccy/go-json/internal/decoder/path.go new file mode 100644 index 00000000..a15ff69e --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/path.go @@ -0,0 +1,670 @@ +package decoder + +import ( + "fmt" + "reflect" + "strconv" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type PathString string + +func (s PathString) Build() (*Path, error) { + builder := new(PathBuilder) + return builder.Build([]rune(s)) +} + +type PathBuilder struct { + root PathNode + node PathNode + singleQuotePathSelector bool + doubleQuotePathSelector bool +} + +func (b *PathBuilder) Build(buf []rune) (*Path, error) { + node, err := b.build(buf) + if err != nil { + return nil, err + } + return &Path{ + node: node, + RootSelectorOnly: node == nil, + SingleQuotePathSelector: b.singleQuotePathSelector, + DoubleQuotePathSelector: b.doubleQuotePathSelector, + }, nil +} + +func (b *PathBuilder) build(buf []rune) (PathNode, error) { + if len(buf) == 0 { + return nil, errors.ErrEmptyPath() + } + if buf[0] != '$' { + return nil, errors.ErrInvalidPath("JSON Path must start with a $ character") + } + if len(buf) == 1 { + return nil, nil + } + buf = buf[1:] + offset, err := b.buildNext(buf) + if err != nil { + return nil, err + } + if len(buf) > offset { + return nil, errors.ErrInvalidPath("remain invalid path %q", buf[offset:]) + } + return b.root, nil +} + +func (b *PathBuilder) buildNextCharIfExists(buf []rune, cursor int) (int, error) { + if len(buf) > cursor { + offset, err := b.buildNext(buf[cursor:]) + if err != nil { + return 0, err + } + return cursor + 1 + offset, nil + } + return cursor, nil +} + +func (b *PathBuilder) buildNext(buf []rune) (int, error) { + switch buf[0] { + case '.': + if len(buf) == 1 { + return 0, errors.ErrInvalidPath("JSON Path ends with dot character") + } + offset, err := b.buildSelector(buf[1:]) + if err != nil { + return 0, err + } + return offset + 1, nil + case '[': + if len(buf) == 1 { + return 0, errors.ErrInvalidPath("JSON Path ends with left bracket character") + } + offset, err := b.buildIndex(buf[1:]) + if err != nil { + return 0, err + } + return offset + 1, nil + default: + return 0, errors.ErrInvalidPath("expect dot or left bracket character. but found %c character", buf[0]) + } +} + +func (b *PathBuilder) buildSelector(buf []rune) (int, error) { + switch buf[0] { + case '.': + if len(buf) == 1 { + return 0, errors.ErrInvalidPath("JSON Path ends with double dot character") + } + offset, err := b.buildPathRecursive(buf[1:]) + if err != nil { + return 0, err + } + return 1 + offset, nil + case '[', ']', '$', '*': + return 0, errors.ErrInvalidPath("found invalid path character %c after dot", buf[0]) + } + for cursor := 0; cursor < len(buf); cursor++ { + switch buf[cursor] { + case '$', '*', ']': + return 0, errors.ErrInvalidPath("found %c character in field selector context", buf[cursor]) + case '.': + if cursor+1 >= len(buf) { + return 0, errors.ErrInvalidPath("JSON Path ends with dot character") + } + selector := buf[:cursor] + b.addSelectorNode(string(selector)) + offset, err := b.buildSelector(buf[cursor+1:]) + if err != nil { + return 0, err + } + return cursor + 1 + offset, nil + case '[': + if cursor+1 >= len(buf) { + return 0, errors.ErrInvalidPath("JSON Path ends with left bracket character") + } + selector := buf[:cursor] + b.addSelectorNode(string(selector)) + offset, err := b.buildIndex(buf[cursor+1:]) + if err != nil { + return 0, err + } + return cursor + 1 + offset, nil + case '"': + if cursor+1 >= len(buf) { + return 0, errors.ErrInvalidPath("JSON Path ends with double quote character") + } + offset, err := b.buildQuoteSelector(buf[cursor+1:], DoubleQuotePathSelector) + if err != nil { + return 0, err + } + return cursor + 1 + offset, nil + } + } + b.addSelectorNode(string(buf)) + return len(buf), nil +} + +func (b *PathBuilder) buildQuoteSelector(buf []rune, sel QuotePathSelector) (int, error) { + switch buf[0] { + case '[', ']', '$', '.', '*', '\'', '"': + return 0, errors.ErrInvalidPath("found invalid path character %c after quote", buf[0]) + } + for cursor := 0; cursor < len(buf); cursor++ { + switch buf[cursor] { + case '\'': + if sel != SingleQuotePathSelector { + return 0, errors.ErrInvalidPath("found double quote character in field selector with single quote context") + } + if len(buf) <= cursor+1 { + return 0, errors.ErrInvalidPath("JSON Path ends with single quote character in field selector context") + } + if buf[cursor+1] != ']' { + return 0, errors.ErrInvalidPath("expect right bracket for field selector with single quote but found %c", buf[cursor+1]) + } + selector := buf[:cursor] + b.addSelectorNode(string(selector)) + b.singleQuotePathSelector = true + return b.buildNextCharIfExists(buf, cursor+2) + case '"': + if sel != DoubleQuotePathSelector { + return 0, errors.ErrInvalidPath("found single quote character in field selector with double quote context") + } + selector := buf[:cursor] + b.addSelectorNode(string(selector)) + b.doubleQuotePathSelector = true + return b.buildNextCharIfExists(buf, cursor+1) + } + } + return 0, errors.ErrInvalidPath("couldn't find quote character in selector quote path context") +} + +func (b *PathBuilder) buildPathRecursive(buf []rune) (int, error) { + switch buf[0] { + case '.', '[', ']', '$', '*': + return 0, errors.ErrInvalidPath("found invalid path character %c after double dot", buf[0]) + } + for cursor := 0; cursor < len(buf); cursor++ { + switch buf[cursor] { + case '$', '*', ']': + return 0, errors.ErrInvalidPath("found %c character in field selector context", buf[cursor]) + case '.': + if cursor+1 >= len(buf) { + return 0, errors.ErrInvalidPath("JSON Path ends with dot character") + } + selector := buf[:cursor] + b.addRecursiveNode(string(selector)) + offset, err := b.buildSelector(buf[cursor+1:]) + if err != nil { + return 0, err + } + return cursor + 1 + offset, nil + case '[': + if cursor+1 >= len(buf) { + return 0, errors.ErrInvalidPath("JSON Path ends with left bracket character") + } + selector := buf[:cursor] + b.addRecursiveNode(string(selector)) + offset, err := b.buildIndex(buf[cursor+1:]) + if err != nil { + return 0, err + } + return cursor + 1 + offset, nil + } + } + b.addRecursiveNode(string(buf)) + return len(buf), nil +} + +func (b *PathBuilder) buildIndex(buf []rune) (int, error) { + switch buf[0] { + case '.', '[', ']', '$': + return 0, errors.ErrInvalidPath("found invalid path character %c after left bracket", buf[0]) + case '\'': + if len(buf) == 1 { + return 0, errors.ErrInvalidPath("JSON Path ends with single quote character") + } + offset, err := b.buildQuoteSelector(buf[1:], SingleQuotePathSelector) + if err != nil { + return 0, err + } + return 1 + offset, nil + case '*': + if len(buf) == 1 { + return 0, errors.ErrInvalidPath("JSON Path ends with star character") + } + if buf[1] != ']' { + return 0, errors.ErrInvalidPath("expect right bracket character for index all path but found %c character", buf[1]) + } + b.addIndexAllNode() + offset := len("*]") + if len(buf) > 2 { + buildOffset, err := b.buildNext(buf[2:]) + if err != nil { + return 0, err + } + return offset + buildOffset, nil + } + return offset, nil + } + + for cursor := 0; cursor < len(buf); cursor++ { + switch buf[cursor] { + case ']': + index, err := strconv.ParseInt(string(buf[:cursor]), 10, 64) + if err != nil { + return 0, errors.ErrInvalidPath("%q is unexpected index path", buf[:cursor]) + } + b.addIndexNode(int(index)) + return b.buildNextCharIfExists(buf, cursor+1) + } + } + return 0, errors.ErrInvalidPath("couldn't find right bracket character in index path context") +} + +func (b *PathBuilder) addIndexAllNode() { + node := newPathIndexAllNode() + if b.root == nil { + b.root = node + b.node = node + } else { + b.node = b.node.chain(node) + } +} + +func (b *PathBuilder) addRecursiveNode(selector string) { + node := newPathRecursiveNode(selector) + if b.root == nil { + b.root = node + b.node = node + } else { + b.node = b.node.chain(node) + } +} + +func (b *PathBuilder) addSelectorNode(name string) { + node := newPathSelectorNode(name) + if b.root == nil { + b.root = node + b.node = node + } else { + b.node = b.node.chain(node) + } +} + +func (b *PathBuilder) addIndexNode(idx int) { + node := newPathIndexNode(idx) + if b.root == nil { + b.root = node + b.node = node + } else { + b.node = b.node.chain(node) + } +} + +type QuotePathSelector int + +const ( + SingleQuotePathSelector QuotePathSelector = 1 + DoubleQuotePathSelector QuotePathSelector = 2 +) + +type Path struct { + node PathNode + RootSelectorOnly bool + SingleQuotePathSelector bool + DoubleQuotePathSelector bool +} + +func (p *Path) Field(sel string) (PathNode, bool, error) { + if p.node == nil { + return nil, false, nil + } + return p.node.Field(sel) +} + +func (p *Path) Get(src, dst reflect.Value) error { + if p.node == nil { + return nil + } + return p.node.Get(src, dst) +} + +func (p *Path) String() string { + if p.node == nil { + return "$" + } + return p.node.String() +} + +type PathNode interface { + fmt.Stringer + Index(idx int) (PathNode, bool, error) + Field(fieldName string) (PathNode, bool, error) + Get(src, dst reflect.Value) error + chain(PathNode) PathNode + target() bool + single() bool +} + +type BasePathNode struct { + child PathNode +} + +func (n *BasePathNode) chain(node PathNode) PathNode { + n.child = node + return node +} + +func (n *BasePathNode) target() bool { + return n.child == nil +} + +func (n *BasePathNode) single() bool { + return true +} + +type PathSelectorNode struct { + *BasePathNode + selector string +} + +func newPathSelectorNode(selector string) *PathSelectorNode { + return &PathSelectorNode{ + BasePathNode: &BasePathNode{}, + selector: selector, + } +} + +func (n *PathSelectorNode) Index(idx int) (PathNode, bool, error) { + return nil, false, &errors.PathError{} +} + +func (n *PathSelectorNode) Field(fieldName string) (PathNode, bool, error) { + if n.selector == fieldName { + return n.child, true, nil + } + return nil, false, nil +} + +func (n *PathSelectorNode) Get(src, dst reflect.Value) error { + switch src.Type().Kind() { + case reflect.Map: + iter := src.MapRange() + for iter.Next() { + key, ok := iter.Key().Interface().(string) + if !ok { + return fmt.Errorf("invalid map key type %T", src.Type().Key()) + } + child, found, err := n.Field(key) + if err != nil { + return err + } + if found { + if child != nil { + return child.Get(iter.Value(), dst) + } + return AssignValue(iter.Value(), dst) + } + } + case reflect.Struct: + typ := src.Type() + for i := 0; i < typ.Len(); i++ { + tag := runtime.StructTagFromField(typ.Field(i)) + child, found, err := n.Field(tag.Key) + if err != nil { + return err + } + if found { + if child != nil { + return child.Get(src.Field(i), dst) + } + return AssignValue(src.Field(i), dst) + } + } + case reflect.Ptr: + return n.Get(src.Elem(), dst) + case reflect.Interface: + return n.Get(reflect.ValueOf(src.Interface()), dst) + case reflect.Float64, reflect.String, reflect.Bool: + return AssignValue(src, dst) + } + return fmt.Errorf("failed to get %s value from %s", n.selector, src.Type()) +} + +func (n *PathSelectorNode) String() string { + s := fmt.Sprintf(".%s", n.selector) + if n.child != nil { + s += n.child.String() + } + return s +} + +type PathIndexNode struct { + *BasePathNode + selector int +} + +func newPathIndexNode(selector int) *PathIndexNode { + return &PathIndexNode{ + BasePathNode: &BasePathNode{}, + selector: selector, + } +} + +func (n *PathIndexNode) Index(idx int) (PathNode, bool, error) { + if n.selector == idx { + return n.child, true, nil + } + return nil, false, nil +} + +func (n *PathIndexNode) Field(fieldName string) (PathNode, bool, error) { + return nil, false, &errors.PathError{} +} + +func (n *PathIndexNode) Get(src, dst reflect.Value) error { + switch src.Type().Kind() { + case reflect.Array, reflect.Slice: + if src.Len() > n.selector { + if n.child != nil { + return n.child.Get(src.Index(n.selector), dst) + } + return AssignValue(src.Index(n.selector), dst) + } + case reflect.Ptr: + return n.Get(src.Elem(), dst) + case reflect.Interface: + return n.Get(reflect.ValueOf(src.Interface()), dst) + } + return fmt.Errorf("failed to get [%d] value from %s", n.selector, src.Type()) +} + +func (n *PathIndexNode) String() string { + s := fmt.Sprintf("[%d]", n.selector) + if n.child != nil { + s += n.child.String() + } + return s +} + +type PathIndexAllNode struct { + *BasePathNode +} + +func newPathIndexAllNode() *PathIndexAllNode { + return &PathIndexAllNode{ + BasePathNode: &BasePathNode{}, + } +} + +func (n *PathIndexAllNode) Index(idx int) (PathNode, bool, error) { + return n.child, true, nil +} + +func (n *PathIndexAllNode) Field(fieldName string) (PathNode, bool, error) { + return nil, false, &errors.PathError{} +} + +func (n *PathIndexAllNode) Get(src, dst reflect.Value) error { + switch src.Type().Kind() { + case reflect.Array, reflect.Slice: + var arr []interface{} + for i := 0; i < src.Len(); i++ { + var v interface{} + rv := reflect.ValueOf(&v) + if n.child != nil { + if err := n.child.Get(src.Index(i), rv); err != nil { + return err + } + } else { + if err := AssignValue(src.Index(i), rv); err != nil { + return err + } + } + arr = append(arr, v) + } + if err := AssignValue(reflect.ValueOf(arr), dst); err != nil { + return err + } + return nil + case reflect.Ptr: + return n.Get(src.Elem(), dst) + case reflect.Interface: + return n.Get(reflect.ValueOf(src.Interface()), dst) + } + return fmt.Errorf("failed to get all value from %s", src.Type()) +} + +func (n *PathIndexAllNode) String() string { + s := "[*]" + if n.child != nil { + s += n.child.String() + } + return s +} + +type PathRecursiveNode struct { + *BasePathNode + selector string +} + +func newPathRecursiveNode(selector string) *PathRecursiveNode { + node := newPathSelectorNode(selector) + return &PathRecursiveNode{ + BasePathNode: &BasePathNode{ + child: node, + }, + selector: selector, + } +} + +func (n *PathRecursiveNode) Field(fieldName string) (PathNode, bool, error) { + if n.selector == fieldName { + return n.child, true, nil + } + return nil, false, nil +} + +func (n *PathRecursiveNode) Index(_ int) (PathNode, bool, error) { + return n, true, nil +} + +func valueToSliceValue(v interface{}) []interface{} { + rv := reflect.ValueOf(v) + ret := []interface{}{} + if rv.Type().Kind() == reflect.Slice || rv.Type().Kind() == reflect.Array { + for i := 0; i < rv.Len(); i++ { + ret = append(ret, rv.Index(i).Interface()) + } + return ret + } + return []interface{}{v} +} + +func (n *PathRecursiveNode) Get(src, dst reflect.Value) error { + if n.child == nil { + return fmt.Errorf("failed to get by recursive path ..%s", n.selector) + } + var arr []interface{} + switch src.Type().Kind() { + case reflect.Map: + iter := src.MapRange() + for iter.Next() { + key, ok := iter.Key().Interface().(string) + if !ok { + return fmt.Errorf("invalid map key type %T", src.Type().Key()) + } + child, found, err := n.Field(key) + if err != nil { + return err + } + if found { + var v interface{} + rv := reflect.ValueOf(&v) + _ = child.Get(iter.Value(), rv) + arr = append(arr, valueToSliceValue(v)...) + } else { + var v interface{} + rv := reflect.ValueOf(&v) + _ = n.Get(iter.Value(), rv) + if v != nil { + arr = append(arr, valueToSliceValue(v)...) + } + } + } + _ = AssignValue(reflect.ValueOf(arr), dst) + return nil + case reflect.Struct: + typ := src.Type() + for i := 0; i < typ.Len(); i++ { + tag := runtime.StructTagFromField(typ.Field(i)) + child, found, err := n.Field(tag.Key) + if err != nil { + return err + } + if found { + var v interface{} + rv := reflect.ValueOf(&v) + _ = child.Get(src.Field(i), rv) + arr = append(arr, valueToSliceValue(v)...) + } else { + var v interface{} + rv := reflect.ValueOf(&v) + _ = n.Get(src.Field(i), rv) + if v != nil { + arr = append(arr, valueToSliceValue(v)...) + } + } + } + _ = AssignValue(reflect.ValueOf(arr), dst) + return nil + case reflect.Array, reflect.Slice: + for i := 0; i < src.Len(); i++ { + var v interface{} + rv := reflect.ValueOf(&v) + _ = n.Get(src.Index(i), rv) + if v != nil { + arr = append(arr, valueToSliceValue(v)...) + } + } + _ = AssignValue(reflect.ValueOf(arr), dst) + return nil + case reflect.Ptr: + return n.Get(src.Elem(), dst) + case reflect.Interface: + return n.Get(reflect.ValueOf(src.Interface()), dst) + } + return fmt.Errorf("failed to get %s value from %s", n.selector, src.Type()) +} + +func (n *PathRecursiveNode) String() string { + s := fmt.Sprintf("..%s", n.selector) + if n.child != nil { + s += n.child.String() + } + return s +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/ptr.go b/vendor/github.com/goccy/go-json/internal/decoder/ptr.go index 2c83b9c4..ae229946 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/ptr.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/ptr.go @@ -1,6 +1,7 @@ package decoder import ( + "fmt" "unsafe" "github.com/goccy/go-json/internal/runtime" @@ -34,6 +35,10 @@ func (d *ptrDecoder) contentDecoder() Decoder { //go:linkname unsafe_New reflect.unsafe_New func unsafe_New(*runtime.Type) unsafe.Pointer +func UnsafeNew(t *runtime.Type) unsafe.Pointer { + return unsafe_New(t) +} + func (d *ptrDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { if s.skipWhiteSpace() == nul { s.read() @@ -80,8 +85,13 @@ func (d *ptrDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.P } c, err := d.dec.Decode(ctx, cursor, depth, newptr) if err != nil { + *(*unsafe.Pointer)(p) = nil return 0, err } cursor = c return cursor, nil } + +func (d *ptrDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: ptr decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/slice.go b/vendor/github.com/goccy/go-json/internal/decoder/slice.go index 85b6e111..30a23e4b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/slice.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/slice.go @@ -299,3 +299,82 @@ func (d *sliceDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe } } } + +func (d *sliceDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + buf := ctx.Buf + depth++ + if depth > maxDecodeNestingDepth { + return nil, 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + + ret := [][]byte{} + for { + switch buf[cursor] { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return [][]byte{nullbytes}, cursor, nil + case '[': + cursor++ + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == ']' { + cursor++ + return ret, cursor, nil + } + idx := 0 + for { + child, found, err := ctx.Option.Path.node.Index(idx) + if err != nil { + return nil, 0, err + } + if found { + if child != nil { + oldPath := ctx.Option.Path.node + ctx.Option.Path.node = child + paths, c, err := d.valueDecoder.DecodePath(ctx, cursor, depth) + if err != nil { + return nil, 0, err + } + ctx.Option.Path.node = oldPath + ret = append(ret, paths...) + cursor = c + } else { + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return nil, 0, err + } + ret = append(ret, buf[start:end]) + cursor = end + } + } else { + c, err := skipValue(buf, cursor, depth) + if err != nil { + return nil, 0, err + } + cursor = c + } + cursor = skipWhiteSpace(buf, cursor) + switch buf[cursor] { + case ']': + cursor++ + return ret, cursor, nil + case ',': + idx++ + default: + return nil, 0, errors.ErrInvalidCharacter(buf[cursor], "slice", cursor) + } + cursor++ + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return nil, 0, d.errNumber(cursor) + default: + return nil, 0, errors.ErrUnexpectedEndOfJSON("slice", cursor) + } + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/stream.go b/vendor/github.com/goccy/go-json/internal/decoder/stream.go index 332d47d8..a383f725 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/stream.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/stream.go @@ -138,8 +138,11 @@ func (s *Stream) Token() (interface{}, error) { s.cursor++ case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': bytes := floatBytes(s) - s := *(*string)(unsafe.Pointer(&bytes)) - f64, err := strconv.ParseFloat(s, 64) + str := *(*string)(unsafe.Pointer(&bytes)) + if s.UseNumber { + return json.Number(str), nil + } + f64, err := strconv.ParseFloat(str, 64) if err != nil { return nil, err } @@ -277,7 +280,7 @@ func (s *Stream) skipObject(depth int64) error { if char(p, cursor) == nul { s.cursor = cursor if s.read() { - _, cursor, p = s.statForRetry() + _, cursor, p = s.stat() continue } return errors.ErrUnexpectedEndOfJSON("string of object", cursor) @@ -340,7 +343,7 @@ func (s *Stream) skipArray(depth int64) error { if char(p, cursor) == nul { s.cursor = cursor if s.read() { - _, cursor, p = s.statForRetry() + _, cursor, p = s.stat() continue } return errors.ErrUnexpectedEndOfJSON("string of object", cursor) @@ -398,7 +401,7 @@ func (s *Stream) skipValue(depth int64) error { if char(p, cursor) == nul { s.cursor = cursor if s.read() { - _, cursor, p = s.statForRetry() + _, cursor, p = s.stat() continue } return errors.ErrUnexpectedEndOfJSON("value of string", s.totalOffset()) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/string.go b/vendor/github.com/goccy/go-json/internal/decoder/string.go index a55ac556..32602c90 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/string.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/string.go @@ -2,6 +2,7 @@ package decoder import ( "bytes" + "fmt" "reflect" "unicode" "unicode/utf16" @@ -59,6 +60,17 @@ func (d *stringDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsaf return cursor, nil } +func (d *stringDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + bytes, c, err := d.decodeByte(ctx.Buf, cursor) + if err != nil { + return nil, 0, err + } + if bytes == nil { + return [][]byte{nullbytes}, c, nil + } + return [][]byte{bytes}, c, nil +} + var ( hexToInt = [256]int{ '0': 0, @@ -94,24 +106,30 @@ func unicodeToRune(code []byte) rune { return r } +func readAtLeast(s *Stream, n int64, p *unsafe.Pointer) bool { + for s.cursor+n >= s.length { + if !s.read() { + return false + } + *p = s.bufptr() + } + return true +} + func decodeUnicodeRune(s *Stream, p unsafe.Pointer) (rune, int64, unsafe.Pointer, error) { const defaultOffset = 5 const surrogateOffset = 11 - if s.cursor+defaultOffset >= s.length { - if !s.read() { - return rune(0), 0, nil, errors.ErrInvalidCharacter(s.char(), "escaped string", s.totalOffset()) - } - p = s.bufptr() + if !readAtLeast(s, defaultOffset, &p) { + return rune(0), 0, nil, errors.ErrInvalidCharacter(s.char(), "escaped string", s.totalOffset()) } r := unicodeToRune(s.buf[s.cursor+1 : s.cursor+defaultOffset]) if utf16.IsSurrogate(r) { - if s.cursor+surrogateOffset >= s.length { - s.read() - p = s.bufptr() + if !readAtLeast(s, surrogateOffset, &p) { + return unicode.ReplacementChar, defaultOffset, p, nil } - if s.cursor+surrogateOffset >= s.length || s.buf[s.cursor+defaultOffset] != '\\' || s.buf[s.cursor+defaultOffset+1] != 'u' { + if s.buf[s.cursor+defaultOffset] != '\\' || s.buf[s.cursor+defaultOffset+1] != 'u' { return unicode.ReplacementChar, defaultOffset, p, nil } r2 := unicodeToRune(s.buf[s.cursor+defaultOffset+2 : s.cursor+surrogateOffset]) @@ -164,6 +182,7 @@ RETRY: if !s.read() { return nil, errors.ErrInvalidCharacter(s.char(), "escaped string", s.totalOffset()) } + p = s.bufptr() goto RETRY default: return nil, errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) @@ -323,6 +342,12 @@ func (d *stringDecoder) decodeByte(buf []byte, cursor int64) ([]byte, int64, err if cursor+5 >= buflen { return nil, 0, errors.ErrUnexpectedEndOfJSON("escaped string", cursor) } + for i := int64(1); i <= 4; i++ { + c := char(b, cursor+i) + if !(('0' <= c && c <= '9') || ('a' <= c && c <= 'f') || ('A' <= c && c <= 'F')) { + return nil, 0, errors.ErrSyntax(fmt.Sprintf("json: invalid character %c in \\u hexadecimal character escape", c), cursor+i) + } + } cursor += 5 default: return nil, 0, errors.ErrUnexpectedEndOfJSON("escaped string", cursor) @@ -386,6 +411,19 @@ func unescapeString(buf []byte) int { v3 := hexToInt[char(src, 4)] v4 := hexToInt[char(src, 5)] code := rune((v1 << 12) | (v2 << 8) | (v3 << 4) | v4) + if code >= 0xd800 && code < 0xdc00 && uintptr(unsafeAdd(src, 11)) < uintptr(end) { + if char(src, 6) == '\\' && char(src, 7) == 'u' { + v1 := hexToInt[char(src, 8)] + v2 := hexToInt[char(src, 9)] + v3 := hexToInt[char(src, 10)] + v4 := hexToInt[char(src, 11)] + lo := rune((v1 << 12) | (v2 << 8) | (v3 << 4) | v4) + if lo >= 0xdc00 && lo < 0xe000 { + code = (code-0xd800)<<10 | (lo - 0xdc00) + 0x10000 + src = unsafeAdd(src, 6) + } + } + } var b [utf8.UTFMax]byte n := utf8.EncodeRune(b[:], code) switch n { diff --git a/vendor/github.com/goccy/go-json/internal/decoder/struct.go b/vendor/github.com/goccy/go-json/internal/decoder/struct.go index 2c646804..313da153 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/struct.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/struct.go @@ -51,6 +51,14 @@ func init() { } } +func toASCIILower(s string) string { + b := []byte(s) + for i := range b { + b[i] = largeToSmallTable[b[i]] + } + return string(b) +} + func newStructDecoder(structName, fieldName string, fieldMap map[string]*structFieldSet) *structDecoder { return &structDecoder{ fieldMap: fieldMap, @@ -91,6 +99,10 @@ func (d *structDecoder) tryOptimize() { for k, v := range d.fieldMap { key := strings.ToLower(k) if key != k { + if key != toASCIILower(k) { + d.isTriedOptimize = true + return + } // already exists same key (e.g. Hello and HELLO has same lower case key if _, exists := conflicted[key]; exists { d.isTriedOptimize = true @@ -158,49 +170,53 @@ func (d *structDecoder) tryOptimize() { } // decode from '\uXXXX' -func decodeKeyCharByUnicodeRune(buf []byte, cursor int64) ([]byte, int64) { +func decodeKeyCharByUnicodeRune(buf []byte, cursor int64) ([]byte, int64, error) { const defaultOffset = 4 const surrogateOffset = 6 + if cursor+defaultOffset >= int64(len(buf)) { + return nil, 0, errors.ErrUnexpectedEndOfJSON("escaped string", cursor) + } + r := unicodeToRune(buf[cursor : cursor+defaultOffset]) if utf16.IsSurrogate(r) { cursor += defaultOffset if cursor+surrogateOffset >= int64(len(buf)) || buf[cursor] != '\\' || buf[cursor+1] != 'u' { - return []byte(string(unicode.ReplacementChar)), cursor + defaultOffset - 1 + return []byte(string(unicode.ReplacementChar)), cursor + defaultOffset - 1, nil } cursor += 2 r2 := unicodeToRune(buf[cursor : cursor+defaultOffset]) if r := utf16.DecodeRune(r, r2); r != unicode.ReplacementChar { - return []byte(string(r)), cursor + defaultOffset - 1 + return []byte(string(r)), cursor + defaultOffset - 1, nil } } - return []byte(string(r)), cursor + defaultOffset - 1 + return []byte(string(r)), cursor + defaultOffset - 1, nil } -func decodeKeyCharByEscapedChar(buf []byte, cursor int64) ([]byte, int64) { +func decodeKeyCharByEscapedChar(buf []byte, cursor int64) ([]byte, int64, error) { c := buf[cursor] cursor++ switch c { case '"': - return []byte{'"'}, cursor + return []byte{'"'}, cursor, nil case '\\': - return []byte{'\\'}, cursor + return []byte{'\\'}, cursor, nil case '/': - return []byte{'/'}, cursor + return []byte{'/'}, cursor, nil case 'b': - return []byte{'\b'}, cursor + return []byte{'\b'}, cursor, nil case 'f': - return []byte{'\f'}, cursor + return []byte{'\f'}, cursor, nil case 'n': - return []byte{'\n'}, cursor + return []byte{'\n'}, cursor, nil case 'r': - return []byte{'\r'}, cursor + return []byte{'\r'}, cursor, nil case 't': - return []byte{'\t'}, cursor + return []byte{'\t'}, cursor, nil case 'u': return decodeKeyCharByUnicodeRune(buf, cursor) } - return nil, cursor + return nil, cursor, nil } func decodeKeyByBitmapUint8(d *structDecoder, buf []byte, cursor int64) (int64, *structFieldSet, error) { @@ -242,7 +258,10 @@ func decodeKeyByBitmapUint8(d *structDecoder, buf []byte, cursor int64) (int64, return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) case '\\': cursor++ - chars, nextCursor := decodeKeyCharByEscapedChar(buf, cursor) + chars, nextCursor, err := decodeKeyCharByEscapedChar(buf, cursor) + if err != nil { + return 0, nil, err + } for _, c := range chars { curBit &= bitmap[keyIdx][largeToSmallTable[c]] if curBit == 0 { @@ -305,7 +324,10 @@ func decodeKeyByBitmapUint16(d *structDecoder, buf []byte, cursor int64) (int64, return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) case '\\': cursor++ - chars, nextCursor := decodeKeyCharByEscapedChar(buf, cursor) + chars, nextCursor, err := decodeKeyCharByEscapedChar(buf, cursor) + if err != nil { + return 0, nil, err + } for _, c := range chars { curBit &= bitmap[keyIdx][largeToSmallTable[c]] if curBit == 0 { @@ -817,3 +839,7 @@ func (d *structDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsaf cursor++ } } + +func (d *structDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: struct decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/type.go b/vendor/github.com/goccy/go-json/internal/decoder/type.go index 70e9907c..beaf3ab8 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/type.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/type.go @@ -10,6 +10,7 @@ import ( type Decoder interface { Decode(*RuntimeContext, int64, int64, unsafe.Pointer) (int64, error) + DecodePath(*RuntimeContext, int64, int64) ([][]byte, int64, error) DecodeStream(*Stream, int64, unsafe.Pointer) error } diff --git a/vendor/github.com/goccy/go-json/internal/decoder/uint.go b/vendor/github.com/goccy/go-json/internal/decoder/uint.go index a62c5149..4131731b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/uint.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/uint.go @@ -188,3 +188,7 @@ func (d *uintDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe. d.op(p, u64) return cursor, nil } + +func (d *uintDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: uint decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_json.go b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_json.go index e9b25c68..4cd6dbd5 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_json.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_json.go @@ -3,6 +3,7 @@ package decoder import ( "context" "encoding/json" + "fmt" "unsafe" "github.com/goccy/go-json/internal/errors" @@ -97,3 +98,7 @@ func (d *unmarshalJSONDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, } return end, nil } + +func (d *unmarshalJSONDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: unmarshal json decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go index 1ef28778..d711d0f8 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go @@ -3,6 +3,7 @@ package decoder import ( "bytes" "encoding" + "fmt" "unicode" "unicode/utf16" "unicode/utf8" @@ -142,7 +143,11 @@ func (d *unmarshalTextDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, return end, nil } -func unquoteBytes(s []byte) (t []byte, ok bool) { +func (d *unmarshalTextDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: unmarshal text decoder does not support decode path") +} + +func unquoteBytes(s []byte) (t []byte, ok bool) { //nolint: nonamedreturns length := len(s) if length < 2 || s[0] != '"' || s[length-1] != '"' { return diff --git a/vendor/github.com/goccy/go-json/internal/decoder/wrapped_string.go b/vendor/github.com/goccy/go-json/internal/decoder/wrapped_string.go index 66227ae0..0c4e2e6e 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/wrapped_string.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/wrapped_string.go @@ -1,6 +1,7 @@ package decoder import ( + "fmt" "reflect" "unsafe" @@ -66,3 +67,7 @@ func (d *wrappedStringDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, ctx.Buf = oldBuf return c, nil } + +func (d *wrappedStringDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int64) ([][]byte, int64, error) { + return nil, 0, fmt.Errorf("json: wrapped string decoder does not support decode path") +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/code.go b/vendor/github.com/goccy/go-json/internal/encoder/code.go index a00e38a9..5b08faef 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/code.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/code.go @@ -2,6 +2,7 @@ package encoder import ( "fmt" + "reflect" "unsafe" "github.com/goccy/go-json/internal/runtime" @@ -383,7 +384,7 @@ func (c *StructCode) Kind() CodeKind { } func (c *StructCode) lastFieldCode(field *StructFieldCode, firstField *Opcode) *Opcode { - if field.isAnonymous { + if isEmbeddedStruct(field) { return c.lastAnonymousFieldCode(firstField) } lastField := firstField @@ -396,7 +397,10 @@ func (c *StructCode) lastFieldCode(field *StructFieldCode, firstField *Opcode) * func (c *StructCode) lastAnonymousFieldCode(firstField *Opcode) *Opcode { // firstField is special StructHead operation for anonymous structure. // So, StructHead's next operation is truly struct head operation. - lastField := firstField.Next + for firstField.Op == OpStructHead || firstField.Op == OpStructField { + firstField = firstField.Next + } + lastField := firstField for lastField.NextField != nil { lastField = lastField.NextField } @@ -436,11 +440,6 @@ func (c *StructCode) ToOpcode(ctx *compileContext) Opcodes { } if isEndField { endField := fieldCodes.Last() - if field.isAnonymous { - firstField.End = endField - lastField := c.lastAnonymousFieldCode(firstField) - lastField.NextField = endField - } if len(codes) > 0 { codes.First().End = endField } else { @@ -697,7 +696,15 @@ func (c *StructFieldCode) addStructEndCode(ctx *compileContext, codes Opcodes) O Indent: ctx.indent, } codes.Last().Next = end - codes.First().NextField = end + code := codes.First() + for code.Op == OpStructField || code.Op == OpStructHead { + code = code.Next + } + for code.NextField != nil { + code = code.NextField + } + code.NextField = end + codes = codes.Add(end) ctx.incOpcodeIndex() return codes @@ -1003,3 +1010,14 @@ func convertPtrOp(code *Opcode) OpType { } return code.Op } + +func isEmbeddedStruct(field *StructFieldCode) bool { + if !field.isAnonymous { + return false + } + t := field.typ + if t.Kind() == reflect.Ptr { + t = t.Elem() + } + return t.Kind() == reflect.Struct +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compact.go b/vendor/github.com/goccy/go-json/internal/encoder/compact.go index 0eb9545d..e287a6c0 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compact.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compact.go @@ -213,8 +213,8 @@ func compactString(dst, src []byte, cursor int64, escape bool) ([]byte, int64, e dst = append(dst, src[start:cursor]...) dst = append(dst, `\u202`...) dst = append(dst, hex[src[cursor+2]&0xF]) - cursor += 2 start = cursor + 3 + cursor += 2 } } switch c { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go index 0eb3d90f..b1076368 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go @@ -5,6 +5,7 @@ import ( "encoding" "encoding/json" "reflect" + "sync" "sync/atomic" "unsafe" @@ -24,14 +25,17 @@ var ( cachedOpcodeSets []*OpcodeSet cachedOpcodeMap unsafe.Pointer // map[uintptr]*OpcodeSet typeAddr *runtime.TypeAddr + initEncoderOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift) +func initEncoder() { + initEncoderOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadOpcodeMap() map[uintptr]*OpcodeSet { @@ -480,14 +484,17 @@ func (c *Compiler) mapCode(typ *runtime.Type) (*MapCode, error) { func (c *Compiler) listElemCode(typ *runtime.Type) (Code, error) { switch { - case c.isPtrMarshalJSONType(typ): + case c.implementsMarshalJSONType(typ) || c.implementsMarshalJSONType(runtime.PtrTo(typ)): return c.marshalJSONCode(typ) case !typ.Implements(marshalTextType) && runtime.PtrTo(typ).Implements(marshalTextType): return c.marshalTextCode(typ) case typ.Kind() == reflect.Map: return c.ptrCode(runtime.PtrTo(typ)) default: - code, err := c.typeToCodeWithPtr(typ, false) + // isPtr was originally used to indicate whether the type of top level is pointer. + // However, since the slice/array element is a specification that can get the pointer address, explicitly set isPtr to true. + // See here for related issues: https://github.com/goccy/go-json/issues/370 + code, err := c.typeToCodeWithPtr(typ, true) if err != nil { return nil, err } @@ -503,8 +510,6 @@ func (c *Compiler) listElemCode(typ *runtime.Type) (Code, error) { func (c *Compiler) mapKeyCode(typ *runtime.Type) (Code, error) { switch { - case c.implementsMarshalJSON(typ): - return c.marshalJSONCode(typ) case c.implementsMarshalText(typ): return c.marshalTextCode(typ) } @@ -616,6 +621,13 @@ func (c *Compiler) structCode(typ *runtime.Type, isPtr bool) (*StructCode, error return code, nil } +func toElemType(t *runtime.Type) *runtime.Type { + for t.Kind() == reflect.Ptr { + t = t.Elem() + } + return t +} + func (c *Compiler) structFieldCode(structCode *StructCode, tag *runtime.StructTag, isPtr, isOnlyOneFirstField bool) (*StructFieldCode, error) { field := tag.Field fieldType := runtime.Type2RType(field.Type) @@ -625,7 +637,7 @@ func (c *Compiler) structFieldCode(structCode *StructCode, tag *runtime.StructTa key: tag.Key, tag: tag, offset: field.Offset, - isAnonymous: field.Anonymous && !tag.IsTaggedKey, + isAnonymous: field.Anonymous && !tag.IsTaggedKey && toElemType(fieldType).Kind() == reflect.Struct, isTaggedKey: tag.IsTaggedKey, isNilableType: c.isNilableType(fieldType), isNilCheck: true, @@ -853,6 +865,9 @@ func (c *Compiler) implementsMarshalText(typ *runtime.Type) bool { } func (c *Compiler) isNilableType(typ *runtime.Type) bool { + if !runtime.IfaceIndir(typ) { + return true + } switch typ.Kind() { case reflect.Ptr: return true @@ -885,29 +900,40 @@ func (c *Compiler) codeToOpcode(ctx *compileContext, typ *runtime.Type, code Cod } func (c *Compiler) linkRecursiveCode(ctx *compileContext) { + recursiveCodes := map[uintptr]*CompiledCode{} for _, recursive := range *ctx.recursiveCodes { typeptr := uintptr(unsafe.Pointer(recursive.Type)) codes := ctx.structTypeToCodes[typeptr] - compiled := recursive.Jmp - compiled.Code = copyOpcode(codes.First()) - code := compiled.Code - code.End.Next = newEndOp(&compileContext{}, recursive.Type) + if recursiveCode, ok := recursiveCodes[typeptr]; ok { + *recursive.Jmp = *recursiveCode + continue + } + + code := copyOpcode(codes.First()) code.Op = code.Op.PtrHeadToHead() + lastCode := newEndOp(&compileContext{}, recursive.Type) + lastCode.Op = OpRecursiveEnd - beforeLastCode := code.End - lastCode := beforeLastCode.Next + // OpRecursiveEnd must set before call TotalLength + code.End.Next = lastCode totalLength := code.TotalLength() + + // Idx, ElemIdx, Length must set after call TotalLength lastCode.Idx = uint32((totalLength + 1) * uintptrSize) lastCode.ElemIdx = lastCode.Idx + uintptrSize lastCode.Length = lastCode.Idx + 2*uintptrSize - code.End.Next.Op = OpRecursiveEnd // extend length to alloc slot for elemIdx + length curTotalLength := uintptr(recursive.TotalLength()) + 3 nextTotalLength := uintptr(totalLength) + 3 + + compiled := recursive.Jmp + compiled.Code = code compiled.CurLen = curTotalLength compiled.NextLen = nextTotalLength compiled.Linked = true + + recursiveCodes[typeptr] = compiled } } diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go index 20c93cbf..b6f45a49 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go @@ -4,6 +4,7 @@ package encoder func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go index 13ba23fd..47b482f7 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go @@ -10,6 +10,7 @@ import ( var setsMu sync.RWMutex func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go index 14eb6a0d..b436f5b2 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go @@ -406,6 +406,11 @@ func AppendMarshalJSON(ctx *RuntimeContext, code *Opcode, b []byte, v interface{ rv = newV } } + + if rv.Kind() == reflect.Ptr && rv.IsNil() { + return AppendNull(ctx, b), nil + } + v = rv.Interface() var bb []byte if (code.Flags & MarshalerContextFlags) != 0 { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/int.go b/vendor/github.com/goccy/go-json/internal/encoder/int.go index 85f07960..8b5febea 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/int.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/int.go @@ -1,3 +1,27 @@ +// This files's processing codes are inspired by https://github.com/segmentio/encoding. +// The license notation is as follows. +// +// # MIT License +// +// Copyright (c) 2019 Segment.io, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in all +// copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +// SOFTWARE. package encoder import ( diff --git a/vendor/github.com/goccy/go-json/internal/encoder/opcode.go b/vendor/github.com/goccy/go-json/internal/encoder/opcode.go index 05fc3ce0..df22f554 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/opcode.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/opcode.go @@ -1,7 +1,9 @@ package encoder import ( + "bytes" "fmt" + "sort" "strings" "unsafe" @@ -555,6 +557,87 @@ func (c *Opcode) Dump() string { return strings.Join(codes, "\n") } +func (c *Opcode) DumpDOT() string { + type edge struct { + from, to *Opcode + label string + weight int + } + var edges []edge + + b := &bytes.Buffer{} + fmt.Fprintf(b, "digraph \"%p\" {\n", c.Type) + fmt.Fprintln(b, "mclimit=1.5;\nrankdir=TD;\nordering=out;\nnode[shape=box];") + for code := c; !code.IsEnd(); { + label := code.Op.String() + fmt.Fprintf(b, "\"%p\" [label=%q];\n", code, label) + if p := code.Next; p != nil { + edges = append(edges, edge{ + from: code, + to: p, + label: "Next", + weight: 10, + }) + } + if p := code.NextField; p != nil { + edges = append(edges, edge{ + from: code, + to: p, + label: "NextField", + weight: 2, + }) + } + if p := code.End; p != nil { + edges = append(edges, edge{ + from: code, + to: p, + label: "End", + weight: 1, + }) + } + if p := code.Jmp; p != nil { + edges = append(edges, edge{ + from: code, + to: p.Code, + label: "Jmp", + weight: 1, + }) + } + + switch code.Op.CodeType() { + case CodeSliceHead: + code = code.Next + case CodeMapHead: + code = code.Next + case CodeArrayElem, CodeSliceElem: + code = code.End + case CodeMapKey: + code = code.End + case CodeMapValue: + code = code.Next + case CodeMapEnd: + code = code.Next + case CodeStructField: + code = code.Next + case CodeStructEnd: + code = code.Next + default: + code = code.Next + } + if code.IsEnd() { + fmt.Fprintf(b, "\"%p\" [label=%q];\n", code, code.Op.String()) + } + } + sort.Slice(edges, func(i, j int) bool { + return edges[i].to.DisplayIdx < edges[j].to.DisplayIdx + }) + for _, e := range edges { + fmt.Fprintf(b, "\"%p\" -> \"%p\" [label=%q][weight=%d];\n", e.from, e.to, e.label, e.weight) + } + fmt.Fprint(b, "}") + return b.String() +} + func newSliceHeaderCode(ctx *compileContext, typ *runtime.Type) *Opcode { idx := opcodeOffset(ctx.ptrIndex) ctx.incPtrIndex() diff --git a/vendor/github.com/goccy/go-json/internal/encoder/option.go b/vendor/github.com/goccy/go-json/internal/encoder/option.go index 82d5ce3e..12c58e46 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/option.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/option.go @@ -23,6 +23,7 @@ type Option struct { ColorScheme *ColorScheme Context context.Context DebugOut io.Writer + DebugDOTOut io.WriteCloser } type EncodeFormat struct { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/string.go b/vendor/github.com/goccy/go-json/internal/encoder/string.go index e4152b27..4abb8416 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/string.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/string.go @@ -1,3 +1,27 @@ +// This files's string processing codes are inspired by https://github.com/segmentio/encoding. +// The license notation is as follows. +// +// # MIT License +// +// Copyright (c) 2019 Segment.io, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in all +// copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +// SOFTWARE. package encoder import ( diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm/debug_vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm/debug_vm.go index fbbc0de4..82b6dd47 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/vm/debug_vm.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm/debug_vm.go @@ -2,6 +2,7 @@ package vm import ( "fmt" + "io" "github.com/goccy/go-json/internal/encoder" ) @@ -14,6 +15,11 @@ func DebugRun(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) } else { code = codeSet.NoescapeKeyCode } + if wc := ctx.Option.DebugDOTOut; wc != nil { + _, _ = io.WriteString(wc, code.DumpDOT()) + wc.Close() + ctx.Option.DebugDOTOut = nil + } if err := recover(); err != nil { w := ctx.Option.DebugOut diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm/vm.go index 91b11e1f..645d20f9 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/vm/vm.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm/vm.go @@ -3,6 +3,7 @@ package vm import ( "math" + "reflect" "sort" "unsafe" @@ -194,9 +195,12 @@ func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]b typ = iface.typ } if ifacePtr == nil { - b = appendNullComma(ctx, b) - code = code.Next - break + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } } ctx.KeepRefs = append(ctx.KeepRefs, up) ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/vm.go index 5c6c52c3..a63e83e5 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/vm_color/vm.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/vm.go @@ -3,6 +3,7 @@ package vm_color import ( "math" + "reflect" "sort" "unsafe" @@ -194,9 +195,12 @@ func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]b typ = iface.typ } if ifacePtr == nil { - b = appendNullComma(ctx, b) - code = code.Next - break + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } } ctx.KeepRefs = append(ctx.KeepRefs, up) ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/util.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/util.go index 60e4a8ed..2395abec 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/util.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/util.go @@ -189,7 +189,7 @@ func appendNullComma(ctx *encoder.RuntimeContext, b []byte) []byte { } func appendColon(_ *encoder.RuntimeContext, b []byte) []byte { - return append(b, ':', ' ') + return append(b[:len(b)-2], ':', ' ') } func appendMapKeyValue(ctx *encoder.RuntimeContext, code *encoder.Opcode, b, key, value []byte) []byte { @@ -229,8 +229,9 @@ func appendEmptyObject(_ *encoder.RuntimeContext, b []byte) []byte { func appendObjectEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { last := len(b) - 1 - b[last] = '\n' - b = appendIndent(ctx, b, code.Indent-1) + // replace comma to newline + b[last-1] = '\n' + b = appendIndent(ctx, b[:last], code.Indent) return append(b, '}', ',', '\n') } diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/vm.go index 42dc11ca..3b4e22e5 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/vm.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/vm.go @@ -3,6 +3,7 @@ package vm_color_indent import ( "math" + "reflect" "sort" "unsafe" @@ -194,9 +195,12 @@ func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]b typ = iface.typ } if ifacePtr == nil { - b = appendNullComma(ctx, b) - code = code.Next - break + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } } ctx.KeepRefs = append(ctx.KeepRefs, up) ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/util.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/util.go index fca8f185..6cb745e3 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/util.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/util.go @@ -133,7 +133,7 @@ func appendNullComma(_ *encoder.RuntimeContext, b []byte) []byte { } func appendColon(_ *encoder.RuntimeContext, b []byte) []byte { - return append(b, ':', ' ') + return append(b[:len(b)-2], ':', ' ') } func appendMapKeyValue(ctx *encoder.RuntimeContext, code *encoder.Opcode, b, key, value []byte) []byte { @@ -173,8 +173,9 @@ func appendEmptyObject(_ *encoder.RuntimeContext, b []byte) []byte { func appendObjectEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { last := len(b) - 1 - b[last] = '\n' - b = appendIndent(ctx, b, code.Indent-1) + // replace comma to newline + b[last-1] = '\n' + b = appendIndent(ctx, b[:last], code.Indent) return append(b, '}', ',', '\n') } diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/vm.go index dfe0cc64..836c5c8a 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/vm.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/vm.go @@ -3,6 +3,7 @@ package vm_indent import ( "math" + "reflect" "sort" "unsafe" @@ -194,9 +195,12 @@ func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]b typ = iface.typ } if ifacePtr == nil { - b = appendNullComma(ctx, b) - code = code.Next - break + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } } ctx.KeepRefs = append(ctx.KeepRefs, up) ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) diff --git a/vendor/github.com/goccy/go-json/internal/errors/error.go b/vendor/github.com/goccy/go-json/internal/errors/error.go index d58e39f4..9207d0ff 100644 --- a/vendor/github.com/goccy/go-json/internal/errors/error.go +++ b/vendor/github.com/goccy/go-json/internal/errors/error.go @@ -162,3 +162,22 @@ func ErrInvalidBeginningOfValue(c byte, cursor int64) *SyntaxError { Offset: cursor, } } + +type PathError struct { + msg string +} + +func (e *PathError) Error() string { + return fmt.Sprintf("json: invalid path format: %s", e.msg) +} + +func ErrInvalidPath(msg string, args ...interface{}) *PathError { + if len(args) != 0 { + return &PathError{msg: fmt.Sprintf(msg, args...)} + } + return &PathError{msg: msg} +} + +func ErrEmptyPath() *PathError { + return &PathError{msg: "path is empty"} +} diff --git a/vendor/github.com/goccy/go-json/internal/runtime/rtype.go b/vendor/github.com/goccy/go-json/internal/runtime/rtype.go index 4db10deb..37cfe35a 100644 --- a/vendor/github.com/goccy/go-json/internal/runtime/rtype.go +++ b/vendor/github.com/goccy/go-json/internal/runtime/rtype.go @@ -252,7 +252,6 @@ func IfaceIndir(*Type) bool //go:noescape func RType2Type(t *Type) reflect.Type -//go:nolint structcheck type emptyInterface struct { _ *Type ptr unsafe.Pointer diff --git a/vendor/github.com/goccy/go-json/internal/runtime/struct_field.go b/vendor/github.com/goccy/go-json/internal/runtime/struct_field.go index c321180a..baab0c59 100644 --- a/vendor/github.com/goccy/go-json/internal/runtime/struct_field.go +++ b/vendor/github.com/goccy/go-json/internal/runtime/struct_field.go @@ -13,7 +13,11 @@ func getTag(field reflect.StructField) string { func IsIgnoredStructField(field reflect.StructField) bool { if field.PkgPath != "" { if field.Anonymous { - if !(field.Type.Kind() == reflect.Ptr && field.Type.Elem().Kind() == reflect.Struct) && field.Type.Kind() != reflect.Struct { + t := field.Type + if t.Kind() == reflect.Ptr { + t = t.Elem() + } + if t.Kind() != reflect.Struct { return true } } else { diff --git a/vendor/github.com/goccy/go-json/internal/runtime/type.go b/vendor/github.com/goccy/go-json/internal/runtime/type.go index 0167cd2c..4b693cb0 100644 --- a/vendor/github.com/goccy/go-json/internal/runtime/type.go +++ b/vendor/github.com/goccy/go-json/internal/runtime/type.go @@ -2,6 +2,7 @@ package runtime import ( "reflect" + "sync" "unsafe" ) @@ -23,8 +24,8 @@ type TypeAddr struct { } var ( - typeAddr *TypeAddr - alreadyAnalyzed bool + typeAddr *TypeAddr + once sync.Once ) //go:linkname typelinks reflect.typelinks @@ -34,67 +35,64 @@ func typelinks() ([]unsafe.Pointer, [][]int32) func rtypeOff(unsafe.Pointer, int32) unsafe.Pointer func AnalyzeTypeAddr() *TypeAddr { - defer func() { - alreadyAnalyzed = true - }() - if alreadyAnalyzed { - return typeAddr - } - sections, offsets := typelinks() - if len(sections) != 1 { - return nil - } - if len(offsets) != 1 { - return nil - } - section := sections[0] - offset := offsets[0] - var ( - min uintptr = uintptr(^uint(0)) - max uintptr = 0 - isAligned64 = true - isAligned32 = true - ) - for i := 0; i < len(offset); i++ { - typ := (*Type)(rtypeOff(section, offset[i])) - addr := uintptr(unsafe.Pointer(typ)) - if min > addr { - min = addr + once.Do(func() { + sections, offsets := typelinks() + if len(sections) != 1 { + return } - if max < addr { - max = addr + if len(offsets) != 1 { + return } - if typ.Kind() == reflect.Ptr { - addr = uintptr(unsafe.Pointer(typ.Elem())) + section := sections[0] + offset := offsets[0] + var ( + min uintptr = uintptr(^uint(0)) + max uintptr = 0 + isAligned64 = true + isAligned32 = true + ) + for i := 0; i < len(offset); i++ { + typ := (*Type)(rtypeOff(section, offset[i])) + addr := uintptr(unsafe.Pointer(typ)) if min > addr { min = addr } if max < addr { max = addr } + if typ.Kind() == reflect.Ptr { + addr = uintptr(unsafe.Pointer(typ.Elem())) + if min > addr { + min = addr + } + if max < addr { + max = addr + } + } + isAligned64 = isAligned64 && (addr-min)&63 == 0 + isAligned32 = isAligned32 && (addr-min)&31 == 0 + } + addrRange := max - min + if addrRange == 0 { + return + } + var addrShift uintptr + if isAligned64 { + addrShift = 6 + } else if isAligned32 { + addrShift = 5 } - isAligned64 = isAligned64 && (addr-min)&63 == 0 - isAligned32 = isAligned32 && (addr-min)&31 == 0 - } - addrRange := max - min - if addrRange == 0 { - return nil - } - var addrShift uintptr - if isAligned64 { - addrShift = 6 - } else if isAligned32 { - addrShift = 5 - } - cacheSize := addrRange >> addrShift - if cacheSize > maxAcceptableTypeAddrRange { - return nil - } - typeAddr = &TypeAddr{ - BaseTypeAddr: min, - MaxTypeAddr: max, - AddrRange: addrRange, - AddrShift: addrShift, - } + cacheSize := addrRange >> addrShift + if cacheSize > maxAcceptableTypeAddrRange { + return + } + typeAddr = &TypeAddr{ + BaseTypeAddr: min, + MaxTypeAddr: max, + AddrRange: addrRange, + AddrShift: addrShift, + } + }) + return typeAddr } diff --git a/vendor/github.com/goccy/go-json/json.go b/vendor/github.com/goccy/go-json/json.go index 413cb20b..fb18065a 100644 --- a/vendor/github.com/goccy/go-json/json.go +++ b/vendor/github.com/goccy/go-json/json.go @@ -89,31 +89,31 @@ type UnmarshalerContext interface { // // Examples of struct field tags and their meanings: // -// // Field appears in JSON as key "myName". -// Field int `json:"myName"` +// // Field appears in JSON as key "myName". +// Field int `json:"myName"` // -// // Field appears in JSON as key "myName" and -// // the field is omitted from the object if its value is empty, -// // as defined above. -// Field int `json:"myName,omitempty"` +// // Field appears in JSON as key "myName" and +// // the field is omitted from the object if its value is empty, +// // as defined above. +// Field int `json:"myName,omitempty"` // -// // Field appears in JSON as key "Field" (the default), but -// // the field is skipped if empty. -// // Note the leading comma. -// Field int `json:",omitempty"` +// // Field appears in JSON as key "Field" (the default), but +// // the field is skipped if empty. +// // Note the leading comma. +// Field int `json:",omitempty"` // -// // Field is ignored by this package. -// Field int `json:"-"` +// // Field is ignored by this package. +// Field int `json:"-"` // -// // Field appears in JSON as key "-". -// Field int `json:"-,"` +// // Field appears in JSON as key "-". +// Field int `json:"-,"` // // The "string" option signals that a field is stored as JSON inside a // JSON-encoded string. It applies only to fields of string, floating point, // integer, or boolean types. This extra level of encoding is sometimes used // when communicating with JavaScript programs: // -// Int64String int64 `json:",string"` +// Int64String int64 `json:",string"` // // The key name will be used if it's a non-empty string consisting of // only Unicode letters, digits, and ASCII punctuation except quotation @@ -166,7 +166,6 @@ type UnmarshalerContext interface { // JSON cannot represent cyclic data structures and Marshal does not // handle them. Passing cyclic structures to Marshal will result in // an infinite recursion. -// func Marshal(v interface{}) ([]byte, error) { return MarshalWithOption(v) } @@ -264,14 +263,13 @@ func MarshalIndentWithOption(v interface{}, prefix, indent string, optFuncs ...E // // The JSON null value unmarshals into an interface, map, pointer, or slice // by setting that Go value to nil. Because null is often used in JSON to mean -// ``not present,'' unmarshaling a JSON null into any other Go type has no effect +// “not present,” unmarshaling a JSON null into any other Go type has no effect // on the value and produces no error. // // When unmarshaling quoted strings, invalid UTF-8 or // invalid UTF-16 surrogate pairs are not treated as an error. // Instead, they are replaced by the Unicode replacement // character U+FFFD. -// func Unmarshal(data []byte, v interface{}) error { return unmarshal(data, v) } @@ -299,7 +297,6 @@ func UnmarshalNoEscape(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) // Number, for JSON numbers // string, for JSON string literals // nil, for JSON null -// type Token = json.Token // A Number represents a JSON number literal. diff --git a/vendor/github.com/goccy/go-json/option.go b/vendor/github.com/goccy/go-json/option.go index af400a45..378031a0 100644 --- a/vendor/github.com/goccy/go-json/option.go +++ b/vendor/github.com/goccy/go-json/option.go @@ -48,6 +48,13 @@ func DebugWith(w io.Writer) EncodeOptionFunc { } } +// DebugDOT sets the destination to write opcodes graph. +func DebugDOT(w io.WriteCloser) EncodeOptionFunc { + return func(opt *EncodeOption) { + opt.DebugDOTOut = w + } +} + // Colorize add an identifier for coloring to the string of the encoded result. func Colorize(scheme *ColorScheme) EncodeOptionFunc { return func(opt *EncodeOption) { diff --git a/vendor/github.com/goccy/go-json/path.go b/vendor/github.com/goccy/go-json/path.go new file mode 100644 index 00000000..38abce78 --- /dev/null +++ b/vendor/github.com/goccy/go-json/path.go @@ -0,0 +1,84 @@ +package json + +import ( + "reflect" + + "github.com/goccy/go-json/internal/decoder" +) + +// CreatePath creates JSON Path. +// +// JSON Path rule +// $ : root object or element. The JSON Path format must start with this operator, which refers to the outermost level of the JSON-formatted string. +// . : child operator. You can identify child values using dot-notation. +// .. : recursive descent. +// [] : subscript operator. If the JSON object is an array, you can use brackets to specify the array index. +// [*] : all objects/elements for array. +// +// Reserved words must be properly escaped when included in Path. +// +// Escape Rule +// single quote style escape: e.g.) `$['a.b'].c` +// double quote style escape: e.g.) `$."a.b".c` +func CreatePath(p string) (*Path, error) { + path, err := decoder.PathString(p).Build() + if err != nil { + return nil, err + } + return &Path{path: path}, nil +} + +// Path represents JSON Path. +type Path struct { + path *decoder.Path +} + +// RootSelectorOnly whether only the root selector ($) is used. +func (p *Path) RootSelectorOnly() bool { + return p.path.RootSelectorOnly +} + +// UsedSingleQuotePathSelector whether single quote-based escaping was done when building the JSON Path. +func (p *Path) UsedSingleQuotePathSelector() bool { + return p.path.SingleQuotePathSelector +} + +// UsedSingleQuotePathSelector whether double quote-based escaping was done when building the JSON Path. +func (p *Path) UsedDoubleQuotePathSelector() bool { + return p.path.DoubleQuotePathSelector +} + +// Extract extracts a specific JSON string. +func (p *Path) Extract(data []byte, optFuncs ...DecodeOptionFunc) ([][]byte, error) { + return extractFromPath(p, data, optFuncs...) +} + +// PathString returns original JSON Path string. +func (p *Path) PathString() string { + return p.path.String() +} + +// Unmarshal extract and decode the value of the part corresponding to JSON Path from the input data. +func (p *Path) Unmarshal(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { + contents, err := extractFromPath(p, data, optFuncs...) + if err != nil { + return err + } + results := make([]interface{}, 0, len(contents)) + for _, content := range contents { + var result interface{} + if err := Unmarshal(content, &result); err != nil { + return err + } + results = append(results, result) + } + if err := decoder.AssignValue(reflect.ValueOf(results), reflect.ValueOf(v)); err != nil { + return err + } + return nil +} + +// Get extract and substitute the value of the part corresponding to JSON Path from the input value. +func (p *Path) Get(src, dst interface{}) error { + return p.path.Get(reflect.ValueOf(src), reflect.ValueOf(dst)) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/.gitignore b/vendor/github.com/klauspost/cpuid/v2/.gitignore new file mode 100644 index 00000000..daf913b1 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/.gitignore @@ -0,0 +1,24 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof diff --git a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml new file mode 100644 index 00000000..1b695b62 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml @@ -0,0 +1,57 @@ +version: 2 + +builds: + - + id: "cpuid" + binary: cpuid + main: ./cmd/cpuid/main.go + env: + - CGO_ENABLED=0 + flags: + - -ldflags=-s -w + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm64 + goarm: + - 7 + +archives: + - + id: cpuid + name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}" + format_overrides: + - goos: windows + format: zip + files: + - LICENSE +checksum: + name_template: 'checksums.txt' +changelog: + sort: asc + filters: + exclude: + - '^doc:' + - '^docs:' + - '^test:' + - '^tests:' + - '^Update\sREADME.md' + +nfpms: + - + file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}" + vendor: Klaus Post + homepage: https://github.com/klauspost/cpuid + maintainer: Klaus Post + description: CPUID Tool + license: BSD 3-Clause + formats: + - deb + - rpm diff --git a/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt new file mode 100644 index 00000000..2ef4714f --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt @@ -0,0 +1,35 @@ +Developer Certificate of Origin +Version 1.1 + +Copyright (C) 2015- Klaus Post & Contributors. +Email: klauspost@gmail.com + +Everyone is permitted to copy and distribute verbatim copies of this +license document, but changing it is not allowed. + + +Developer's Certificate of Origin 1.1 + +By making a contribution to this project, I certify that: + +(a) The contribution was created in whole or in part by me and I + have the right to submit it under the open source license + indicated in the file; or + +(b) The contribution is based upon previous work that, to the best + of my knowledge, is covered under an appropriate open source + license and I have the right under that license to submit that + work with modifications, whether created in whole or in part + by me, under the same open source license (unless I am + permitted to submit under a different license), as indicated + in the file; or + +(c) The contribution was provided directly to me by some other + person who certified (a), (b) or (c) and I have not modified + it. + +(d) I understand and agree that this project and the contribution + are public and that a record of the contribution (including all + personal information I submit with it, including my sign-off) is + maintained indefinitely and may be redistributed consistent with + this project or the open source license(s) involved. diff --git a/vendor/github.com/klauspost/cpuid/v2/LICENSE b/vendor/github.com/klauspost/cpuid/v2/LICENSE new file mode 100644 index 00000000..5cec7ee9 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/LICENSE @@ -0,0 +1,22 @@ +The MIT License (MIT) + +Copyright (c) 2015 Klaus Post + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md new file mode 100644 index 00000000..e59d3d0c --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -0,0 +1,505 @@ +# cpuid +Package cpuid provides information about the CPU running the current program. + +CPU features are detected on startup, and kept for fast access through the life of the application. +Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use. + +You can access the CPU information by accessing the shared CPU variable of the cpuid library. + +Package home: https://github.com/klauspost/cpuid + +[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2) +[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml) + +## installing + +`go get -u github.com/klauspost/cpuid/v2` using modules. +Drop `v2` for others. + +Installing binary: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +Or download binaries from release page: https://github.com/klauspost/cpuid/releases + +### Homebrew + +For macOS/Linux users, you can install via [brew](https://brew.sh/) + +```sh +$ brew install cpuid +``` + +## example + +```Go +package main + +import ( + "fmt" + "strings" + + . "github.com/klauspost/cpuid/v2" +) + +func main() { + // Print basic CPU information: + fmt.Println("Name:", CPU.BrandName) + fmt.Println("PhysicalCores:", CPU.PhysicalCores) + fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore) + fmt.Println("LogicalCores:", CPU.LogicalCores) + fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID) + fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ",")) + fmt.Println("Cacheline bytes:", CPU.CacheLine) + fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes") + fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes") + fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes") + fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes") + fmt.Println("Frequency", CPU.Hz, "hz") + + // Test if we have these specific features: + if CPU.Supports(SSE, SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +Sample output: +``` +>go run main.go +Name: AMD Ryzen 9 3950X 16-Core Processor +PhysicalCores: 16 +ThreadsPerCore: 2 +LogicalCores: 32 +Family 23 Model: 113 Vendor ID: AMD +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3 +Cacheline bytes: 64 +L1 Data Cache: 32768 bytes +L1 Instruction Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes +Frequency 0 hz +We have Streaming SIMD 2 Extensions +``` + +# usage + +The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. +A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. + +To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc. +This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported. + +Note that for some cpu/os combinations some features will not be detected. +`amd64` has rather good support and should work reliably on all platforms. + +Note that hypervisors may not pass through all CPU features through to the guest OS, +so even if your host supports a feature it may not be visible on guests. + +## arm64 feature detection + +Not all operating systems provide ARM features directly +and there is no safe way to do so for the rest. + +Currently `arm64/linux` and `arm64/freebsd` should be quite reliable. +`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected. + +A `DetectARM()` can be used if you are able to control your deployment, +it will detect CPU features, but may crash if the OS doesn't intercept the calls. +A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below. + +Note that currently only features are detected on ARM, +no additional information is currently available. + +## flags + +It is possible to add flags that affects cpu detection. + +For this the `Flags()` command is provided. + +This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called. + +This means that any detection used in `init()` functions will not contain these flags. + +Example: + +```Go +package main + +import ( + "flag" + "fmt" + "strings" + + "github.com/klauspost/cpuid/v2" +) + +func main() { + cpuid.Flags() + flag.Parse() + cpuid.Detect() + + // Test if we have these specific features: + if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +## commandline + +Download as binary from: https://github.com/klauspost/cpuid/releases + +Install from source: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +### Example + +``` +λ cpuid +Name: AMD Ryzen 9 3950X 16-Core Processor +Vendor String: AuthenticAMD +Vendor ID: AMD +PhysicalCores: 16 +Threads Per Core: 2 +Logical Cores: 32 +CPU Family 23 Model: 113 +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE +Microarchitecture level: 3 +Cacheline bytes: 64 +L1 Instruction Cache: 32768 bytes +L1 Data Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes + +``` +### JSON Output: + +``` +λ cpuid --json +{ + "BrandName": "AMD Ryzen 9 3950X 16-Core Processor", + "VendorID": 2, + "VendorString": "AuthenticAMD", + "PhysicalCores": 16, + "ThreadsPerCore": 2, + "LogicalCores": 32, + "Family": 23, + "Model": 113, + "CacheLine": 64, + "Hz": 0, + "BoostFreq": 0, + "Cache": { + "L1I": 32768, + "L1D": 32768, + "L2": 524288, + "L3": 16777216 + }, + "SGX": { + "Available": false, + "LaunchControl": false, + "SGX1Supported": false, + "SGX2Supported": false, + "MaxEnclaveSizeNot64": 0, + "MaxEnclaveSize64": 0, + "EPCSections": null + }, + "Features": [ + "ADX", + "AESNI", + "AVX", + "AVX2", + "BMI1", + "BMI2", + "CLMUL", + "CLZERO", + "CMOV", + "CMPXCHG8", + "CPBOOST", + "CX16", + "F16C", + "FMA3", + "FXSR", + "FXSROPT", + "HTT", + "HYPERVISOR", + "LAHF", + "LZCNT", + "MCAOVERFLOW", + "MMX", + "MMXEXT", + "MOVBE", + "NX", + "OSXSAVE", + "POPCNT", + "RDRAND", + "RDSEED", + "RDTSCP", + "SCE", + "SHA", + "SSE", + "SSE2", + "SSE3", + "SSE4", + "SSE42", + "SSE4A", + "SSSE3", + "SUCCOR", + "X87", + "XSAVE" + ], + "X64Level": 3 +} +``` + +### Check CPU microarch level + +``` +λ cpuid --check-level=3 +2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3. +Exit Code 0 + +λ cpuid --check-level=4 +2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3. +Exit Code 1 +``` + + +## Available flags + +### x86 & amd64 + +| Feature Flag | Description | +|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) | +| AESNI | Advanced Encryption Standard New Instructions | +| AMD3DNOW | AMD 3DNOW | +| AMD3DNOWEXT | AMD 3DNowExt | +| AMXBF16 | Tile computational operations on BFLOAT16 numbers | +| AMXINT8 | Tile computational operations on 8-bit integers | +| AMXFP16 | Tile computational operations on FP16 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | +| AMXCOMPLEX | Tile computational operations on complex numbers | +| AMXTILE | Tile architecture | +| AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile | +| APX_F | Intel APX | +| AVX | AVX functions | +| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported | +| AVX10_128 | If set indicates that AVX10 128-bit vector support is present | +| AVX10_256 | If set indicates that AVX10 256-bit vector support is present | +| AVX10_512 | If set indicates that AVX10 512-bit vector support is present | +| AVX2 | AVX2 functions | +| AVX512BF16 | AVX-512 BFLOAT16 Instructions | +| AVX512BITALG | AVX-512 Bit Algorithms | +| AVX512BW | AVX-512 Byte and Word Instructions | +| AVX512CD | AVX-512 Conflict Detection Instructions | +| AVX512DQ | AVX-512 Doubleword and Quadword Instructions | +| AVX512ER | AVX-512 Exponential and Reciprocal Instructions | +| AVX512F | AVX-512 Foundation | +| AVX512FP16 | AVX-512 FP16 Instructions | +| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions | +| AVX512PF | AVX-512 Prefetch Instructions | +| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions | +| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 | +| AVX512VL | AVX-512 Vector Length Extensions | +| AVX512VNNI | AVX-512 Vector Neural Network Instructions | +| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q | +| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword | +| AVXIFMA | AVX-IFMA instructions | +| AVXNECONVERT | AVX-NE-CONVERT instructions | +| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | +| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | +| AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| AVXVNNIINT16 | AVX-VNNI-INT16 instructions | +| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 | +| BMI1 | Bit Manipulation Instruction Set 1 | +| BMI2 | Bit Manipulation Instruction Set 2 | +| CETIBT | Intel CET Indirect Branch Tracking | +| CETSS | Intel CET Shadow Stack | +| CLDEMOTE | Cache Line Demote | +| CLMUL | Carry-less Multiplication | +| CLZERO | CLZERO instruction supported | +| CMOV | i686 CMOV | +| CMPCCXADD | CMPCCXADD instructions | +| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB | +| CMPXCHG8 | CMPXCHG8 instruction | +| CPBOOST | Core Performance Boost | +| CPPC | AMD: Collaborative Processor Performance Control | +| CX16 | CMPXCHG16B Instruction | +| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ | +| ENQCMD | Enqueue Command | +| ERMS | Enhanced REP MOVSB/STOSB | +| F16C | Half-precision floating-point conversion | +| FLUSH_L1D | Flush L1D cache | +| FMA3 | Intel FMA 3. Does not imply AVX. | +| FMA4 | Bulldozer FMA4 functions | +| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide | +| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide | +| FSRM | Fast Short Rep Mov | +| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 | +| FXSROPT | FXSAVE/FXRSTOR optimizations | +| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. | +| HLE | Hardware Lock Elision | +| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR | +| HTT | Hyperthreading (enabled) | +| HWA | Hardware assert supported. Indicates support for MSRC001_10 | +| HYBRID_CPU | This part has CPUs of more than one type. | +| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors | +| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) | +| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR | +| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) | +| IBRS | AMD: Indirect Branch Restricted Speculation | +| IBRS_PREFERRED | AMD: IBRS is preferred over software solution | +| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection | +| IBS | Instruction Based Sampling (AMD) | +| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) | +| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) | +| IBSFFV | Instruction Based Sampling Feature (AMD) | +| IBSOPCNT | Instruction Based Sampling Feature (AMD) | +| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) | +| IBSOPSAM | Instruction Based Sampling Feature (AMD) | +| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) | +| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) | +| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported | +| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported | +| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse | +| IBS_PREVENTHOST | Disallowing IBS use by the host supported | +| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 | +| IDPRED_CTRL | IPRED_DIS | +| INT_WBINVD | WBINVD/WBNOINVD are interruptible. | +| INVLPGB | NVLPGB and TLBSYNC instruction supported | +| KEYLOCKER | Key locker | +| KEYLOCKERW | Key locker wide | +| LAHF | LAHF/SAHF in long mode | +| LAM | If set, CPU supports Linear Address Masking | +| LBRVIRT | LBR virtualization | +| LZCNT | LZCNT instruction | +| MCAOVERFLOW | MCA overflow recovery support. | +| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. | +| MCOMMIT | MCOMMIT instruction supported | +| MD_CLEAR | VERW clears CPU buffers | +| MMX | standard MMX | +| MMXEXT | SSE integer functions or AMD MMX ext | +| MOVBE | MOVBE instruction (big-endian) | +| MOVDIR64B | Move 64 Bytes as Direct Store | +| MOVDIRI | Move Doubleword as Direct Store | +| MOVSB_ZL | Fast Zero-Length MOVSB | +| MPX | Intel MPX (Memory Protection Extensions) | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MSRIRC | Instruction Retired Counter MSR available | +| MSRLIST | Read/Write List of Model Specific Registers | +| MSR_PAGEFLUSH | Page Flush MSR available | +| NRIPS | Indicates support for NRIP save on VMEXIT | +| NX | NX (No-Execute) bit | +| OSXSAVE | XSAVE enabled by OS | +| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption | +| POPCNT | POPCNT instruction | +| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled | +| PREFETCHI | PREFETCHIT0/1 instructions | +| PSFD | Predictive Store Forward Disable | +| RDPRU | RDPRU instruction supported | +| RDRAND | RDRAND instruction is available | +| RDSEED | RDSEED instruction is available | +| RDTSCP | RDTSCP Instruction | +| RRSBA_CTRL | Restricted RSB Alternate | +| RTM | Restricted Transactional Memory | +| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. | +| SERIALIZE | Serialize Instruction Execution | +| SEV | AMD Secure Encrypted Virtualization supported | +| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host | +| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported | +| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests | +| SEV_ES | AMD SEV Encrypted State supported | +| SEV_RESTRICTED | AMD SEV Restricted Injection supported | +| SEV_SNP | AMD SEV Secure Nested Paging supported | +| SGX | Software Guard Extensions | +| SGXLC | Software Guard Extensions Launch Control | +| SHA | Intel SHA Extensions | +| SME | AMD Secure Memory Encryption supported | +| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | +| SPEC_CTRL_SSBD | Speculative Store Bypass Disable | +| SRBDS_CTRL | SRBDS mitigation MSR available | +| SSE | SSE functions | +| SSE2 | P4 SSE functions | +| SSE3 | Prescott SSE3 functions | +| SSE4 | Penryn SSE4.1 functions | +| SSE42 | Nehalem SSE4.2 functions | +| SSE4A | AMD Barcelona microarchitecture SSE4a instructions | +| SSSE3 | Conroe SSSE3 functions | +| STIBP | Single Thread Indirect Branch Predictors | +| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On | +| STOSB_SHORT | Fast short STOSB | +| SUCCOR | Software uncorrectable error containment and recovery capability. | +| SVM | AMD Secure Virtual Machine | +| SVMDA | Indicates support for the SVM decode assists. | +| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control | +| SVML | AMD SVM lock. Indicates support for SVM-Lock. | +| SVMNP | AMD SVM nested paging | +| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter | +| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold | +| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. | +| SYSEE | SYSENTER and SYSEXIT instructions | +| TBM | AMD Trailing Bit Manipulation | +| TDX_GUEST | Intel Trust Domain Extensions Guest | +| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | +| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | +| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | +| TSXLDTRK | Intel TSX Suspend Load Address Tracking | +| VAES | Vector AES. AVX(512) versions requires additional checks. | +| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. | +| VMPL | AMD VM Permission Levels supported | +| VMSA_REGPROT | AMD VMSA Register Protection supported | +| VMX | Virtual Machine Extensions | +| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. | +| VTE | AMD Virtual Transparent Encryption supported | +| WAITPKG | TPAUSE, UMONITOR, UMWAIT | +| WBNOINVD | Write Back and Do Not Invalidate Cache | +| WRMSRNS | Non-Serializing Write to Model Specific Register | +| X87 | FPU | +| XGETBV1 | Supports XGETBV with ECX = 1 | +| XOP | Bulldozer XOP functions | +| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV | +| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. | +| XSAVEOPT | XSAVEOPT available | +| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS | + +# ARM features: + +| Feature Flag | Description | +|--------------|------------------------------------------------------------------| +| AESARM | AES instructions | +| ARMCPUID | Some CPU ID registers readable at user-level | +| ASIMD | Advanced SIMD | +| ASIMDDP | SIMD Dot Product | +| ASIMDHP | Advanced SIMD half-precision floating point | +| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) | +| ATOMICS | Large System Extensions (LSE) | +| CRC32 | CRC32/CRC32C instructions | +| DCPOP | Data cache clean to Point of Persistence (DC CVAP) | +| EVTSTRM | Generic timer | +| FCMA | Floatin point complex number addition and multiplication | +| FHM | FMLAL and FMLSL instructions | +| FP | Single-precision and double-precision floating point | +| FPHP | Half-precision floating point | +| GPA | Generic Pointer Authentication | +| JSCVT | Javascript-style double->int convert (FJCVTZS) | +| LRCPC | Weaker release consistency (LDAPR, etc) | +| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) | +| RNDR | Random Number instructions | +| TLB | Outer Shareable and TLB range maintenance instructions | +| TS | Flag manipulation instructions | +| SHA1 | SHA-1 instructions (SHA1C, etc) | +| SHA2 | SHA-2 instructions (SHA256H, etc) | +| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) | +| SHA512 | SHA512 instructions | +| SM3 | SM3 instructions | +| SM4 | SM4 instructions | +| SVE | Scalable Vector Extension | + +# license + +This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go new file mode 100644 index 00000000..8103fb34 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -0,0 +1,1566 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +// Package cpuid provides information about the CPU running the current program. +// +// CPU features are detected on startup, and kept for fast access through the life of the application. +// Currently x86 / x64 (AMD64) as well as arm64 is supported. +// +// You can access the CPU information by accessing the shared CPU variable of the cpuid library. +// +// Package home: https://github.com/klauspost/cpuid +package cpuid + +import ( + "flag" + "fmt" + "math" + "math/bits" + "os" + "runtime" + "strings" +) + +// AMD refererence: https://www.amd.com/system/files/TechDocs/25481.pdf +// and Processor Programming Reference (PPR) + +// Vendor is a representation of a CPU vendor. +type Vendor int + +const ( + VendorUnknown Vendor = iota + Intel + AMD + VIA + Transmeta + NSC + KVM // Kernel-based Virtual Machine + MSVM // Microsoft Hyper-V or Windows Virtual PC + VMware + XenHVM + Bhyve + Hygon + SiS + RDC + + Ampere + ARM + Broadcom + Cavium + DEC + Fujitsu + Infineon + Motorola + NVIDIA + AMCC + Qualcomm + Marvell + + QEMU + QNX + ACRN + SRE + Apple + + lastVendor +) + +//go:generate stringer -type=FeatureID,Vendor + +// FeatureID is the ID of a specific cpu feature. +type FeatureID int + +const ( + // Keep index -1 as unknown + UNKNOWN = -1 + + // x86 features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXFP8 // Tile computational operations on FP8 numbers + AMXTILE // Tile architecture + AMXTF32 // Tile architecture + AMXCOMPLEX // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile + APX_F // Intel APX + AVX // AVX functions + AVX10 // If set the Intel AVX10 Converged Vector ISA is supported + AVX10_128 // If set indicates that AVX10 128-bit vector support is present + AVX10_256 // If set indicates that AVX10 256-bit vector support is present + AVX10_512 // If set indicates that AVX10 512-bit vector support is present + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + AVXVNNIINT16 // AVX-VNNI-INT16 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control + CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + KEYLOCKER // Key locker + KEYLOCKERW // Key locker wide + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. + MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SBPB // Indicates support for the Selective Branch Predictor Barrier + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available + SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO. + SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability + SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + + // ARM features: + AESARM // AES instructions + ARMCPUID // Some CPU ID registers readable at user-level + ASIMD // Advanced SIMD + ASIMDDP // SIMD Dot Product + ASIMDHP // Advanced SIMD half-precision floating point + ASIMDRDM // Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) + ATOMICS // Large System Extensions (LSE) + CRC32 // CRC32/CRC32C instructions + DCPOP // Data cache clean to Point of Persistence (DC CVAP) + EVTSTRM // Generic timer + FCMA // Floatin point complex number addition and multiplication + FHM // FMLAL and FMLSL instructions + FP // Single-precision and double-precision floating point + FPHP // Half-precision floating point + GPA // Generic Pointer Authentication + JSCVT // Javascript-style double->int convert (FJCVTZS) + LRCPC // Weaker release consistency (LDAPR, etc) + PMULL // Polynomial Multiply instructions (PMULL/PMULL2) + RNDR // Random Number instructions + TLB // Outer Shareable and TLB range maintenance instructions + TS // Flag manipulation instructions + SHA1 // SHA-1 instructions (SHA1C, etc) + SHA2 // SHA-2 instructions (SHA256H, etc) + SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX) + SHA512 // SHA512 instructions + SM3 // SM3 instructions + SM4 // SM4 instructions + SVE // Scalable Vector Extension + // Keep it last. It automatically defines the size of []flagSet + lastID + + firstID FeatureID = UNKNOWN + 1 +) + +// CPUInfo contains information about the detected system CPU. +type CPUInfo struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + HypervisorVendorID Vendor // Hypervisor vendor + HypervisorVendorString string // Raw hypervisor vendor string + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { + L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected + L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected + L2 int // L2 Cache (per core or shared). Will be -1 if undetected + L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected + } + SGX SGXSupport + AMDMemEncryption AMDMemEncryptionSupport + AVX10Level uint8 + + maxFunc uint32 + maxExFunc uint32 +} + +var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) +var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32) +var xgetbv func(index uint32) (eax, edx uint32) +var rdtscpAsm func() (eax, ebx, ecx, edx uint32) +var darwinHasAVX512 = func() bool { return false } + +// CPU contains information about the CPU as detected on startup, +// or when Detect last was called. +// +// Use this as the primary entry point to you data. +var CPU CPUInfo + +func init() { + initCPU() + Detect() +} + +// Detect will re-detect current CPU info. +// This will replace the content of the exported CPU variable. +// +// Unless you expect the CPU to change while you are running your program +// you should not need to call this function. +// If you call this, you must ensure that no other goroutine is accessing the +// exported CPU variable. +func Detect() { + // Set defaults + CPU.ThreadsPerCore = 1 + CPU.Cache.L1I = -1 + CPU.Cache.L1D = -1 + CPU.Cache.L2 = -1 + CPU.Cache.L3 = -1 + safe := true + if detectArmFlag != nil { + safe = !*detectArmFlag + } + addInfo(&CPU, safe) + if displayFeats != nil && *displayFeats { + fmt.Println("cpu features:", strings.Join(CPU.FeatureSet(), ",")) + // Exit with non-zero so tests will print value. + os.Exit(1) + } + if disableFlag != nil { + s := strings.Split(*disableFlag, ",") + for _, feat := range s { + feat := ParseFeature(strings.TrimSpace(feat)) + if feat != UNKNOWN { + CPU.featureSet.unset(feat) + } + } + } +} + +// DetectARM will detect ARM64 features. +// This is NOT done automatically since it can potentially crash +// if the OS does not handle the command. +// If in the future this can be done safely this function may not +// do anything. +func DetectARM() { + addInfo(&CPU, false) +} + +var detectArmFlag *bool +var displayFeats *bool +var disableFlag *string + +// Flags will enable flags. +// This must be called *before* flag.Parse AND +// Detect must be called after the flags have been parsed. +// Note that this means that any detection used in init() functions +// will not contain these flags. +func Flags() { + disableFlag = flag.String("cpu.disable", "", "disable cpu features; comma separated list") + displayFeats = flag.Bool("cpu.features", false, "lists cpu features and exits") + detectArmFlag = flag.Bool("cpu.arm", false, "allow ARM features to be detected; can potentially crash") +} + +// Supports returns whether the CPU supports all of the requested features. +func (c CPUInfo) Supports(ids ...FeatureID) bool { + for _, id := range ids { + if !c.featureSet.inSet(id) { + return false + } + } + return true +} + +// Has allows for checking a single feature. +// Should be inlined by the compiler. +func (c *CPUInfo) Has(id FeatureID) bool { + return c.featureSet.inSet(id) +} + +// AnyOf returns whether the CPU supports one or more of the requested features. +func (c CPUInfo) AnyOf(ids ...FeatureID) bool { + for _, id := range ids { + if c.featureSet.inSet(id) { + return true + } + } + return false +} + +// Features contains several features combined for a fast check using +// CpuInfo.HasAll +type Features *flagSet + +// CombineFeatures allows to combine several features for a close to constant time lookup. +func CombineFeatures(ids ...FeatureID) Features { + var v flagSet + for _, id := range ids { + v.set(id) + } + return &v +} + +func (c *CPUInfo) HasAll(f Features) bool { + return c.featureSet.hasSetP(f) +} + +// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +var oneOfLevel = CombineFeatures(SYSEE, SYSCALL) +var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2) +var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) +var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) +var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) + +// X64Level returns the microarchitecture level detected on the CPU. +// If features are lacking or non x64 mode, 0 is returned. +// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +func (c CPUInfo) X64Level() int { + if !c.featureSet.hasOneOf(oneOfLevel) { + return 0 + } + if c.featureSet.hasSetP(level4Features) { + return 4 + } + if c.featureSet.hasSetP(level3Features) { + return 3 + } + if c.featureSet.hasSetP(level2Features) { + return 2 + } + if c.featureSet.hasSetP(level1Features) { + return 1 + } + return 0 +} + +// Disable will disable one or several features. +func (c *CPUInfo) Disable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.unset(id) + } + return true +} + +// Enable will disable one or several features even if they were undetected. +// This is of course not recommended for obvious reasons. +func (c *CPUInfo) Enable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.set(id) + } + return true +} + +// IsVendor returns true if vendor is recognized as Intel +func (c CPUInfo) IsVendor(v Vendor) bool { + return c.VendorID == v +} + +// FeatureSet returns all available features as strings. +func (c CPUInfo) FeatureSet() []string { + s := make([]string, 0, c.featureSet.nEnabled()) + s = append(s, c.featureSet.Strings()...) + return s +} + +// RTCounter returns the 64-bit time-stamp counter +// Uses the RDTSCP instruction. The value 0 is returned +// if the CPU does not support the instruction. +func (c CPUInfo) RTCounter() uint64 { + if !c.Has(RDTSCP) { + return 0 + } + a, _, _, d := rdtscpAsm() + return uint64(a) | (uint64(d) << 32) +} + +// Ia32TscAux returns the IA32_TSC_AUX part of the RDTSCP. +// This variable is OS dependent, but on Linux contains information +// about the current cpu/core the code is running on. +// If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. +func (c CPUInfo) Ia32TscAux() uint32 { + if !c.Has(RDTSCP) { + return 0 + } + _, _, ecx, _ := rdtscpAsm() + return ecx +} + +// SveLengths returns arm SVE vector and predicate lengths in bits. +// Will return 0, 0 if SVE is not enabled or otherwise unable to detect. +func (c CPUInfo) SveLengths() (vl, pl uint64) { + if !c.Has(SVE) { + return 0, 0 + } + return getVectorLength() +} + +// LogicalCPU will return the Logical CPU the code is currently executing on. +// This is likely to change when the OS re-schedules the running thread +// to another CPU. +// If the current core cannot be detected, -1 will be returned. +func (c CPUInfo) LogicalCPU() int { + if c.maxFunc < 1 { + return -1 + } + _, ebx, _, _ := cpuid(1) + return int(ebx >> 24) +} + +// frequencies tries to compute the clock speed of the CPU. If leaf 15 is +// supported, use it, otherwise parse the brand string. Yes, really. +func (c *CPUInfo) frequencies() { + c.Hz, c.BoostFreq = 0, 0 + mfi := maxFunctionID() + if mfi >= 0x15 { + eax, ebx, ecx, _ := cpuid(0x15) + if eax != 0 && ebx != 0 && ecx != 0 { + c.Hz = (int64(ecx) * int64(ebx)) / int64(eax) + } + } + if mfi >= 0x16 { + a, b, _, _ := cpuid(0x16) + // Base... + if a&0xffff > 0 { + c.Hz = int64(a&0xffff) * 1_000_000 + } + // Boost... + if b&0xffff > 0 { + c.BoostFreq = int64(b&0xffff) * 1_000_000 + } + } + if c.Hz > 0 { + return + } + + // computeHz determines the official rated speed of a CPU from its brand + // string. This insanity is *actually the official documented way to do + // this according to Intel*, prior to leaf 0x15 existing. The official + // documentation only shows this working for exactly `x.xx` or `xxxx` + // cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other + // sizes. + model := c.BrandName + hz := strings.LastIndex(model, "Hz") + if hz < 3 { + return + } + var multiplier int64 + switch model[hz-1] { + case 'M': + multiplier = 1000 * 1000 + case 'G': + multiplier = 1000 * 1000 * 1000 + case 'T': + multiplier = 1000 * 1000 * 1000 * 1000 + } + if multiplier == 0 { + return + } + freq := int64(0) + divisor := int64(0) + decimalShift := int64(1) + var i int + for i = hz - 2; i >= 0 && model[i] != ' '; i-- { + if model[i] >= '0' && model[i] <= '9' { + freq += int64(model[i]-'0') * decimalShift + decimalShift *= 10 + } else if model[i] == '.' { + if divisor != 0 { + return + } + divisor = decimalShift + } else { + return + } + } + // we didn't find a space + if i < 0 { + return + } + if divisor != 0 { + c.Hz = (freq * multiplier) / divisor + return + } + c.Hz = freq * multiplier +} + +// VM Will return true if the cpu id indicates we are in +// a virtual machine. +func (c CPUInfo) VM() bool { + return CPU.featureSet.inSet(HYPERVISOR) +} + +// flags contains detected cpu features and characteristics +type flags uint64 + +// log2(bits_in_uint64) +const flagBitsLog2 = 6 +const flagBits = 1 << flagBitsLog2 +const flagMask = flagBits - 1 + +// flagSet contains detected cpu features and characteristics in an array of flags +type flagSet [(lastID + flagMask) / flagBits]flags + +func (s *flagSet) inSet(feat FeatureID) bool { + return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 +} + +func (s *flagSet) set(feat FeatureID) { + s[feat>>flagBitsLog2] |= 1 << (feat & flagMask) +} + +// setIf will set a feature if boolean is true. +func (s *flagSet) setIf(cond bool, features ...FeatureID) { + if cond { + for _, offset := range features { + s[offset>>flagBitsLog2] |= 1 << (offset & flagMask) + } + } +} + +func (s *flagSet) unset(offset FeatureID) { + bit := flags(1 << (offset & flagMask)) + s[offset>>flagBitsLog2] = s[offset>>flagBitsLog2] & ^bit +} + +// or with another flagset. +func (s *flagSet) or(other flagSet) { + for i, v := range other[:] { + s[i] |= v + } +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSet(other flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSetP(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasOneOf returns whether one or more features are present. +func (s *flagSet) hasOneOf(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != 0 { + return true + } + } + return false +} + +// nEnabled will return the number of enabled flags. +func (s *flagSet) nEnabled() (n int) { + for _, v := range s[:] { + n += bits.OnesCount64(uint64(v)) + } + return n +} + +func flagSetWith(feat ...FeatureID) flagSet { + var res flagSet + for _, f := range feat { + res.set(f) + } + return res +} + +// ParseFeature will parse the string and return the ID of the matching feature. +// Will return UNKNOWN if not found. +func ParseFeature(s string) FeatureID { + s = strings.ToUpper(s) + for i := firstID; i < lastID; i++ { + if i.String() == s { + return i + } + } + return UNKNOWN +} + +// Strings returns an array of the detected features for FlagsSet. +func (s flagSet) Strings() []string { + if len(s) == 0 { + return []string{""} + } + r := make([]string, 0) + for i := firstID; i < lastID; i++ { + if s.inSet(i) { + r = append(r, i.String()) + } + } + return r +} + +func maxExtendedFunction() uint32 { + eax, _, _, _ := cpuid(0x80000000) + return eax +} + +func maxFunctionID() uint32 { + a, _, _, _ := cpuid(0) + return a +} + +func brandName() string { + if maxExtendedFunction() >= 0x80000004 { + v := make([]uint32, 0, 48) + for i := uint32(0); i < 3; i++ { + a, b, c, d := cpuid(0x80000002 + i) + v = append(v, a, b, c, d) + } + return strings.Trim(string(valAsString(v...)), " ") + } + return "unknown" +} + +func threadsPerCore() int { + mfi := maxFunctionID() + vend, _ := vendorID() + + if mfi < 0x4 || (vend != Intel && vend != AMD) { + return 1 + } + + if mfi < 0xb { + if vend != Intel { + return 1 + } + _, b, _, d := cpuid(1) + if (d & (1 << 28)) != 0 { + // v will contain logical core count + v := (b >> 16) & 255 + if v > 1 { + a4, _, _, _ := cpuid(4) + // physical cores + v2 := (a4 >> 26) + 1 + if v2 > 0 { + return int(v) / int(v2) + } + } + } + return 1 + } + _, b, _, _ := cpuidex(0xb, 0) + if b&0xffff == 0 { + if vend == AMD { + // if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core. + // The number of threads per core is ThreadsPerCore+1 + // See PPR for AMD Family 17h Models 00h-0Fh (page 82) + fam, _, _ := familyModel() + _, _, _, d := cpuid(1) + if (d&(1<<28)) != 0 && fam >= 23 { + if maxExtendedFunction() >= 0x8000001e { + _, b, _, _ := cpuid(0x8000001e) + return int((b>>8)&0xff) + 1 + } + return 2 + } + } + return 1 + } + return int(b & 0xffff) +} + +func logicalCores() int { + mfi := maxFunctionID() + v, _ := vendorID() + switch v { + case Intel: + // Use this on old Intel processors + if mfi < 0xb { + if mfi < 1 { + return 0 + } + // CPUID.1:EBX[23:16] represents the maximum number of addressable IDs (initial APIC ID) + // that can be assigned to logical processors in a physical package. + // The value may not be the same as the number of logical processors that are present in the hardware of a physical package. + _, ebx, _, _ := cpuid(1) + logical := (ebx >> 16) & 0xff + return int(logical) + } + _, b, _, _ := cpuidex(0xb, 1) + return int(b & 0xffff) + case AMD, Hygon: + _, b, _, _ := cpuid(1) + return int((b >> 16) & 0xff) + default: + return 0 + } +} + +func familyModel() (family, model, stepping int) { + if maxFunctionID() < 0x1 { + return 0, 0, 0 + } + eax, _, _, _ := cpuid(1) + // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0]. + family = int((eax >> 8) & 0xf) + extFam := family == 0x6 // Intel is 0x6, needs extended model. + if family == 0xf { + // Add ExtFamily + family += int((eax >> 20) & 0xff) + extFam = true + } + // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0]. + model = int((eax >> 4) & 0xf) + if extFam { + // Add ExtModel + model += int((eax >> 12) & 0xf0) + } + stepping = int(eax & 0xf) + return family, model, stepping +} + +func physicalCores() int { + v, _ := vendorID() + switch v { + case Intel: + return logicalCores() / threadsPerCore() + case AMD, Hygon: + lc := logicalCores() + tpc := threadsPerCore() + if lc > 0 && tpc > 0 { + return lc / tpc + } + + // The following is inaccurate on AMD EPYC 7742 64-Core Processor + if maxExtendedFunction() >= 0x80000008 { + _, _, c, _ := cpuid(0x80000008) + if c&0xff > 0 { + return int(c&0xff) + 1 + } + } + } + return 0 +} + +// Except from http://en.wikipedia.org/wiki/CPUID#EAX.3D0:_Get_vendor_ID +var vendorMapping = map[string]Vendor{ + "AMDisbetter!": AMD, + "AuthenticAMD": AMD, + "CentaurHauls": VIA, + "GenuineIntel": Intel, + "TransmetaCPU": Transmeta, + "GenuineTMx86": Transmeta, + "Geode by NSC": NSC, + "VIA VIA VIA ": VIA, + "KVMKVMKVM": KVM, + "Linux KVM Hv": KVM, + "TCGTCGTCGTCG": QEMU, + "Microsoft Hv": MSVM, + "VMwareVMware": VMware, + "XenVMMXenVMM": XenHVM, + "bhyve bhyve ": Bhyve, + "HygonGenuine": Hygon, + "Vortex86 SoC": SiS, + "SiS SiS SiS ": SiS, + "RiseRiseRise": SiS, + "Genuine RDC": RDC, + "QNXQVMBSQG": QNX, + "ACRNACRNACRN": ACRN, + "SRESRESRESRE": SRE, + "Apple VZ": Apple, +} + +func vendorID() (Vendor, string) { + _, b, c, d := cpuid(0) + v := string(valAsString(b, d, c)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + +func hypervisorVendorID() (Vendor, string) { + // https://lwn.net/Articles/301888/ + _, b, c, d := cpuid(0x40000000) + v := string(valAsString(b, c, d)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + +func cacheLine() int { + if maxFunctionID() < 0x1 { + return 0 + } + + _, ebx, _, _ := cpuid(1) + cache := (ebx & 0xff00) >> 5 // cflush size + if cache == 0 && maxExtendedFunction() >= 0x80000006 { + _, _, ecx, _ := cpuid(0x80000006) + cache = ecx & 0xff // cacheline size + } + // TODO: Read from Cache and TLB Information + return int(cache) +} + +func (c *CPUInfo) cacheSize() { + c.Cache.L1D = -1 + c.Cache.L1I = -1 + c.Cache.L2 = -1 + c.Cache.L3 = -1 + vendor, _ := vendorID() + switch vendor { + case Intel: + if maxFunctionID() < 4 { + return + } + c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0 + for i := uint32(0); ; i++ { + eax, ebx, ecx, _ := cpuidex(4, i) + cacheType := eax & 15 + if cacheType == 0 { + break + } + cacheLevel := (eax >> 5) & 7 + coherency := int(ebx&0xfff) + 1 + partitions := int((ebx>>12)&0x3ff) + 1 + associativity := int((ebx>>22)&0x3ff) + 1 + sets := int(ecx) + 1 + size := associativity * partitions * coherency * sets + switch cacheLevel { + case 1: + if cacheType == 1 { + // 1 = Data Cache + c.Cache.L1D = size + } else if cacheType == 2 { + // 2 = Instruction Cache + c.Cache.L1I = size + } else { + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + case AMD, Hygon: + // Untested. + if maxExtendedFunction() < 0x80000005 { + return + } + _, _, ecx, edx := cpuid(0x80000005) + c.Cache.L1D = int(((ecx >> 24) & 0xFF) * 1024) + c.Cache.L1I = int(((edx >> 24) & 0xFF) * 1024) + + if maxExtendedFunction() < 0x80000006 { + return + } + _, _, ecx, _ = cpuid(0x80000006) + c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) + + // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties + if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) { + return + } + + // Xen Hypervisor is buggy and returns the same entry no matter ECX value. + // Hack: When we encounter the same entry 100 times we break. + nSame := 0 + var last uint32 + for i := uint32(0); i < math.MaxUint32; i++ { + eax, ebx, ecx, _ := cpuidex(0x8000001D, i) + + level := (eax >> 5) & 7 + cacheNumSets := ecx + 1 + cacheLineSize := 1 + (ebx & 2047) + cachePhysPartitions := 1 + ((ebx >> 12) & 511) + cacheNumWays := 1 + ((ebx >> 22) & 511) + + typ := eax & 15 + size := int(cacheNumSets * cacheLineSize * cachePhysPartitions * cacheNumWays) + if typ == 0 { + return + } + + // Check for the same value repeated. + comb := eax ^ ebx ^ ecx + if comb == last { + nSame++ + if nSame == 100 { + return + } + } + last = comb + + switch level { + case 1: + switch typ { + case 1: + // Data cache + c.Cache.L1D = size + case 2: + // Inst cache + c.Cache.L1I = size + default: + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + } +} + +type SGXEPCSection struct { + BaseAddress uint64 + EPCSize uint64 +} + +type SGXSupport struct { + Available bool + LaunchControl bool + SGX1Supported bool + SGX2Supported bool + MaxEnclaveSizeNot64 int64 + MaxEnclaveSize64 int64 + EPCSections []SGXEPCSection +} + +func hasSGX(available, lc bool) (rval SGXSupport) { + rval.Available = available + + if !available { + return + } + + rval.LaunchControl = lc + + a, _, _, d := cpuidex(0x12, 0) + rval.SGX1Supported = a&0x01 != 0 + rval.SGX2Supported = a&0x02 != 0 + rval.MaxEnclaveSizeNot64 = 1 << (d & 0xFF) // pow 2 + rval.MaxEnclaveSize64 = 1 << ((d >> 8) & 0xFF) // pow 2 + rval.EPCSections = make([]SGXEPCSection, 0) + + for subleaf := uint32(2); subleaf < 2+8; subleaf++ { + eax, ebx, ecx, edx := cpuidex(0x12, subleaf) + leafType := eax & 0xf + + if leafType == 0 { + // Invalid subleaf, stop iterating + break + } else if leafType == 1 { + // EPC Section subleaf + baseAddress := uint64(eax&0xfffff000) + (uint64(ebx&0x000fffff) << 32) + size := uint64(ecx&0xfffff000) + (uint64(edx&0x000fffff) << 32) + + section := SGXEPCSection{BaseAddress: baseAddress, EPCSize: size} + rval.EPCSections = append(rval.EPCSections, section) + } + } + + return +} + +type AMDMemEncryptionSupport struct { + Available bool + CBitPossition uint32 + NumVMPL uint32 + PhysAddrReduction uint32 + NumEntryptedGuests uint32 + MinSevNoEsAsid uint32 +} + +func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) { + rval.Available = available + if !available { + return + } + + _, b, c, d := cpuidex(0x8000001f, 0) + + rval.CBitPossition = b & 0x3f + rval.PhysAddrReduction = (b >> 6) & 0x3F + rval.NumVMPL = (b >> 12) & 0xf + rval.NumEntryptedGuests = c + rval.MinSevNoEsAsid = d + + return +} + +func support() flagSet { + var fs flagSet + mfi := maxFunctionID() + vend, _ := vendorID() + if mfi < 0x1 { + return fs + } + family, model, _ := familyModel() + + _, _, c, d := cpuid(1) + fs.setIf((d&(1<<0)) != 0, X87) + fs.setIf((d&(1<<8)) != 0, CMPXCHG8) + fs.setIf((d&(1<<11)) != 0, SYSEE) + fs.setIf((d&(1<<15)) != 0, CMOV) + fs.setIf((d&(1<<23)) != 0, MMX) + fs.setIf((d&(1<<24)) != 0, FXSR) + fs.setIf((d&(1<<25)) != 0, FXSROPT) + fs.setIf((d&(1<<25)) != 0, SSE) + fs.setIf((d&(1<<26)) != 0, SSE2) + fs.setIf((c&1) != 0, SSE3) + fs.setIf((c&(1<<5)) != 0, VMX) + fs.setIf((c&(1<<9)) != 0, SSSE3) + fs.setIf((c&(1<<19)) != 0, SSE4) + fs.setIf((c&(1<<20)) != 0, SSE42) + fs.setIf((c&(1<<25)) != 0, AESNI) + fs.setIf((c&(1<<1)) != 0, CLMUL) + fs.setIf(c&(1<<22) != 0, MOVBE) + fs.setIf(c&(1<<23) != 0, POPCNT) + fs.setIf(c&(1<<30) != 0, RDRAND) + + // This bit has been reserved by Intel & AMD for use by hypervisors, + // and indicates the presence of a hypervisor. + fs.setIf(c&(1<<31) != 0, HYPERVISOR) + fs.setIf(c&(1<<29) != 0, F16C) + fs.setIf(c&(1<<13) != 0, CX16) + + if vend == Intel && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + fs.setIf(c&1<<26 != 0, XSAVE) + fs.setIf(c&1<<27 != 0, OSXSAVE) + // Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits + const avxCheck = 1<<26 | 1<<27 | 1<<28 + if c&avxCheck == avxCheck { + // Check for OS support + eax, _ := xgetbv(0) + if (eax & 0x6) == 0x6 { + fs.set(AVX) + switch vend { + case Intel: + // Older than Haswell. + fs.setIf(family == 6 && model < 60, AVXSLOW) + case AMD: + // Older than Zen 2 + fs.setIf(family < 23 || (family == 23 && model < 49), AVXSLOW) + } + } + } + // FMA3 can be used with SSE registers, so no OS support is strictly needed. + // fma3 and OSXSAVE needed. + const fma3Check = 1<<12 | 1<<27 + fs.setIf(c&fma3Check == fma3Check, FMA3) + + // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. + if mfi >= 7 { + _, ebx, ecx, edx := cpuidex(7, 0) + if fs.inSet(AVX) && (ebx&0x00000020) != 0 { + fs.set(AVX2) + } + // CPUID.(EAX=7, ECX=0).EBX + if (ebx & 0x00000008) != 0 { + fs.set(BMI1) + fs.setIf((ebx&0x00000100) != 0, BMI2) + } + fs.setIf(ebx&(1<<2) != 0, SGX) + fs.setIf(ebx&(1<<4) != 0, HLE) + fs.setIf(ebx&(1<<9) != 0, ERMS) + fs.setIf(ebx&(1<<11) != 0, RTM) + fs.setIf(ebx&(1<<14) != 0, MPX) + fs.setIf(ebx&(1<<18) != 0, RDSEED) + fs.setIf(ebx&(1<<19) != 0, ADX) + fs.setIf(ebx&(1<<29) != 0, SHA) + + // CPUID.(EAX=7, ECX=0).ECX + fs.setIf(ecx&(1<<5) != 0, WAITPKG) + fs.setIf(ecx&(1<<7) != 0, CETSS) + fs.setIf(ecx&(1<<8) != 0, GFNI) + fs.setIf(ecx&(1<<9) != 0, VAES) + fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) + fs.setIf(ecx&(1<<13) != 0, TME) + fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<23) != 0, KEYLOCKER) + fs.setIf(ecx&(1<<27) != 0, MOVDIRI) + fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) + fs.setIf(ecx&(1<<29) != 0, ENQCMD) + fs.setIf(ecx&(1<<30) != 0, SGXLC) + + // CPUID.(EAX=7, ECX=0).EDX + fs.setIf(edx&(1<<4) != 0, FSRM) + fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL) + fs.setIf(edx&(1<<10) != 0, MD_CLEAR) + fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT) + fs.setIf(edx&(1<<14) != 0, SERIALIZE) + fs.setIf(edx&(1<<15) != 0, HYBRID_CPU) + fs.setIf(edx&(1<<16) != 0, TSXLDTRK) + fs.setIf(edx&(1<<18) != 0, PCONFIG) + fs.setIf(edx&(1<<20) != 0, CETIBT) + fs.setIf(edx&(1<<26) != 0, IBPB) + fs.setIf(edx&(1<<27) != 0, STIBP) + fs.setIf(edx&(1<<28) != 0, FLUSH_L1D) + fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP) + fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) + fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) + + // CPUID.(EAX=7, ECX=1).EAX + eax1, _, _, edx1 := cpuidex(7, 1) + fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) + fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) + fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) + fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) + fs.setIf(eax1&(1<<22) != 0, HRESET) + fs.setIf(eax1&(1<<23) != 0, AVXIFMA) + fs.setIf(eax1&(1<<26) != 0, LAM) + + // CPUID.(EAX=7, ECX=1).EDX + fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) + fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<7) != 0, AMXTF32) + fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX) + fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16) + fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + fs.setIf(edx1&(1<<19) != 0, AVX10) + fs.setIf(edx1&(1<<21) != 0, APX_F) + + // Only detect AVX-512 features if XGETBV is supported + if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { + // Check for OS support + eax, _ := xgetbv(0) + + // Verify that XCR0[7:5] = ‘111b’ (OPMASK state, upper 256-bit of ZMM0-ZMM15 and + // ZMM16-ZMM31 state are enabled by OS) + /// and that XCR0[2:1] = ‘11b’ (XMM state and YMM state are enabled by OS). + hasAVX512 := (eax>>5)&7 == 7 && (eax>>1)&3 == 3 + if runtime.GOOS == "darwin" { + hasAVX512 = fs.inSet(AVX) && darwinHasAVX512() + } + if hasAVX512 { + fs.setIf(ebx&(1<<16) != 0, AVX512F) + fs.setIf(ebx&(1<<17) != 0, AVX512DQ) + fs.setIf(ebx&(1<<21) != 0, AVX512IFMA) + fs.setIf(ebx&(1<<26) != 0, AVX512PF) + fs.setIf(ebx&(1<<27) != 0, AVX512ER) + fs.setIf(ebx&(1<<28) != 0, AVX512CD) + fs.setIf(ebx&(1<<30) != 0, AVX512BW) + fs.setIf(ebx&(1<<31) != 0, AVX512VL) + // ecx + fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<3) != 0, AMXFP8) + fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) + fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) + fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) + fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ) + // edx + fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT) + fs.setIf(edx&(1<<22) != 0, AMXBF16) + fs.setIf(edx&(1<<23) != 0, AVX512FP16) + fs.setIf(edx&(1<<24) != 0, AMXTILE) + fs.setIf(edx&(1<<25) != 0, AMXINT8) + // eax1 = CPUID.(EAX=7, ECX=1).EAX + fs.setIf(eax1&(1<<5) != 0, AVX512BF16) + fs.setIf(eax1&(1<<19) != 0, WRMSRNS) + fs.setIf(eax1&(1<<21) != 0, AMXFP16) + fs.setIf(eax1&(1<<27) != 0, MSRLIST) + } + } + + // CPUID.(EAX=7, ECX=2) + _, _, _, edx = cpuidex(7, 2) + fs.setIf(edx&(1<<0) != 0, PSFD) + fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL) + fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL) + fs.setIf(edx&(1<<4) != 0, BHI_CTRL) + fs.setIf(edx&(1<<5) != 0, MCDT_NO) + + // Add keylocker features. + if fs.inSet(KEYLOCKER) && mfi >= 0x19 { + _, ebx, _, _ := cpuidex(0x19, 0) + fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4) + } + + // Add AVX10 features. + if fs.inSet(AVX10) && mfi >= 0x24 { + _, ebx, _, _ := cpuidex(0x24, 0) + fs.setIf(ebx&(1<<16) != 0, AVX10_128) + fs.setIf(ebx&(1<<17) != 0, AVX10_256) + fs.setIf(ebx&(1<<18) != 0, AVX10_512) + } + } + + // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) + // EAX + // Bit 00: XSAVEOPT is available. + // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set. + // Bit 02: Supports XGETBV with ECX = 1 if set. + // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set. + // Bits 31 - 04: Reserved. + // EBX + // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS. + // ECX + // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1. + // EDX? + // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved. + if mfi >= 0xd { + if fs.inSet(XSAVE) { + eax, _, _, _ := cpuidex(0xd, 1) + fs.setIf(eax&(1<<0) != 0, XSAVEOPT) + fs.setIf(eax&(1<<1) != 0, XSAVEC) + fs.setIf(eax&(1<<2) != 0, XGETBV1) + fs.setIf(eax&(1<<3) != 0, XSAVES) + } + } + if maxExtendedFunction() >= 0x80000001 { + _, _, c, d := cpuid(0x80000001) + if (c & (1 << 5)) != 0 { + fs.set(LZCNT) + fs.set(POPCNT) + } + // ECX + fs.setIf((c&(1<<0)) != 0, LAHF) + fs.setIf((c&(1<<2)) != 0, SVM) + fs.setIf((c&(1<<6)) != 0, SSE4A) + fs.setIf((c&(1<<10)) != 0, IBS) + fs.setIf((c&(1<<22)) != 0, TOPEXT) + + // EDX + fs.setIf(d&(1<<11) != 0, SYSCALL) + fs.setIf(d&(1<<20) != 0, NX) + fs.setIf(d&(1<<22) != 0, MMXEXT) + fs.setIf(d&(1<<23) != 0, MMX) + fs.setIf(d&(1<<24) != 0, FXSR) + fs.setIf(d&(1<<25) != 0, FXSROPT) + fs.setIf(d&(1<<27) != 0, RDTSCP) + fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT) + fs.setIf(d&(1<<31) != 0, AMD3DNOW) + + /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be + * used unless the OS has AVX support. */ + if fs.inSet(AVX) { + fs.setIf((c&(1<<11)) != 0, XOP) + fs.setIf((c&(1<<16)) != 0, FMA4) + } + + } + if maxExtendedFunction() >= 0x80000007 { + _, b, _, d := cpuid(0x80000007) + fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW) + fs.setIf((b&(1<<1)) != 0, SUCCOR) + fs.setIf((b&(1<<2)) != 0, HWA) + fs.setIf((d&(1<<9)) != 0, CPBOOST) + } + + if maxExtendedFunction() >= 0x80000008 { + _, b, _, _ := cpuid(0x80000008) + fs.setIf(b&(1<<28) != 0, PSFD) + fs.setIf(b&(1<<27) != 0, CPPC) + fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD) + fs.setIf(b&(1<<23) != 0, PPIN) + fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED) + fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS) + fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP) + fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED) + fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON) + fs.setIf(b&(1<<15) != 0, STIBP) + fs.setIf(b&(1<<14) != 0, IBRS) + fs.setIf((b&(1<<13)) != 0, INT_WBINVD) + fs.setIf(b&(1<<12) != 0, IBPB) + fs.setIf((b&(1<<9)) != 0, WBNOINVD) + fs.setIf((b&(1<<8)) != 0, MCOMMIT) + fs.setIf((b&(1<<4)) != 0, RDPRU) + fs.setIf((b&(1<<3)) != 0, INVLPGB) + fs.setIf((b&(1<<1)) != 0, MSRIRC) + fs.setIf((b&(1<<0)) != 0, CLZERO) + } + + if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A { + _, _, _, edx := cpuid(0x8000000A) + fs.setIf((edx>>0)&1 == 1, SVMNP) + fs.setIf((edx>>1)&1 == 1, LBRVIRT) + fs.setIf((edx>>2)&1 == 1, SVML) + fs.setIf((edx>>3)&1 == 1, NRIPS) + fs.setIf((edx>>4)&1 == 1, TSCRATEMSR) + fs.setIf((edx>>5)&1 == 1, VMCBCLEAN) + fs.setIf((edx>>6)&1 == 1, SVMFBASID) + fs.setIf((edx>>7)&1 == 1, SVMDA) + fs.setIf((edx>>10)&1 == 1, SVMPF) + fs.setIf((edx>>12)&1 == 1, SVMPFT) + } + + if maxExtendedFunction() >= 0x8000001a { + eax, _, _, _ := cpuid(0x8000001a) + fs.setIf((eax>>0)&1 == 1, FP128) + fs.setIf((eax>>1)&1 == 1, MOVU) + fs.setIf((eax>>2)&1 == 1, FP256) + } + + if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { + eax, _, _, _ := cpuid(0x8000001b) + fs.setIf((eax>>0)&1 == 1, IBSFFV) + fs.setIf((eax>>1)&1 == 1, IBSFETCHSAM) + fs.setIf((eax>>2)&1 == 1, IBSOPSAM) + fs.setIf((eax>>3)&1 == 1, IBSRDWROPCNT) + fs.setIf((eax>>4)&1 == 1, IBSOPCNT) + fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) + fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) + fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) + fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE) + fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX) + fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1. + fs.setIf((eax>>11)&1 == 1, IBS_ZEN4) + } + + if maxExtendedFunction() >= 0x8000001f && vend == AMD { + a, _, _, _ := cpuid(0x8000001f) + fs.setIf((a>>0)&1 == 1, SME) + fs.setIf((a>>1)&1 == 1, SEV) + fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH) + fs.setIf((a>>3)&1 == 1, SEV_ES) + fs.setIf((a>>4)&1 == 1, SEV_SNP) + fs.setIf((a>>5)&1 == 1, VMPL) + fs.setIf((a>>10)&1 == 1, SME_COHERENT) + fs.setIf((a>>11)&1 == 1, SEV_64BIT) + fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED) + fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE) + fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP) + fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST) + fs.setIf((a>>16)&1 == 1, VTE) + fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) + } + + if maxExtendedFunction() >= 0x80000021 && vend == AMD { + a, _, _, _ := cpuid(0x80000021) + fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX) + fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO) + fs.setIf((a>>29)&1 == 1, SRSO_NO) + fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE) + fs.setIf((a>>27)&1 == 1, SBPB) + } + + if mfi >= 0x20 { + // Microsoft has decided to purposefully hide the information + // of the guest TEE when VMs are being created using Hyper-V. + // + // This leads us to check for the Hyper-V cpuid features + // (0x4000000C), and then for the `ebx` value set. + // + // For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part + // we're mostly interested about,according to: + // https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174 + _, ebx, _, _ := cpuid(0x4000000C) + fs.setIf(ebx == 0xbe3, TDX_GUEST) + } + + if mfi >= 0x21 { + // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). + _, ebx, ecx, edx := cpuid(0x21) + identity := string(valAsString(ebx, edx, ecx)) + fs.setIf(identity == "IntelTDX ", TDX_GUEST) + } + + return fs +} + +func (c *CPUInfo) supportAVX10() uint8 { + if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) { + _, ebx, _, _ := cpuidex(0x24, 0) + return uint8(ebx) + } + return 0 +} + +func valAsString(values ...uint32) []byte { + r := make([]byte, 4*len(values)) + for i, v := range values { + dst := r[i*4:] + dst[0] = byte(v & 0xff) + dst[1] = byte((v >> 8) & 0xff) + dst[2] = byte((v >> 16) & 0xff) + dst[3] = byte((v >> 24) & 0xff) + switch { + case dst[0] == 0: + return r[:i*4] + case dst[1] == 0: + return r[:i*4+1] + case dst[2] == 0: + return r[:i*4+2] + case dst[3] == 0: + return r[:i*4+3] + } + } + return r +} diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s new file mode 100644 index 00000000..8587c3a1 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s @@ -0,0 +1,47 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build 386,!gccgo,!noasm,!appengine + +// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuid(SB), 7, $0 + XORL CX, CX + MOVL op+0(FP), AX + CPUID + MOVL AX, eax+4(FP) + MOVL BX, ebx+8(FP) + MOVL CX, ecx+12(FP) + MOVL DX, edx+16(FP) + RET + +// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuidex(SB), 7, $0 + MOVL op+0(FP), AX + MOVL op2+4(FP), CX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func xgetbv(index uint32) (eax, edx uint32) +TEXT ·asmXgetbv(SB), 7, $0 + MOVL index+0(FP), CX + BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV + MOVL AX, eax+4(FP) + MOVL DX, edx+8(FP) + RET + +// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +TEXT ·asmRdtscpAsm(SB), 7, $0 + BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP + MOVL AX, eax+0(FP) + MOVL BX, ebx+4(FP) + MOVL CX, ecx+8(FP) + MOVL DX, edx+12(FP) + RET + +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0 + MOVL $0, eax+0(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s new file mode 100644 index 00000000..bc11f894 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s @@ -0,0 +1,72 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build amd64,!gccgo,!noasm,!appengine + +// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuid(SB), 7, $0 + XORQ CX, CX + MOVL op+0(FP), AX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuidex(SB), 7, $0 + MOVL op+0(FP), AX + MOVL op2+4(FP), CX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func asmXgetbv(index uint32) (eax, edx uint32) +TEXT ·asmXgetbv(SB), 7, $0 + MOVL index+0(FP), CX + BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV + MOVL AX, eax+8(FP) + MOVL DX, edx+12(FP) + RET + +// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +TEXT ·asmRdtscpAsm(SB), 7, $0 + BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP + MOVL AX, eax+0(FP) + MOVL BX, ebx+4(FP) + MOVL CX, ecx+8(FP) + MOVL DX, edx+12(FP) + RET + +// From https://go-review.googlesource.com/c/sys/+/285572/ +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0-1 + MOVB $0, ret+0(FP) // default to false + +#ifdef GOOS_darwin // return if not darwin +#ifdef GOARCH_amd64 // return if not amd64 +// These values from: +// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h +#define commpage64_base_address 0x00007fffffe00000 +#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010) +#define commpage64_version (commpage64_base_address+0x01E) +#define hasAVX512F 0x0000004000000000 + MOVQ $commpage64_version, BX + MOVW (BX), AX + CMPW AX, $13 // versions < 13 do not support AVX512 + JL no_avx512 + MOVQ $commpage64_cpu_capabilities64, BX + MOVQ (BX), AX + MOVQ $hasAVX512F, CX + ANDQ CX, AX + JZ no_avx512 + MOVB $1, ret+0(FP) + +no_avx512: +#endif +#endif + RET + diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s new file mode 100644 index 00000000..b196f78e --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -0,0 +1,36 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build arm64,!gccgo,!noasm,!appengine + +// See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt + +// func getMidr +TEXT ·getMidr(SB), 7, $0 + WORD $0xd5380000 // mrs x0, midr_el1 /* Main ID Register */ + MOVD R0, midr+0(FP) + RET + +// func getProcFeatures +TEXT ·getProcFeatures(SB), 7, $0 + WORD $0xd5380400 // mrs x0, id_aa64pfr0_el1 /* Processor Feature Register 0 */ + MOVD R0, procFeatures+0(FP) + RET + +// func getInstAttributes +TEXT ·getInstAttributes(SB), 7, $0 + WORD $0xd5380600 // mrs x0, id_aa64isar0_el1 /* Instruction Set Attribute Register 0 */ + WORD $0xd5380621 // mrs x1, id_aa64isar1_el1 /* Instruction Set Attribute Register 1 */ + MOVD R0, instAttrReg0+0(FP) + MOVD R1, instAttrReg1+8(FP) + RET + +TEXT ·getVectorLength(SB), 7, $0 + WORD $0xd2800002 // mov x2, #0 + WORD $0x04225022 // addvl x2, x2, #1 + WORD $0xd37df042 // lsl x2, x2, #3 + WORD $0xd2800003 // mov x3, #0 + WORD $0x04635023 // addpl x3, x3, #1 + WORD $0xd37df063 // lsl x3, x3, #3 + MOVD R2, vl+0(FP) + MOVD R3, pl+8(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go new file mode 100644 index 00000000..9ae32d60 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -0,0 +1,250 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build arm64 && !gccgo && !noasm && !appengine +// +build arm64,!gccgo,!noasm,!appengine + +package cpuid + +import "runtime" + +func getMidr() (midr uint64) +func getProcFeatures() (procFeatures uint64) +func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) +func getVectorLength() (vl, pl uint64) + +func initCPU() { + cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + xgetbv = func(uint32) (a, b uint32) { return 0, 0 } + rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } +} + +func addInfo(c *CPUInfo, safe bool) { + // Seems to be safe to assume on ARM64 + c.CacheLine = 64 + detectOS(c) + + // ARM64 disabled since it may crash if interrupt is not intercepted by OS. + if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" { + return + } + midr := getMidr() + + // MIDR_EL1 - Main ID Register + // https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | Implementer | [31-24] | y | + // |--------------------------------------------------| + // | Variant | [23-20] | y | + // |--------------------------------------------------| + // | Architecture | [19-16] | y | + // |--------------------------------------------------| + // | PartNum | [15-4] | y | + // |--------------------------------------------------| + // | Revision | [3-0] | y | + // x--------------------------------------------------x + + switch (midr >> 24) & 0xff { + case 0xC0: + c.VendorString = "Ampere Computing" + c.VendorID = Ampere + case 0x41: + c.VendorString = "Arm Limited" + c.VendorID = ARM + case 0x42: + c.VendorString = "Broadcom Corporation" + c.VendorID = Broadcom + case 0x43: + c.VendorString = "Cavium Inc" + c.VendorID = Cavium + case 0x44: + c.VendorString = "Digital Equipment Corporation" + c.VendorID = DEC + case 0x46: + c.VendorString = "Fujitsu Ltd" + c.VendorID = Fujitsu + case 0x49: + c.VendorString = "Infineon Technologies AG" + c.VendorID = Infineon + case 0x4D: + c.VendorString = "Motorola or Freescale Semiconductor Inc" + c.VendorID = Motorola + case 0x4E: + c.VendorString = "NVIDIA Corporation" + c.VendorID = NVIDIA + case 0x50: + c.VendorString = "Applied Micro Circuits Corporation" + c.VendorID = AMCC + case 0x51: + c.VendorString = "Qualcomm Inc" + c.VendorID = Qualcomm + case 0x56: + c.VendorString = "Marvell International Ltd" + c.VendorID = Marvell + case 0x69: + c.VendorString = "Intel Corporation" + c.VendorID = Intel + } + + // Lower 4 bits: Architecture + // Architecture Meaning + // 0b0001 Armv4. + // 0b0010 Armv4T. + // 0b0011 Armv5 (obsolete). + // 0b0100 Armv5T. + // 0b0101 Armv5TE. + // 0b0110 Armv5TEJ. + // 0b0111 Armv6. + // 0b1111 Architectural features are individually identified in the ID_* registers, see 'ID registers'. + // Upper 4 bit: Variant + // An IMPLEMENTATION DEFINED variant number. + // Typically, this field is used to distinguish between different product variants, or major revisions of a product. + c.Family = int(midr>>16) & 0xff + + // PartNum, bits [15:4] + // An IMPLEMENTATION DEFINED primary part number for the device. + // On processors implemented by Arm, if the top four bits of the primary + // part number are 0x0 or 0x7, the variant and architecture are encoded differently. + // Revision, bits [3:0] + // An IMPLEMENTATION DEFINED revision number for the device. + c.Model = int(midr) & 0xffff + + procFeatures := getProcFeatures() + + // ID_AA64PFR0_EL1 - Processor Feature Register 0 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | DIT | [51-48] | y | + // |--------------------------------------------------| + // | SVE | [35-32] | y | + // |--------------------------------------------------| + // | GIC | [27-24] | n | + // |--------------------------------------------------| + // | AdvSIMD | [23-20] | y | + // |--------------------------------------------------| + // | FP | [19-16] | y | + // |--------------------------------------------------| + // | EL3 | [15-12] | n | + // |--------------------------------------------------| + // | EL2 | [11-8] | n | + // |--------------------------------------------------| + // | EL1 | [7-4] | n | + // |--------------------------------------------------| + // | EL0 | [3-0] | n | + // x--------------------------------------------------x + + var f flagSet + // if procFeatures&(0xf<<48) != 0 { + // fmt.Println("DIT") + // } + f.setIf(procFeatures&(0xf<<32) != 0, SVE) + if procFeatures&(0xf<<20) != 15<<20 { + f.set(ASIMD) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1 + // 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic. + f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP) + } + f.setIf(procFeatures&(0xf<<16) != 0, FP) + + instAttrReg0, instAttrReg1 := getInstAttributes() + + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // + // ID_AA64ISAR0_EL1 - Instruction Set Attribute Register 0 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | RNDR | [63-60] | y | + // |--------------------------------------------------| + // | TLB | [59-56] | y | + // |--------------------------------------------------| + // | TS | [55-52] | y | + // |--------------------------------------------------| + // | FHM | [51-48] | y | + // |--------------------------------------------------| + // | DP | [47-44] | y | + // |--------------------------------------------------| + // | SM4 | [43-40] | y | + // |--------------------------------------------------| + // | SM3 | [39-36] | y | + // |--------------------------------------------------| + // | SHA3 | [35-32] | y | + // |--------------------------------------------------| + // | RDM | [31-28] | y | + // |--------------------------------------------------| + // | ATOMICS | [23-20] | y | + // |--------------------------------------------------| + // | CRC32 | [19-16] | y | + // |--------------------------------------------------| + // | SHA2 | [15-12] | y | + // |--------------------------------------------------| + // | SHA1 | [11-8] | y | + // |--------------------------------------------------| + // | AES | [7-4] | y | + // x--------------------------------------------------x + + f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR) + f.setIf(instAttrReg0&(0xf<<56) != 0, TLB) + f.setIf(instAttrReg0&(0xf<<52) != 0, TS) + f.setIf(instAttrReg0&(0xf<<48) != 0, FHM) + f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP) + f.setIf(instAttrReg0&(0xf<<40) != 0, SM4) + f.setIf(instAttrReg0&(0xf<<36) != 0, SM3) + f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3) + f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM) + f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS) + f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32) + f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented. + f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512) + f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1) + f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities. + f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL) + + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1 + // + // ID_AA64ISAR1_EL1 - Instruction set attribute register 1 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | GPI | [31-28] | y | + // |--------------------------------------------------| + // | GPA | [27-24] | y | + // |--------------------------------------------------| + // | LRCPC | [23-20] | y | + // |--------------------------------------------------| + // | FCMA | [19-16] | y | + // |--------------------------------------------------| + // | JSCVT | [15-12] | y | + // |--------------------------------------------------| + // | API | [11-8] | y | + // |--------------------------------------------------| + // | APA | [7-4] | y | + // |--------------------------------------------------| + // | DPB | [3-0] | y | + // x--------------------------------------------------x + + // if instAttrReg1&(0xf<<28) != 0 { + // fmt.Println("GPI") + // } + f.setIf(instAttrReg1&(0xf<<28) != 24, GPA) + f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC) + f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA) + f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT) + // if instAttrReg1&(0xf<<8) != 0 { + // fmt.Println("API") + // } + // if instAttrReg1&(0xf<<4) != 0 { + // fmt.Println("APA") + // } + f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP) + + // Store + c.featureSet.or(f) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go new file mode 100644 index 00000000..574f9389 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -0,0 +1,17 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine +// +build !amd64,!386,!arm64 gccgo noasm appengine + +package cpuid + +func initCPU() { + cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + xgetbv = func(uint32) (a, b uint32) { return 0, 0 } + rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } + +} + +func addInfo(info *CPUInfo, safe bool) {} +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go new file mode 100644 index 00000000..f924c9d8 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -0,0 +1,41 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine) +// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine + +package cpuid + +func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +func asmXgetbv(index uint32) (eax, edx uint32) +func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +func asmDarwinHasAVX512() bool + +func initCPU() { + cpuid = asmCpuid + cpuidex = asmCpuidex + xgetbv = asmXgetbv + rdtscpAsm = asmRdtscpAsm + darwinHasAVX512 = asmDarwinHasAVX512 +} + +func addInfo(c *CPUInfo, safe bool) { + c.maxFunc = maxFunctionID() + c.maxExFunc = maxExtendedFunction() + c.BrandName = brandName() + c.CacheLine = cacheLine() + c.Family, c.Model, c.Stepping = familyModel() + c.featureSet = support() + c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) + c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV)) + c.ThreadsPerCore = threadsPerCore() + c.LogicalCores = logicalCores() + c.PhysicalCores = physicalCores() + c.VendorID, c.VendorString = vendorID() + c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID() + c.AVX10Level = c.supportAVX10() + c.cacheSize() + c.frequencies() +} + +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go new file mode 100644 index 00000000..04760c1a --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -0,0 +1,297 @@ +// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT. + +package cpuid + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[ADX-1] + _ = x[AESNI-2] + _ = x[AMD3DNOW-3] + _ = x[AMD3DNOWEXT-4] + _ = x[AMXBF16-5] + _ = x[AMXFP16-6] + _ = x[AMXINT8-7] + _ = x[AMXFP8-8] + _ = x[AMXTILE-9] + _ = x[AMXTF32-10] + _ = x[AMXCOMPLEX-11] + _ = x[APX_F-12] + _ = x[AVX-13] + _ = x[AVX10-14] + _ = x[AVX10_128-15] + _ = x[AVX10_256-16] + _ = x[AVX10_512-17] + _ = x[AVX2-18] + _ = x[AVX512BF16-19] + _ = x[AVX512BITALG-20] + _ = x[AVX512BW-21] + _ = x[AVX512CD-22] + _ = x[AVX512DQ-23] + _ = x[AVX512ER-24] + _ = x[AVX512F-25] + _ = x[AVX512FP16-26] + _ = x[AVX512IFMA-27] + _ = x[AVX512PF-28] + _ = x[AVX512VBMI-29] + _ = x[AVX512VBMI2-30] + _ = x[AVX512VL-31] + _ = x[AVX512VNNI-32] + _ = x[AVX512VP2INTERSECT-33] + _ = x[AVX512VPOPCNTDQ-34] + _ = x[AVXIFMA-35] + _ = x[AVXNECONVERT-36] + _ = x[AVXSLOW-37] + _ = x[AVXVNNI-38] + _ = x[AVXVNNIINT8-39] + _ = x[AVXVNNIINT16-40] + _ = x[BHI_CTRL-41] + _ = x[BMI1-42] + _ = x[BMI2-43] + _ = x[CETIBT-44] + _ = x[CETSS-45] + _ = x[CLDEMOTE-46] + _ = x[CLMUL-47] + _ = x[CLZERO-48] + _ = x[CMOV-49] + _ = x[CMPCCXADD-50] + _ = x[CMPSB_SCADBS_SHORT-51] + _ = x[CMPXCHG8-52] + _ = x[CPBOOST-53] + _ = x[CPPC-54] + _ = x[CX16-55] + _ = x[EFER_LMSLE_UNS-56] + _ = x[ENQCMD-57] + _ = x[ERMS-58] + _ = x[F16C-59] + _ = x[FLUSH_L1D-60] + _ = x[FMA3-61] + _ = x[FMA4-62] + _ = x[FP128-63] + _ = x[FP256-64] + _ = x[FSRM-65] + _ = x[FXSR-66] + _ = x[FXSROPT-67] + _ = x[GFNI-68] + _ = x[HLE-69] + _ = x[HRESET-70] + _ = x[HTT-71] + _ = x[HWA-72] + _ = x[HYBRID_CPU-73] + _ = x[HYPERVISOR-74] + _ = x[IA32_ARCH_CAP-75] + _ = x[IA32_CORE_CAP-76] + _ = x[IBPB-77] + _ = x[IBPB_BRTYPE-78] + _ = x[IBRS-79] + _ = x[IBRS_PREFERRED-80] + _ = x[IBRS_PROVIDES_SMP-81] + _ = x[IBS-82] + _ = x[IBSBRNTRGT-83] + _ = x[IBSFETCHSAM-84] + _ = x[IBSFFV-85] + _ = x[IBSOPCNT-86] + _ = x[IBSOPCNTEXT-87] + _ = x[IBSOPSAM-88] + _ = x[IBSRDWROPCNT-89] + _ = x[IBSRIPINVALIDCHK-90] + _ = x[IBS_FETCH_CTLX-91] + _ = x[IBS_OPDATA4-92] + _ = x[IBS_OPFUSE-93] + _ = x[IBS_PREVENTHOST-94] + _ = x[IBS_ZEN4-95] + _ = x[IDPRED_CTRL-96] + _ = x[INT_WBINVD-97] + _ = x[INVLPGB-98] + _ = x[KEYLOCKER-99] + _ = x[KEYLOCKERW-100] + _ = x[LAHF-101] + _ = x[LAM-102] + _ = x[LBRVIRT-103] + _ = x[LZCNT-104] + _ = x[MCAOVERFLOW-105] + _ = x[MCDT_NO-106] + _ = x[MCOMMIT-107] + _ = x[MD_CLEAR-108] + _ = x[MMX-109] + _ = x[MMXEXT-110] + _ = x[MOVBE-111] + _ = x[MOVDIR64B-112] + _ = x[MOVDIRI-113] + _ = x[MOVSB_ZL-114] + _ = x[MOVU-115] + _ = x[MPX-116] + _ = x[MSRIRC-117] + _ = x[MSRLIST-118] + _ = x[MSR_PAGEFLUSH-119] + _ = x[NRIPS-120] + _ = x[NX-121] + _ = x[OSXSAVE-122] + _ = x[PCONFIG-123] + _ = x[POPCNT-124] + _ = x[PPIN-125] + _ = x[PREFETCHI-126] + _ = x[PSFD-127] + _ = x[RDPRU-128] + _ = x[RDRAND-129] + _ = x[RDSEED-130] + _ = x[RDTSCP-131] + _ = x[RRSBA_CTRL-132] + _ = x[RTM-133] + _ = x[RTM_ALWAYS_ABORT-134] + _ = x[SBPB-135] + _ = x[SERIALIZE-136] + _ = x[SEV-137] + _ = x[SEV_64BIT-138] + _ = x[SEV_ALTERNATIVE-139] + _ = x[SEV_DEBUGSWAP-140] + _ = x[SEV_ES-141] + _ = x[SEV_RESTRICTED-142] + _ = x[SEV_SNP-143] + _ = x[SGX-144] + _ = x[SGXLC-145] + _ = x[SHA-146] + _ = x[SME-147] + _ = x[SME_COHERENT-148] + _ = x[SPEC_CTRL_SSBD-149] + _ = x[SRBDS_CTRL-150] + _ = x[SRSO_MSR_FIX-151] + _ = x[SRSO_NO-152] + _ = x[SRSO_USER_KERNEL_NO-153] + _ = x[SSE-154] + _ = x[SSE2-155] + _ = x[SSE3-156] + _ = x[SSE4-157] + _ = x[SSE42-158] + _ = x[SSE4A-159] + _ = x[SSSE3-160] + _ = x[STIBP-161] + _ = x[STIBP_ALWAYSON-162] + _ = x[STOSB_SHORT-163] + _ = x[SUCCOR-164] + _ = x[SVM-165] + _ = x[SVMDA-166] + _ = x[SVMFBASID-167] + _ = x[SVML-168] + _ = x[SVMNP-169] + _ = x[SVMPF-170] + _ = x[SVMPFT-171] + _ = x[SYSCALL-172] + _ = x[SYSEE-173] + _ = x[TBM-174] + _ = x[TDX_GUEST-175] + _ = x[TLB_FLUSH_NESTED-176] + _ = x[TME-177] + _ = x[TOPEXT-178] + _ = x[TSCRATEMSR-179] + _ = x[TSXLDTRK-180] + _ = x[VAES-181] + _ = x[VMCBCLEAN-182] + _ = x[VMPL-183] + _ = x[VMSA_REGPROT-184] + _ = x[VMX-185] + _ = x[VPCLMULQDQ-186] + _ = x[VTE-187] + _ = x[WAITPKG-188] + _ = x[WBNOINVD-189] + _ = x[WRMSRNS-190] + _ = x[X87-191] + _ = x[XGETBV1-192] + _ = x[XOP-193] + _ = x[XSAVE-194] + _ = x[XSAVEC-195] + _ = x[XSAVEOPT-196] + _ = x[XSAVES-197] + _ = x[AESARM-198] + _ = x[ARMCPUID-199] + _ = x[ASIMD-200] + _ = x[ASIMDDP-201] + _ = x[ASIMDHP-202] + _ = x[ASIMDRDM-203] + _ = x[ATOMICS-204] + _ = x[CRC32-205] + _ = x[DCPOP-206] + _ = x[EVTSTRM-207] + _ = x[FCMA-208] + _ = x[FHM-209] + _ = x[FP-210] + _ = x[FPHP-211] + _ = x[GPA-212] + _ = x[JSCVT-213] + _ = x[LRCPC-214] + _ = x[PMULL-215] + _ = x[RNDR-216] + _ = x[TLB-217] + _ = x[TS-218] + _ = x[SHA1-219] + _ = x[SHA2-220] + _ = x[SHA3-221] + _ = x[SHA512-222] + _ = x[SM3-223] + _ = x[SM4-224] + _ = x[SVE-225] + _ = x[lastID-226] + _ = x[firstID-0] +} + +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID" + +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621} + +func (i FeatureID) String() string { + if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { + return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]] +} +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[VendorUnknown-0] + _ = x[Intel-1] + _ = x[AMD-2] + _ = x[VIA-3] + _ = x[Transmeta-4] + _ = x[NSC-5] + _ = x[KVM-6] + _ = x[MSVM-7] + _ = x[VMware-8] + _ = x[XenHVM-9] + _ = x[Bhyve-10] + _ = x[Hygon-11] + _ = x[SiS-12] + _ = x[RDC-13] + _ = x[Ampere-14] + _ = x[ARM-15] + _ = x[Broadcom-16] + _ = x[Cavium-17] + _ = x[DEC-18] + _ = x[Fujitsu-19] + _ = x[Infineon-20] + _ = x[Motorola-21] + _ = x[NVIDIA-22] + _ = x[AMCC-23] + _ = x[Qualcomm-24] + _ = x[Marvell-25] + _ = x[QEMU-26] + _ = x[QNX-27] + _ = x[ACRN-28] + _ = x[SRE-29] + _ = x[Apple-30] + _ = x[lastVendor-31] +} + +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor" + +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174} + +func (i Vendor) String() string { + if i < 0 || i >= Vendor(len(_Vendor_index)-1) { + return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]] +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go new file mode 100644 index 00000000..6f0b33ca --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -0,0 +1,127 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +package cpuid + +import ( + "runtime" + "strings" + + "golang.org/x/sys/unix" +) + +func detectOS(c *CPUInfo) bool { + if runtime.GOOS != "ios" { + tryToFillCPUInfoFomSysctl(c) + } + // There are no hw.optional sysctl values for the below features on Mac OS 11.0 + // to detect their supported state dynamically. Assume the CPU features that + // Apple Silicon M1 supports to be available as a minimal set of features + // to all Go programs running on darwin/arm64. + // TODO: Add more if we know them. + c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2) + + return true +} + +func sysctlGetBool(name string) bool { + value, err := unix.SysctlUint32(name) + if err != nil { + return false + } + return value != 0 +} + +func sysctlGetString(name string) string { + value, err := unix.Sysctl(name) + if err != nil { + return "" + } + return value +} + +func sysctlGetInt(unknown int, names ...string) int { + for _, name := range names { + value, err := unix.SysctlUint32(name) + if err != nil { + continue + } + if value != 0 { + return int(value) + } + } + return unknown +} + +func sysctlGetInt64(unknown int, names ...string) int { + for _, name := range names { + value64, err := unix.SysctlUint64(name) + if err != nil { + continue + } + if int(value64) != unknown { + return int(value64) + } + } + return unknown +} + +func setFeature(c *CPUInfo, name string, feature FeatureID) { + c.featureSet.setIf(sysctlGetBool(name), feature) +} +func tryToFillCPUInfoFomSysctl(c *CPUInfo) { + c.BrandName = sysctlGetString("machdep.cpu.brand_string") + + if len(c.BrandName) != 0 { + c.VendorString = strings.Fields(c.BrandName)[0] + } + + c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu") + c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") / + sysctlGetInt(1, "hw.physicalcpu") + c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count") + c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily") + c.Model = sysctlGetInt(0, "machdep.cpu.model") + c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") + c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize") + c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") + c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") + + // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile + setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) + setFeature(c, "hw.optional.AdvSIMD", ASIMD) + setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) + setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) + setFeature(c, "hw.optional.FEAT_CRC32", CRC32) + setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) + // setFeature(c, "", EVTSTRM) + setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FHM", FHM) + setFeature(c, "hw.optional.arm.FEAT_FP", FP) + setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) + setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_RNG", RNDR) + setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) + setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) + setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) + setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) + setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) + setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) + setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + setFeature(c, "hw.optional.arm.FEAT_TLBIOS", TLB) + setFeature(c, "hw.optional.arm.FEAT_TLBIRANGE", TLB) + setFeature(c, "hw.optional.arm.FEAT_FlagM", TS) + setFeature(c, "hw.optional.arm.FEAT_FlagM2", TS) + // setFeature(c, "", SM3) + // setFeature(c, "", SM4) + setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) + + // from empirical observation + setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) + setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) + setFeature(c, "hw.optional.floatingpoint", FP) + setFeature(c, "hw.optional.armv8_2_sha3", SHA3) + setFeature(c, "hw.optional.armv8_2_sha512", SHA512) + setFeature(c, "hw.optional.armv8_3_compnum", FCMA) + setFeature(c, "hw.optional.armv8_crc32", CRC32) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go new file mode 100644 index 00000000..d96d2443 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go @@ -0,0 +1,208 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file located +// here https://github.com/golang/sys/blob/master/LICENSE + +package cpuid + +import ( + "encoding/binary" + "io/ioutil" + "runtime" +) + +// HWCAP bits. +const ( + hwcap_FP = 1 << 0 + hwcap_ASIMD = 1 << 1 + hwcap_EVTSTRM = 1 << 2 + hwcap_AES = 1 << 3 + hwcap_PMULL = 1 << 4 + hwcap_SHA1 = 1 << 5 + hwcap_SHA2 = 1 << 6 + hwcap_CRC32 = 1 << 7 + hwcap_ATOMICS = 1 << 8 + hwcap_FPHP = 1 << 9 + hwcap_ASIMDHP = 1 << 10 + hwcap_CPUID = 1 << 11 + hwcap_ASIMDRDM = 1 << 12 + hwcap_JSCVT = 1 << 13 + hwcap_FCMA = 1 << 14 + hwcap_LRCPC = 1 << 15 + hwcap_DCPOP = 1 << 16 + hwcap_SHA3 = 1 << 17 + hwcap_SM3 = 1 << 18 + hwcap_SM4 = 1 << 19 + hwcap_ASIMDDP = 1 << 20 + hwcap_SHA512 = 1 << 21 + hwcap_SVE = 1 << 22 + hwcap_ASIMDFHM = 1 << 23 + hwcap_DIT = 1 << 24 + hwcap_USCAT = 1 << 25 + hwcap_ILRCPC = 1 << 26 + hwcap_FLAGM = 1 << 27 + hwcap_SSBS = 1 << 28 + hwcap_SB = 1 << 29 + hwcap_PACA = 1 << 30 + hwcap_PACG = 1 << 31 + hwcap_GCS = 1 << 32 + + hwcap2_DCPODP = 1 << 0 + hwcap2_SVE2 = 1 << 1 + hwcap2_SVEAES = 1 << 2 + hwcap2_SVEPMULL = 1 << 3 + hwcap2_SVEBITPERM = 1 << 4 + hwcap2_SVESHA3 = 1 << 5 + hwcap2_SVESM4 = 1 << 6 + hwcap2_FLAGM2 = 1 << 7 + hwcap2_FRINT = 1 << 8 + hwcap2_SVEI8MM = 1 << 9 + hwcap2_SVEF32MM = 1 << 10 + hwcap2_SVEF64MM = 1 << 11 + hwcap2_SVEBF16 = 1 << 12 + hwcap2_I8MM = 1 << 13 + hwcap2_BF16 = 1 << 14 + hwcap2_DGH = 1 << 15 + hwcap2_RNG = 1 << 16 + hwcap2_BTI = 1 << 17 + hwcap2_MTE = 1 << 18 + hwcap2_ECV = 1 << 19 + hwcap2_AFP = 1 << 20 + hwcap2_RPRES = 1 << 21 + hwcap2_MTE3 = 1 << 22 + hwcap2_SME = 1 << 23 + hwcap2_SME_I16I64 = 1 << 24 + hwcap2_SME_F64F64 = 1 << 25 + hwcap2_SME_I8I32 = 1 << 26 + hwcap2_SME_F16F32 = 1 << 27 + hwcap2_SME_B16F32 = 1 << 28 + hwcap2_SME_F32F32 = 1 << 29 + hwcap2_SME_FA64 = 1 << 30 + hwcap2_WFXT = 1 << 31 + hwcap2_EBF16 = 1 << 32 + hwcap2_SVE_EBF16 = 1 << 33 + hwcap2_CSSC = 1 << 34 + hwcap2_RPRFM = 1 << 35 + hwcap2_SVE2P1 = 1 << 36 + hwcap2_SME2 = 1 << 37 + hwcap2_SME2P1 = 1 << 38 + hwcap2_SME_I16I32 = 1 << 39 + hwcap2_SME_BI32I32 = 1 << 40 + hwcap2_SME_B16B16 = 1 << 41 + hwcap2_SME_F16F16 = 1 << 42 + hwcap2_MOPS = 1 << 43 + hwcap2_HBC = 1 << 44 + hwcap2_SVE_B16B16 = 1 << 45 + hwcap2_LRCPC3 = 1 << 46 + hwcap2_LSE128 = 1 << 47 + hwcap2_FPMR = 1 << 48 + hwcap2_LUT = 1 << 49 + hwcap2_FAMINMAX = 1 << 50 + hwcap2_F8CVT = 1 << 51 + hwcap2_F8FMA = 1 << 52 + hwcap2_F8DP4 = 1 << 53 + hwcap2_F8DP2 = 1 << 54 + hwcap2_F8E4M3 = 1 << 55 + hwcap2_F8E5M2 = 1 << 56 + hwcap2_SME_LUTV2 = 1 << 57 + hwcap2_SME_F8F16 = 1 << 58 + hwcap2_SME_F8F32 = 1 << 59 + hwcap2_SME_SF8FMA = 1 << 60 + hwcap2_SME_SF8DP4 = 1 << 61 + hwcap2_SME_SF8DP2 = 1 << 62 + hwcap2_POE = 1 << 63 +) + +func detectOS(c *CPUInfo) bool { + // For now assuming no hyperthreading is reasonable. + c.LogicalCores = runtime.NumCPU() + c.PhysicalCores = c.LogicalCores + c.ThreadsPerCore = 1 + if hwcap == 0 { + // We did not get values from the runtime. + // Try reading /proc/self/auxv + + // From https://github.com/golang/sys + const ( + _AT_HWCAP = 16 + _AT_HWCAP2 = 26 + + uintSize = int(32 << (^uint(0) >> 63)) + ) + + buf, err := ioutil.ReadFile("/proc/self/auxv") + if err != nil { + // e.g. on android /proc/self/auxv is not accessible, so silently + // ignore the error and leave Initialized = false. On some + // architectures (e.g. arm64) doinit() implements a fallback + // readout and will set Initialized = true again. + return false + } + bo := binary.LittleEndian + for len(buf) >= 2*(uintSize/8) { + var tag, val uint + switch uintSize { + case 32: + tag = uint(bo.Uint32(buf[0:])) + val = uint(bo.Uint32(buf[4:])) + buf = buf[8:] + case 64: + tag = uint(bo.Uint64(buf[0:])) + val = uint(bo.Uint64(buf[8:])) + buf = buf[16:] + } + switch tag { + case _AT_HWCAP: + hwcap = val + case _AT_HWCAP2: + // Not used + } + } + if hwcap == 0 { + return false + } + } + + // HWCap was populated by the runtime from the auxiliary vector. + // Use HWCap information since reading aarch64 system registers + // is not supported in user space on older linux kernels. + c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM) + c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID) + c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32) + c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP) + c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM) + c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDFHM), FHM) + c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP) + c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP) + c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT) + c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC) + c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL) + c.featureSet.setIf(isSet(hwcap, hwcap2_RNG), RNDR) + // c.featureSet.setIf(isSet(hwcap, hwcap_), TLB) + // c.featureSet.setIf(isSet(hwcap, hwcap_), TS) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512) + c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3) + c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4) + c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE) + + // The Samsung S9+ kernel reports support for atomics, but not all cores + // actually support them, resulting in SIGILL. See issue #28431. + // TODO(elias.naur): Only disable the optimization on bad chipsets on android. + c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS) + + return true +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go new file mode 100644 index 00000000..8733ba34 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go @@ -0,0 +1,16 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +//go:build arm64 && !linux && !darwin +// +build arm64,!linux,!darwin + +package cpuid + +import "runtime" + +func detectOS(c *CPUInfo) bool { + c.PhysicalCores = runtime.NumCPU() + // For now assuming 1 thread per core... + c.ThreadsPerCore = 1 + c.LogicalCores = c.PhysicalCores + return false +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go new file mode 100644 index 00000000..f8f201b5 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go @@ -0,0 +1,8 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build nounsafe +// +build nounsafe + +package cpuid + +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go new file mode 100644 index 00000000..92af622e --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go @@ -0,0 +1,11 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build !nounsafe +// +build !nounsafe + +package cpuid + +import _ "unsafe" // needed for go:linkname + +//go:linkname hwcap internal/cpu.HWCap +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh new file mode 100644 index 00000000..471d986d --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh @@ -0,0 +1,15 @@ +#!/bin/sh + +set -e + +go tool dist list | while IFS=/ read os arch; do + echo "Checking $os/$arch..." + echo " normal" + GOARCH=$arch GOOS=$os go build -o /dev/null . + echo " noasm" + GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null . + echo " appengine" + GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null . + echo " noasm,appengine" + GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null . +done diff --git a/vendor/github.com/leodido/go-urn/.gitignore b/vendor/github.com/leodido/go-urn/.gitignore index 5bcf4bad..427454f8 100644 --- a/vendor/github.com/leodido/go-urn/.gitignore +++ b/vendor/github.com/leodido/go-urn/.gitignore @@ -8,4 +8,6 @@ *.out *.txt -vendor/ \ No newline at end of file +vendor/ +/removecomments +/snake2camel \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/.travis.yml b/vendor/github.com/leodido/go-urn/.travis.yml deleted file mode 100644 index 21f348d6..00000000 --- a/vendor/github.com/leodido/go-urn/.travis.yml +++ /dev/null @@ -1,16 +0,0 @@ -language: go - -go: - - 1.13.x - - 1.14.x - - 1.15.x - - tip - -before_install: - - go get -t -v ./... - -script: - - go test -race -coverprofile=coverage.txt -covermode=atomic - -after_success: - - bash <(curl -s https://codecov.io/bash) \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/README.md b/vendor/github.com/leodido/go-urn/README.md index cc902ec0..619475bf 100644 --- a/vendor/github.com/leodido/go-urn/README.md +++ b/vendor/github.com/leodido/go-urn/README.md @@ -1,22 +1,35 @@ -[![Build](https://img.shields.io/travis/leodido/go-urn/master.svg?style=for-the-badge)](https://travis-ci.org/leodido/go-urn) [![Coverage](https://img.shields.io/codecov/c/github/leodido/go-urn.svg?style=for-the-badge)](https://codecov.io/gh/leodido/go-urn) [![Documentation](https://img.shields.io/badge/godoc-reference-blue.svg?style=for-the-badge)](https://godoc.org/github.com/leodido/go-urn) +[![Build](https://img.shields.io/circleci/build/github/leodido/go-urn?style=for-the-badge)](https://app.circleci.com/pipelines/github/leodido/go-urn) [![Coverage](https://img.shields.io/codecov/c/github/leodido/go-urn.svg?style=for-the-badge)](https://codecov.io/gh/leodido/go-urn) [![Documentation](https://img.shields.io/badge/godoc-reference-blue.svg?style=for-the-badge)](https://godoc.org/github.com/leodido/go-urn) **A parser for URNs**. -> As seen on [RFC 2141](https://tools.ietf.org/html/rfc2141#ref-1). +> As seen on [RFC 2141](https://datatracker.ietf.org/doc/html/rfc2141), [RFC 7643](https://datatracker.ietf.org/doc/html/rfc7643#section-10), and on [RFC 8141](https://datatracker.ietf.org/doc/html/rfc8141). [API documentation](https://godoc.org/github.com/leodido/go-urn). +Starting with version 1.3 this library also supports [RFC 7643 SCIM URNs](https://datatracker.ietf.org/doc/html/rfc7643#section-10). + +Starting with version 1.4 this library also supports [RFC 8141 URNs (2017)](https://datatracker.ietf.org/doc/html/rfc8141). + ## Installation ``` go get github.com/leodido/go-urn ``` +## Features + +1. RFC 2141 URNs parsing (default) +2. RFC 8141 URNs parsing (supersedes RFC 2141) +3. RFC 7643 SCIM URNs parsing +4. Normalization as per RFCs +5. Lexical equivalence as per RFCs +6. Precise, fine-grained errors + ## Performances This implementation results to be really fast. -Usually below ½ microsecond on my machine[1](#mymachine). +Usually below 400 ns on my machine[1](#mymachine). Notice it also performs, while parsing: @@ -24,32 +37,117 @@ Notice it also performs, while parsing: 2. specific-string normalization ``` -ok/00/urn:a:b______________________________________/-4 20000000 265 ns/op 182 B/op 6 allocs/op -ok/01/URN:foo:a123,456_____________________________/-4 30000000 296 ns/op 200 B/op 6 allocs/op -ok/02/urn:foo:a123%2c456___________________________/-4 20000000 331 ns/op 208 B/op 6 allocs/op -ok/03/urn:ietf:params:scim:schemas:core:2.0:User___/-4 20000000 430 ns/op 280 B/op 6 allocs/op -ok/04/urn:ietf:params:scim:schemas:extension:enterp/-4 20000000 411 ns/op 312 B/op 6 allocs/op -ok/05/urn:ietf:params:scim:schemas:extension:enterp/-4 20000000 472 ns/op 344 B/op 6 allocs/op -ok/06/urn:burnout:nss______________________________/-4 30000000 257 ns/op 192 B/op 6 allocs/op -ok/07/urn:abcdefghilmnopqrstuvzabcdefghilm:x_______/-4 20000000 375 ns/op 213 B/op 6 allocs/op -ok/08/urn:urnurnurn:urn____________________________/-4 30000000 265 ns/op 197 B/op 6 allocs/op -ok/09/urn:ciao:@!=%2c(xyz)+a,b.*@g=$_'_____________/-4 20000000 307 ns/op 248 B/op 6 allocs/op -ok/10/URN:x:abc%1dz%2f%3az_________________________/-4 30000000 259 ns/op 212 B/op 6 allocs/op -no/11/URN:-xxx:x___________________________________/-4 20000000 445 ns/op 320 B/op 6 allocs/op -no/12/urn::colon:nss_______________________________/-4 20000000 461 ns/op 320 B/op 6 allocs/op -no/13/urn:abcdefghilmnopqrstuvzabcdefghilmn:specifi/-4 10000000 660 ns/op 320 B/op 6 allocs/op -no/14/URN:a!?:x____________________________________/-4 20000000 507 ns/op 320 B/op 6 allocs/op -no/15/urn:urn:NSS__________________________________/-4 20000000 429 ns/op 288 B/op 6 allocs/op -no/16/urn:white_space:NSS__________________________/-4 20000000 482 ns/op 320 B/op 6 allocs/op -no/17/urn:concat:no_spaces_________________________/-4 20000000 539 ns/op 328 B/op 7 allocs/op -no/18/urn:a:/______________________________________/-4 20000000 470 ns/op 320 B/op 7 allocs/op -no/19/urn:UrN:NSS__________________________________/-4 20000000 399 ns/op 288 B/op 6 allocs/op +ok/00/urn:a:b______________________________________/-10 51372006 109.0 ns/op 275 B/op 3 allocs/op +ok/01/URN:foo:a123,456_____________________________/-10 36024072 160.8 ns/op 296 B/op 6 allocs/op +ok/02/urn:foo:a123%2C456___________________________/-10 31901007 188.4 ns/op 320 B/op 7 allocs/op +ok/03/urn:ietf:params:scim:schemas:core:2.0:User___/-10 22736756 266.6 ns/op 376 B/op 6 allocs/op +ok/04/urn:ietf:params:scim:schemas:extension:enterp/-10 18291859 335.2 ns/op 408 B/op 6 allocs/op +ok/05/urn:ietf:params:scim:schemas:extension:enterp/-10 15283087 379.4 ns/op 440 B/op 6 allocs/op +ok/06/urn:burnout:nss______________________________/-10 39407593 155.1 ns/op 288 B/op 6 allocs/op +ok/07/urn:abcdefghilmnopqrstuvzabcdefghilm:x_______/-10 27832718 211.4 ns/op 307 B/op 4 allocs/op +ok/08/urn:urnurnurn:urn____________________________/-10 33269596 168.1 ns/op 293 B/op 6 allocs/op +ok/09/urn:ciao:!!*_________________________________/-10 41100675 148.8 ns/op 288 B/op 6 allocs/op +ok/10/urn:ciao:=@__________________________________/-10 37214253 149.7 ns/op 284 B/op 6 allocs/op +ok/11/urn:ciao:@!=%2C(xyz)+a,b.*@g=$_'_____________/-10 26534240 229.8 ns/op 336 B/op 7 allocs/op +ok/12/URN:x:abc%1Dz%2F%3az_________________________/-10 28166396 211.8 ns/op 336 B/op 7 allocs/op +no/13/URN:---xxx:x_________________________________/-10 23635159 255.6 ns/op 419 B/op 5 allocs/op +no/14/urn::colon:nss_______________________________/-10 23594779 258.4 ns/op 419 B/op 5 allocs/op +no/15/URN:@,:x_____________________________________/-10 23742535 261.5 ns/op 419 B/op 5 allocs/op +no/16/URN:URN:NSS__________________________________/-10 27432714 223.3 ns/op 371 B/op 5 allocs/op +no/17/urn:UrN:NSS__________________________________/-10 26922117 224.9 ns/op 371 B/op 5 allocs/op +no/18/urn:a:%______________________________________/-10 24926733 224.6 ns/op 371 B/op 5 allocs/op +no/19/urn:urn:NSS__________________________________/-10 27652641 220.7 ns/op 371 B/op 5 allocs/op +``` + +* [1]: Apple M1 Pro + + +## Example + +For more examples take a look at the [examples file](examples_test.go). + + +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + var uid = "URN:foo:a123,456" + + // Parse the input string as a RFC 2141 URN only + u, e := urn.NewMachine().Parse(uid) + if e != nil { + fmt.Errorf(err) + + return + } + + fmt.Println(u.ID) + fmt.Println(u.SS) + + // Output: + // foo + // a123,456 +} +``` + +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + var uid = "URN:foo:a123,456" + + // Parse the input string as a RFC 2141 URN only + u, ok := urn.Parse([]byte(uid)) + if !ok { + panic("error parsing urn") + } + + fmt.Println(u.ID) + fmt.Println(u.SS) + + // Output: + // foo + // a123,456 +} ``` ---- +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + input := "urn:ietf:params:scim:api:messages:2.0:ListResponse" -* [1]: Intel Core i7-7600U CPU @ 2.80GHz + // Parsing the input string as a RFC 7643 SCIM URN + u, ok := urn.Parse([]byte(input), urn.WithParsingMode(urn.RFC7643Only)) + if !ok { + panic("error parsing urn") + } ---- + fmt.Println(u.IsSCIM()) + scim := u.SCIM() + fmt.Println(scim.Type.String()) + fmt.Println(scim.Name) + fmt.Println(scim.Other) -[![Analytics](https://ga-beacon.appspot.com/UA-49657176-1/go-urn?flat)](https://github.com/igrigorik/ga-beacon) \ No newline at end of file + // Output: + // true + // api + // messages + // 2.0:ListResponse +} +``` \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/kind.go b/vendor/github.com/leodido/go-urn/kind.go new file mode 100644 index 00000000..f5e140f0 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/kind.go @@ -0,0 +1,10 @@ +package urn + +type Kind int + +const ( + NONE Kind = iota + RFC2141 + RFC7643 + RFC8141 +) diff --git a/vendor/github.com/leodido/go-urn/machine.go b/vendor/github.com/leodido/go-urn/machine.go index fe5a0cc8..aec1ba69 100644 --- a/vendor/github.com/leodido/go-urn/machine.go +++ b/vendor/github.com/leodido/go-urn/machine.go @@ -2,27 +2,98 @@ package urn import ( "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" ) var ( - errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" - errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its start) [col %d]" - errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" - errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" - errHex = "expecting the specific string hex chars to be well-formed (%%alnum{2}) [col %d]" - errParse = "parsing error [col %d]" + errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" + errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its beginning) [col %d]" + errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" + errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" + errHex = "expecting the percent encoded chars to be well-formed (%%alnum{2}) [col %d]" + errSCIMNamespace = "expecing the SCIM namespace identifier (ietf:params:scim) [col %d]" + errSCIMType = "expecting a correct SCIM type (schemas, api, param) [col %d]" + errSCIMName = "expecting one or more alnum char in the SCIM name part [col %d]" + errSCIMOther = "expecting a well-formed other SCIM part [col %d]" + errSCIMOtherIncomplete = "expecting a not empty SCIM other part after colon [col %d]" + err8141InformalID = "informal URN namespace must be in the form urn-[1-9][0-9] [col %d]" + err8141SpecificString = "expecting the specific string to contain alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] not in first position) chars [col %d]" + err8141Identifier = "expecting the indentifier to be a string with (length 2 to 32 chars) containing alnum (or dashes) not starting or ending with a dash [col %d]" + err8141RComponentStart = "expecting only one r-component (starting with the ?+ sequence) [col %d]" + err8141QComponentStart = "expecting only one q-component (starting with the ?= sequence) [col %d]" + err8141MalformedRComp = "expecting a non-empty r-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" + err8141MalformedQComp = "expecting a non-empty q-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" ) +var _toStateActions []byte = []byte{ + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 33, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, +} + +var _eofActions []byte = []byte{ + 0, 1, 1, 1, 1, 4, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 8, 9, + 9, 4, 4, 11, 1, 1, 1, 1, + 12, 12, 12, 12, 12, 12, 12, 12, + 12, 12, 12, 12, 12, 12, 12, 12, + 12, 14, 14, 14, 14, 16, 18, 20, + 20, 14, 14, 14, 14, 14, 14, 14, + 14, 14, 14, 1, 1, 1, 1, 21, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 23, 24, 24, 25, 25, 0, 26, 28, + 28, 29, 29, 30, 30, 26, 26, 31, + 31, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 21, + 21, 22, 22, 22, 34, 34, 35, 37, + 37, 38, 40, 41, 41, 38, 42, 42, + 42, 44, 42, 48, 48, 48, 50, 44, + 50, 0, +} const start int = 1 -const firstFinal int = 44 +const firstFinal int = 172 -const enFail int = 46 +const enScimOnly int = 44 +const enRfc8141Only int = 83 +const enFail int = 193 const enMain int = 1 // Machine is the interface representing the FSM type Machine interface { Error() error Parse(input []byte) (*URN, error) + WithParsingMode(ParsingMode) } type machine struct { @@ -30,12 +101,24 @@ type machine struct { cs int p, pe, eof, pb int err error - tolower []int + startParsingAt int + parsingMode ParsingMode + parsingModeSet bool } // NewMachine creates a new FSM able to parse RFC 2141 strings. -func NewMachine() Machine { - m := &machine{} +func NewMachine(options ...Option) Machine { + m := &machine{ + parsingModeSet: false, + } + + for _, o := range options { + o(m) + } + // Set default parsing mode + if !m.parsingModeSet { + m.WithParsingMode(DefaultParsingMode) + } return m } @@ -51,7 +134,7 @@ func (m *machine) text() []byte { return m.data[m.pb:m.p] } -// Parse parses the input byte array as a RFC 2141 string. +// Parse parses the input byte array as a RFC 2141 or RFC7643 string. func (m *machine) Parse(input []byte) (*URN, error) { m.data = input m.p = 0 @@ -59,1622 +142,4881 @@ func (m *machine) Parse(input []byte) (*URN, error) { m.pe = len(input) m.eof = len(input) m.err = nil - m.tolower = []int{} - output := &URN{} - - { - m.cs = start + m.cs = m.startParsingAt + output := &URN{ + tolower: []int{}, } - { if (m.p) == (m.pe) { goto _testEof } + if m.cs == 0 { + goto _out + } + _resume: switch m.cs { case 1: - goto stCase1 + switch (m.data)[(m.p)] { + case 85: + goto tr1 + case 117: + goto tr1 + } + goto tr0 case 0: - goto stCase0 + goto _out case 2: - goto stCase2 + switch (m.data)[(m.p)] { + case 82: + goto tr2 + case 114: + goto tr2 + } + goto tr0 case 3: - goto stCase3 + switch (m.data)[(m.p)] { + case 78: + goto tr3 + case 110: + goto tr3 + } + goto tr0 case 4: - goto stCase4 + if (m.data)[(m.p)] == 58 { + goto tr4 + } + goto tr0 case 5: - goto stCase5 + switch (m.data)[(m.p)] { + case 85: + goto tr7 + case 117: + goto tr7 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr6 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr6 + } + default: + goto tr6 + } + goto tr5 case 6: - goto stCase6 + switch (m.data)[(m.p)] { + case 45: + goto tr9 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr9 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr9 + } + default: + goto tr9 + } + goto tr8 case 7: - goto stCase7 + switch (m.data)[(m.p)] { + case 45: + goto tr11 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr11 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr11 + } + default: + goto tr11 + } + goto tr8 case 8: - goto stCase8 + switch (m.data)[(m.p)] { + case 45: + goto tr12 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr12 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr12 + } + default: + goto tr12 + } + goto tr8 case 9: - goto stCase9 + switch (m.data)[(m.p)] { + case 45: + goto tr13 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr13 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr13 + } + default: + goto tr13 + } + goto tr8 case 10: - goto stCase10 + switch (m.data)[(m.p)] { + case 45: + goto tr14 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr14 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr14 + } + default: + goto tr14 + } + goto tr8 case 11: - goto stCase11 + switch (m.data)[(m.p)] { + case 45: + goto tr15 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr15 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr15 + } + default: + goto tr15 + } + goto tr8 case 12: - goto stCase12 + switch (m.data)[(m.p)] { + case 45: + goto tr16 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr16 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr16 + } + default: + goto tr16 + } + goto tr8 case 13: - goto stCase13 + switch (m.data)[(m.p)] { + case 45: + goto tr17 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr17 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr17 + } + default: + goto tr17 + } + goto tr8 case 14: - goto stCase14 + switch (m.data)[(m.p)] { + case 45: + goto tr18 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr18 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr18 + } + default: + goto tr18 + } + goto tr8 case 15: - goto stCase15 + switch (m.data)[(m.p)] { + case 45: + goto tr19 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr19 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr19 + } + default: + goto tr19 + } + goto tr8 case 16: - goto stCase16 + switch (m.data)[(m.p)] { + case 45: + goto tr20 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr20 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr20 + } + default: + goto tr20 + } + goto tr8 case 17: - goto stCase17 + switch (m.data)[(m.p)] { + case 45: + goto tr21 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr21 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr21 + } + default: + goto tr21 + } + goto tr8 case 18: - goto stCase18 + switch (m.data)[(m.p)] { + case 45: + goto tr22 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr22 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr22 + } + default: + goto tr22 + } + goto tr8 case 19: - goto stCase19 + switch (m.data)[(m.p)] { + case 45: + goto tr23 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr23 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr23 + } + default: + goto tr23 + } + goto tr8 case 20: - goto stCase20 + switch (m.data)[(m.p)] { + case 45: + goto tr24 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr24 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr24 + } + default: + goto tr24 + } + goto tr8 case 21: - goto stCase21 + switch (m.data)[(m.p)] { + case 45: + goto tr25 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr25 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr25 + } + default: + goto tr25 + } + goto tr8 case 22: - goto stCase22 + switch (m.data)[(m.p)] { + case 45: + goto tr26 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr26 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr26 + } + default: + goto tr26 + } + goto tr8 case 23: - goto stCase23 + switch (m.data)[(m.p)] { + case 45: + goto tr27 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr27 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr27 + } + default: + goto tr27 + } + goto tr8 case 24: - goto stCase24 + switch (m.data)[(m.p)] { + case 45: + goto tr28 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr28 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr28 + } + default: + goto tr28 + } + goto tr8 case 25: - goto stCase25 + switch (m.data)[(m.p)] { + case 45: + goto tr29 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr29 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr29 + } + default: + goto tr29 + } + goto tr8 case 26: - goto stCase26 + switch (m.data)[(m.p)] { + case 45: + goto tr30 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr30 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr30 + } + default: + goto tr30 + } + goto tr8 case 27: - goto stCase27 + switch (m.data)[(m.p)] { + case 45: + goto tr31 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr31 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr31 + } + default: + goto tr31 + } + goto tr8 case 28: - goto stCase28 + switch (m.data)[(m.p)] { + case 45: + goto tr32 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr32 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr32 + } + default: + goto tr32 + } + goto tr8 case 29: - goto stCase29 + switch (m.data)[(m.p)] { + case 45: + goto tr33 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr33 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr33 + } + default: + goto tr33 + } + goto tr8 case 30: - goto stCase30 + switch (m.data)[(m.p)] { + case 45: + goto tr34 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr34 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr34 + } + default: + goto tr34 + } + goto tr8 case 31: - goto stCase31 + switch (m.data)[(m.p)] { + case 45: + goto tr35 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr35 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr35 + } + default: + goto tr35 + } + goto tr8 case 32: - goto stCase32 + switch (m.data)[(m.p)] { + case 45: + goto tr36 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr36 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr36 + } + default: + goto tr36 + } + goto tr8 case 33: - goto stCase33 + switch (m.data)[(m.p)] { + case 45: + goto tr37 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr37 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr37 + } + default: + goto tr37 + } + goto tr8 case 34: - goto stCase34 - case 35: - goto stCase35 - case 36: - goto stCase36 - case 37: - goto stCase37 - case 38: - goto stCase38 - case 44: - goto stCase44 - case 39: - goto stCase39 - case 40: - goto stCase40 - case 45: - goto stCase45 - case 41: - goto stCase41 - case 42: - goto stCase42 - case 43: - goto stCase43 - case 46: - goto stCase46 - } - goto stOut - stCase1: - switch (m.data)[(m.p)] { - case 85: - goto tr1 - case 117: - goto tr1 - } - goto tr0 - tr0: - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr3: - - m.err = fmt.Errorf(errPrefix, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr6: - - m.err = fmt.Errorf(errIdentifier, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr41: - - m.err = fmt.Errorf(errSpecificString, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr44: - - m.err = fmt.Errorf(errHex, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errSpecificString, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr50: - - m.err = fmt.Errorf(errPrefix, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errIdentifier, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr52: - - m.err = fmt.Errorf(errNoUrnWithinID, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errIdentifier, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - stCase0: - st0: - m.cs = 0 - goto _out - tr1: - - m.pb = m.p - - goto st2 - st2: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof2 - } - stCase2: - switch (m.data)[(m.p)] { - case 82: - goto st3 - case 114: - goto st3 - } - goto tr0 - st3: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof3 - } - stCase3: - switch (m.data)[(m.p)] { - case 78: - goto st4 - case 110: - goto st4 - } - goto tr3 - st4: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof4 - } - stCase4: - if (m.data)[(m.p)] == 58 { - goto tr5 - } - goto tr0 - tr5: - - output.prefix = string(m.text()) - - goto st5 - st5: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof5 - } - stCase5: - switch (m.data)[(m.p)] { - case 85: - goto tr8 - case 117: - goto tr8 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto tr7 + switch (m.data)[(m.p)] { + case 45: + goto tr38 + case 58: + goto tr10 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto tr7 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr38 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr38 + } + default: + goto tr38 } - default: - goto tr7 - } - goto tr6 - tr7: - - m.pb = m.p - - goto st6 - st6: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof6 - } - stCase6: - switch (m.data)[(m.p)] { - case 45: - goto st7 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st7 + goto tr8 + case 35: + switch (m.data)[(m.p)] { + case 45: + goto tr39 + case 58: + goto tr10 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st7 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr39 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr39 + } + default: + goto tr39 } - default: - goto st7 - } - goto tr6 - st7: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof7 - } - stCase7: - switch (m.data)[(m.p)] { - case 45: - goto st8 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st8 + goto tr8 + case 36: + switch (m.data)[(m.p)] { + case 45: + goto tr40 + case 58: + goto tr10 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st8 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr40 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr40 + } + default: + goto tr40 } - default: - goto st8 - } - goto tr6 - st8: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof8 - } - stCase8: - switch (m.data)[(m.p)] { - case 45: - goto st9 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st9 + goto tr8 + case 37: + if (m.data)[(m.p)] == 58 { + goto tr10 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st9 + goto tr8 + case 38: + switch (m.data)[(m.p)] { + case 33: + goto tr42 + case 36: + goto tr42 + case 37: + goto tr43 + case 61: + goto tr42 + case 95: + goto tr42 } - default: - goto st9 - } - goto tr6 - st9: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof9 - } - stCase9: - switch (m.data)[(m.p)] { - case 45: - goto st10 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st10 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr42 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr42 + } + case (m.data)[(m.p)] >= 64: + goto tr42 + } + default: + goto tr42 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st10 + goto tr41 + case 172: + switch (m.data)[(m.p)] { + case 33: + goto tr212 + case 36: + goto tr212 + case 37: + goto tr213 + case 61: + goto tr212 + case 95: + goto tr212 } - default: - goto st10 - } - goto tr6 - st10: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof10 - } - stCase10: - switch (m.data)[(m.p)] { - case 45: - goto st11 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st11 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr212 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr212 + } + case (m.data)[(m.p)] >= 64: + goto tr212 + } + default: + goto tr212 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st11 + goto tr41 + case 39: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr45 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr45 + } + default: + goto tr46 } - default: - goto st11 - } - goto tr6 - st11: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof11 - } - stCase11: - switch (m.data)[(m.p)] { - case 45: - goto st12 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st12 + goto tr44 + case 40: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr47 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr47 + } + default: + goto tr48 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st12 + goto tr44 + case 173: + switch (m.data)[(m.p)] { + case 33: + goto tr212 + case 36: + goto tr212 + case 37: + goto tr213 + case 61: + goto tr212 + case 95: + goto tr212 } - default: - goto st12 - } - goto tr6 - st12: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof12 - } - stCase12: - switch (m.data)[(m.p)] { - case 45: - goto st13 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st13 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr212 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr212 + } + case (m.data)[(m.p)] >= 64: + goto tr212 + } + default: + goto tr212 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st13 + goto tr44 + case 41: + switch (m.data)[(m.p)] { + case 45: + goto tr9 + case 58: + goto tr10 + case 82: + goto tr49 + case 114: + goto tr49 } - default: - goto st13 - } - goto tr6 - st13: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof13 - } - stCase13: - switch (m.data)[(m.p)] { - case 45: - goto st14 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st14 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr9 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr9 + } + default: + goto tr9 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st14 + goto tr5 + case 42: + switch (m.data)[(m.p)] { + case 45: + goto tr11 + case 58: + goto tr10 + case 78: + goto tr50 + case 110: + goto tr50 } - default: - goto st14 - } - goto tr6 - st14: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof14 - } - stCase14: - switch (m.data)[(m.p)] { - case 45: - goto st15 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st15 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr11 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr11 + } + default: + goto tr11 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st15 + goto tr5 + case 43: + if (m.data)[(m.p)] == 45 { + goto tr12 } - default: - goto st15 - } - goto tr6 - st15: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof15 - } - stCase15: - switch (m.data)[(m.p)] { - case 45: - goto st16 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st16 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr12 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr12 + } + default: + goto tr12 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st16 + goto tr51 + case 44: + switch (m.data)[(m.p)] { + case 85: + goto tr52 + case 117: + goto tr52 } - default: - goto st16 - } - goto tr6 - st16: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof16 - } - stCase16: - switch (m.data)[(m.p)] { + goto tr0 case 45: - goto st17 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st17 + switch (m.data)[(m.p)] { + case 82: + goto tr53 + case 114: + goto tr53 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st17 + goto tr0 + case 46: + switch (m.data)[(m.p)] { + case 78: + goto tr54 + case 110: + goto tr54 } - default: - goto st17 - } - goto tr6 - st17: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof17 - } - stCase17: - switch (m.data)[(m.p)] { - case 45: - goto st18 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st18 + goto tr0 + case 47: + if (m.data)[(m.p)] == 58 { + goto tr55 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st18 + goto tr0 + case 48: + if (m.data)[(m.p)] == 105 { + goto tr57 } - default: - goto st18 - } - goto tr6 - st18: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof18 - } - stCase18: - switch (m.data)[(m.p)] { - case 45: - goto st19 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st19 + goto tr56 + case 49: + if (m.data)[(m.p)] == 101 { + goto tr58 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st19 + goto tr56 + case 50: + if (m.data)[(m.p)] == 116 { + goto tr59 } - default: - goto st19 - } - goto tr6 - st19: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof19 - } - stCase19: - switch (m.data)[(m.p)] { - case 45: - goto st20 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st20 + goto tr56 + case 51: + if (m.data)[(m.p)] == 102 { + goto tr60 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st20 + goto tr56 + case 52: + if (m.data)[(m.p)] == 58 { + goto tr61 } - default: - goto st20 - } - goto tr6 - st20: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof20 - } - stCase20: - switch (m.data)[(m.p)] { - case 45: - goto st21 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st21 + goto tr56 + case 53: + if (m.data)[(m.p)] == 112 { + goto tr62 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st21 + goto tr56 + case 54: + if (m.data)[(m.p)] == 97 { + goto tr63 } - default: - goto st21 - } - goto tr6 - st21: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof21 - } - stCase21: - switch (m.data)[(m.p)] { - case 45: - goto st22 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st22 + goto tr56 + case 55: + if (m.data)[(m.p)] == 114 { + goto tr64 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st22 + goto tr56 + case 56: + if (m.data)[(m.p)] == 97 { + goto tr65 } - default: - goto st22 - } - goto tr6 - st22: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof22 - } - stCase22: - switch (m.data)[(m.p)] { - case 45: - goto st23 + goto tr56 + case 57: + if (m.data)[(m.p)] == 109 { + goto tr66 + } + goto tr56 case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st23 + if (m.data)[(m.p)] == 115 { + goto tr67 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st23 + goto tr56 + case 59: + if (m.data)[(m.p)] == 58 { + goto tr68 } - default: - goto st23 - } - goto tr6 - st23: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof23 - } - stCase23: - switch (m.data)[(m.p)] { - case 45: - goto st24 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st24 + goto tr56 + case 60: + if (m.data)[(m.p)] == 115 { + goto tr69 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st24 + goto tr56 + case 61: + if (m.data)[(m.p)] == 99 { + goto tr70 } - default: - goto st24 - } - goto tr6 - st24: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof24 - } - stCase24: - switch (m.data)[(m.p)] { - case 45: - goto st25 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st25 + goto tr56 + case 62: + if (m.data)[(m.p)] == 105 { + goto tr71 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st25 + goto tr56 + case 63: + if (m.data)[(m.p)] == 109 { + goto tr72 } - default: - goto st25 - } - goto tr6 - st25: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof25 - } - stCase25: - switch (m.data)[(m.p)] { - case 45: - goto st26 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st26 + goto tr56 + case 64: + if (m.data)[(m.p)] == 58 { + goto tr73 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st26 + goto tr56 + case 65: + switch (m.data)[(m.p)] { + case 97: + goto tr75 + case 112: + goto tr76 + case 115: + goto tr77 } - default: - goto st26 - } - goto tr6 - st26: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof26 - } - stCase26: - switch (m.data)[(m.p)] { - case 45: - goto st27 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st27 + goto tr74 + case 66: + if (m.data)[(m.p)] == 112 { + goto tr78 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st27 + goto tr74 + case 67: + if (m.data)[(m.p)] == 105 { + goto tr79 } - default: - goto st27 - } - goto tr6 - st27: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof27 - } - stCase27: - switch (m.data)[(m.p)] { - case 45: - goto st28 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st28 + goto tr74 + case 68: + if (m.data)[(m.p)] == 58 { + goto tr80 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st28 + goto tr74 + case 69: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr82 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr82 + } + default: + goto tr82 } - default: - goto st28 - } - goto tr6 - st28: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof28 - } - stCase28: - switch (m.data)[(m.p)] { - case 45: - goto st29 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st29 + goto tr81 + case 174: + if (m.data)[(m.p)] == 58 { + goto tr215 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st29 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr214 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr214 + } + default: + goto tr214 } - default: - goto st29 - } - goto tr6 - st29: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof29 - } - stCase29: - switch (m.data)[(m.p)] { - case 45: - goto st30 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st30 + goto tr81 + case 70: + switch (m.data)[(m.p)] { + case 33: + goto tr84 + case 36: + goto tr84 + case 37: + goto tr85 + case 61: + goto tr84 + case 95: + goto tr84 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st30 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr84 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr84 + } + case (m.data)[(m.p)] >= 64: + goto tr84 + } + default: + goto tr84 } - default: - goto st30 - } - goto tr6 - st30: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof30 - } - stCase30: - switch (m.data)[(m.p)] { - case 45: - goto st31 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st31 + goto tr83 + case 175: + switch (m.data)[(m.p)] { + case 33: + goto tr216 + case 36: + goto tr216 + case 37: + goto tr217 + case 61: + goto tr216 + case 95: + goto tr216 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st31 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr216 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr216 + } + case (m.data)[(m.p)] >= 64: + goto tr216 + } + default: + goto tr216 } - default: - goto st31 - } - goto tr6 - st31: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof31 - } - stCase31: - switch (m.data)[(m.p)] { - case 45: - goto st32 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st32 + goto tr83 + case 71: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr87 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr87 + } + default: + goto tr88 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st32 + goto tr86 + case 72: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr89 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr89 + } + default: + goto tr90 } - default: - goto st32 - } - goto tr6 - st32: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof32 - } - stCase32: - switch (m.data)[(m.p)] { - case 45: - goto st33 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st33 + goto tr86 + case 176: + switch (m.data)[(m.p)] { + case 33: + goto tr216 + case 36: + goto tr216 + case 37: + goto tr217 + case 61: + goto tr216 + case 95: + goto tr216 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st33 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr216 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr216 + } + case (m.data)[(m.p)] >= 64: + goto tr216 + } + default: + goto tr216 } - default: - goto st33 - } - goto tr6 - st33: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof33 - } - stCase33: - switch (m.data)[(m.p)] { - case 45: - goto st34 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st34 + goto tr86 + case 73: + if (m.data)[(m.p)] == 97 { + goto tr91 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st34 + goto tr74 + case 74: + if (m.data)[(m.p)] == 114 { + goto tr92 } - default: - goto st34 - } - goto tr6 - st34: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof34 - } - stCase34: - switch (m.data)[(m.p)] { - case 45: - goto st35 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st35 + goto tr74 + case 75: + if (m.data)[(m.p)] == 97 { + goto tr93 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st35 + goto tr74 + case 76: + if (m.data)[(m.p)] == 109 { + goto tr79 } - default: - goto st35 - } - goto tr6 - st35: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof35 - } - stCase35: - switch (m.data)[(m.p)] { - case 45: - goto st36 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st36 + goto tr74 + case 77: + if (m.data)[(m.p)] == 99 { + goto tr94 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st36 + goto tr74 + case 78: + if (m.data)[(m.p)] == 104 { + goto tr95 } - default: - goto st36 - } - goto tr6 - st36: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof36 - } - stCase36: - switch (m.data)[(m.p)] { - case 45: - goto st37 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st37 + goto tr74 + case 79: + if (m.data)[(m.p)] == 101 { + goto tr96 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st37 + goto tr74 + case 80: + if (m.data)[(m.p)] == 109 { + goto tr97 } - default: - goto st37 - } - goto tr6 - st37: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof37 - } - stCase37: - if (m.data)[(m.p)] == 58 { - goto tr10 - } - goto tr6 - tr10: - - output.ID = string(m.text()) - - goto st38 - st38: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof38 - } - stCase38: - switch (m.data)[(m.p)] { - case 33: - goto tr42 - case 36: - goto tr42 - case 37: - goto tr43 - case 61: - goto tr42 - case 95: - goto tr42 - } - switch { - case (m.data)[(m.p)] < 48: - if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { - goto tr42 + goto tr74 + case 81: + if (m.data)[(m.p)] == 97 { + goto tr98 + } + goto tr74 + case 82: + if (m.data)[(m.p)] == 115 { + goto tr79 + } + goto tr74 + case 83: + switch (m.data)[(m.p)] { + case 85: + goto tr99 + case 117: + goto tr99 + } + goto tr0 + case 84: + switch (m.data)[(m.p)] { + case 82: + goto tr100 + case 114: + goto tr100 + } + goto tr0 + case 85: + switch (m.data)[(m.p)] { + case 78: + goto tr101 + case 110: + goto tr101 + } + goto tr0 + case 86: + if (m.data)[(m.p)] == 58 { + goto tr102 + } + goto tr0 + case 87: + switch (m.data)[(m.p)] { + case 85: + goto tr105 + case 117: + goto tr105 } - case (m.data)[(m.p)] > 59: switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr104 + } case (m.data)[(m.p)] > 90: if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto tr42 + goto tr104 } - case (m.data)[(m.p)] >= 64: - goto tr42 + default: + goto tr104 } - default: - goto tr42 - } - goto tr41 - tr42: - - m.pb = m.p - - goto st44 - st44: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof44 - } - stCase44: - switch (m.data)[(m.p)] { - case 33: - goto st44 - case 36: - goto st44 - case 37: - goto st39 - case 61: - goto st44 + goto tr103 + case 88: + if (m.data)[(m.p)] == 45 { + goto tr107 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr108 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr108 + } + default: + goto tr108 + } + goto tr106 + case 89: + if (m.data)[(m.p)] == 45 { + goto tr109 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr106 + case 90: + if (m.data)[(m.p)] == 45 { + goto tr111 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 91: + if (m.data)[(m.p)] == 45 { + goto tr113 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr114 + } + default: + goto tr114 + } + goto tr106 + case 92: + if (m.data)[(m.p)] == 45 { + goto tr115 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 93: + if (m.data)[(m.p)] == 45 { + goto tr117 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr118 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr118 + } + default: + goto tr118 + } + goto tr106 + case 94: + if (m.data)[(m.p)] == 45 { + goto tr119 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr120 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr120 + } + default: + goto tr120 + } + goto tr106 case 95: - goto st44 - } - switch { - case (m.data)[(m.p)] < 48: - if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { - goto st44 + if (m.data)[(m.p)] == 45 { + goto tr121 } - case (m.data)[(m.p)] > 59: switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr122 + } case (m.data)[(m.p)] > 90: if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st44 + goto tr122 } - case (m.data)[(m.p)] >= 64: - goto st44 + default: + goto tr122 } - default: - goto st44 - } - goto tr41 - tr43: + goto tr106 + case 96: + if (m.data)[(m.p)] == 45 { + goto tr123 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr124 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr124 + } + default: + goto tr124 + } + goto tr106 + case 97: + if (m.data)[(m.p)] == 45 { + goto tr125 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr126 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr126 + } + default: + goto tr126 + } + goto tr106 + case 98: + if (m.data)[(m.p)] == 45 { + goto tr127 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr128 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr128 + } + default: + goto tr128 + } + goto tr106 + case 99: + if (m.data)[(m.p)] == 45 { + goto tr129 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr130 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr130 + } + default: + goto tr130 + } + goto tr106 + case 100: + if (m.data)[(m.p)] == 45 { + goto tr131 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr132 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr132 + } + default: + goto tr132 + } + goto tr106 + case 101: + if (m.data)[(m.p)] == 45 { + goto tr133 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr134 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr134 + } + default: + goto tr134 + } + goto tr106 + case 102: + if (m.data)[(m.p)] == 45 { + goto tr135 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr136 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr136 + } + default: + goto tr136 + } + goto tr106 + case 103: + if (m.data)[(m.p)] == 45 { + goto tr137 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr138 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr138 + } + default: + goto tr138 + } + goto tr106 + case 104: + if (m.data)[(m.p)] == 45 { + goto tr139 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr140 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr140 + } + default: + goto tr140 + } + goto tr106 + case 105: + if (m.data)[(m.p)] == 45 { + goto tr141 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr142 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr142 + } + default: + goto tr142 + } + goto tr106 + case 106: + if (m.data)[(m.p)] == 45 { + goto tr143 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr144 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr144 + } + default: + goto tr144 + } + goto tr106 + case 107: + if (m.data)[(m.p)] == 45 { + goto tr145 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr146 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr146 + } + default: + goto tr146 + } + goto tr106 + case 108: + if (m.data)[(m.p)] == 45 { + goto tr147 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr148 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr148 + } + default: + goto tr148 + } + goto tr106 + case 109: + if (m.data)[(m.p)] == 45 { + goto tr149 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr150 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr150 + } + default: + goto tr150 + } + goto tr106 + case 110: + if (m.data)[(m.p)] == 45 { + goto tr151 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr152 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr152 + } + default: + goto tr152 + } + goto tr106 + case 111: + if (m.data)[(m.p)] == 45 { + goto tr153 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr154 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr154 + } + default: + goto tr154 + } + goto tr106 + case 112: + if (m.data)[(m.p)] == 45 { + goto tr155 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr156 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr156 + } + default: + goto tr156 + } + goto tr106 + case 113: + if (m.data)[(m.p)] == 45 { + goto tr157 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr158 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr158 + } + default: + goto tr158 + } + goto tr106 + case 114: + if (m.data)[(m.p)] == 45 { + goto tr159 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr160 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr160 + } + default: + goto tr160 + } + goto tr106 + case 115: + if (m.data)[(m.p)] == 45 { + goto tr161 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr162 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr162 + } + default: + goto tr162 + } + goto tr106 + case 116: + if (m.data)[(m.p)] == 45 { + goto tr163 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr164 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr164 + } + default: + goto tr164 + } + goto tr106 + case 117: + if (m.data)[(m.p)] == 45 { + goto tr165 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr166 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr166 + } + default: + goto tr166 + } + goto tr106 + case 118: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr167 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr167 + } + default: + goto tr167 + } + goto tr106 + case 119: + if (m.data)[(m.p)] == 58 { + goto tr168 + } + goto tr106 + case 120: + switch (m.data)[(m.p)] { + case 33: + goto tr170 + case 37: + goto tr171 + case 61: + goto tr170 + case 95: + goto tr170 + case 126: + goto tr170 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr170 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr170 + } + case (m.data)[(m.p)] >= 64: + goto tr170 + } + default: + goto tr170 + } + goto tr169 + case 177: + switch (m.data)[(m.p)] { + case 33: + goto tr218 + case 35: + goto tr219 + case 37: + goto tr220 + case 61: + goto tr218 + case 63: + goto tr221 + case 95: + goto tr218 + case 126: + goto tr218 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr218 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr218 + } + default: + goto tr218 + } + goto tr169 + case 178: + switch (m.data)[(m.p)] { + case 33: + goto tr222 + case 37: + goto tr223 + case 61: + goto tr222 + case 95: + goto tr222 + case 126: + goto tr222 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr222 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr222 + } + default: + goto tr222 + } + goto tr183 + case 179: + switch (m.data)[(m.p)] { + case 33: + goto tr224 + case 37: + goto tr225 + case 61: + goto tr224 + case 95: + goto tr224 + case 126: + goto tr224 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr224 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr224 + } + default: + goto tr224 + } + goto tr183 + case 121: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr173 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr173 + } + default: + goto tr174 + } + goto tr172 + case 122: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr175 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr175 + } + default: + goto tr176 + } + goto tr172 + case 180: + switch (m.data)[(m.p)] { + case 33: + goto tr224 + case 37: + goto tr225 + case 61: + goto tr224 + case 95: + goto tr224 + case 126: + goto tr224 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr224 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr224 + } + default: + goto tr224 + } + goto tr172 + case 123: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr178 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr178 + } + default: + goto tr179 + } + goto tr177 + case 124: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr180 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr180 + } + default: + goto tr181 + } + goto tr177 + case 181: + switch (m.data)[(m.p)] { + case 33: + goto tr218 + case 35: + goto tr219 + case 37: + goto tr220 + case 61: + goto tr218 + case 63: + goto tr221 + case 95: + goto tr218 + case 126: + goto tr218 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr218 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr218 + } + default: + goto tr218 + } + goto tr177 + case 125: + switch (m.data)[(m.p)] { + case 43: + goto tr182 + case 61: + goto tr184 + } + goto tr183 + case 126: + switch (m.data)[(m.p)] { + case 33: + goto tr186 + case 37: + goto tr187 + case 61: + goto tr186 + case 63: + goto tr188 + case 95: + goto tr186 + case 126: + goto tr186 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr186 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr186 + } + case (m.data)[(m.p)] >= 64: + goto tr186 + } + default: + goto tr186 + } + goto tr185 + case 182: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 61: + goto tr226 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr185 + case 127: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr190 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr190 + } + default: + goto tr191 + } + goto tr189 + case 128: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr192 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr192 + } + default: + goto tr193 + } + goto tr189 + case 183: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 61: + goto tr226 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr189 + case 184: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 43: + goto tr230 + case 61: + goto tr231 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr185 + case 185: + switch (m.data)[(m.p)] { + case 33: + goto tr232 + case 35: + goto tr233 + case 37: + goto tr234 + case 47: + goto tr226 + case 61: + goto tr232 + case 63: + goto tr235 + case 95: + goto tr232 + case 126: + goto tr232 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr232 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr232 + } + default: + goto tr232 + } + goto tr185 + case 186: + switch (m.data)[(m.p)] { + case 33: + goto tr204 + case 35: + goto tr227 + case 37: + goto tr237 + case 47: + goto tr226 + case 61: + goto tr204 + case 63: + goto tr229 + case 95: + goto tr204 + case 126: + goto tr204 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr204 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr204 + } + default: + goto tr204 + } + goto tr236 + case 187: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr238 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr203 + case 129: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr195 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr195 + } + default: + goto tr196 + } + goto tr194 + case 130: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr197 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr197 + } + default: + goto tr198 + } + goto tr194 + case 188: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr238 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr194 + case 189: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr242 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr203 + case 190: + switch (m.data)[(m.p)] { + case 33: + goto tr243 + case 35: + goto tr244 + case 37: + goto tr245 + case 47: + goto tr238 + case 61: + goto tr243 + case 63: + goto tr246 + case 95: + goto tr243 + case 126: + goto tr243 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr243 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr243 + } + default: + goto tr243 + } + goto tr203 + case 131: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr200 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr200 + } + default: + goto tr201 + } + goto tr199 + case 132: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr197 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr197 + } + default: + goto tr198 + } + goto tr199 + case 133: + if (m.data)[(m.p)] == 43 { + goto tr202 + } + goto tr185 + case 191: + switch (m.data)[(m.p)] { + case 33: + goto tr232 + case 35: + goto tr233 + case 37: + goto tr234 + case 61: + goto tr232 + case 63: + goto tr247 + case 95: + goto tr232 + case 126: + goto tr232 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr232 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr232 + } + case (m.data)[(m.p)] >= 64: + goto tr232 + } + default: + goto tr232 + } + goto tr185 + case 134: + switch (m.data)[(m.p)] { + case 43: + goto tr202 + case 61: + goto tr184 + } + goto tr185 + case 135: + switch (m.data)[(m.p)] { + case 33: + goto tr204 + case 37: + goto tr205 + case 61: + goto tr204 + case 63: + goto tr206 + case 95: + goto tr204 + case 126: + goto tr204 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr204 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr204 + } + case (m.data)[(m.p)] >= 64: + goto tr204 + } + default: + goto tr204 + } + goto tr203 + case 136: + if (m.data)[(m.p)] == 61 { + goto tr207 + } + goto tr203 + case 192: + switch (m.data)[(m.p)] { + case 33: + goto tr243 + case 35: + goto tr244 + case 37: + goto tr245 + case 61: + goto tr243 + case 63: + goto tr248 + case 95: + goto tr243 + case 126: + goto tr243 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr243 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr243 + } + case (m.data)[(m.p)] >= 64: + goto tr243 + } + default: + goto tr243 + } + goto tr203 + case 137: + if (m.data)[(m.p)] == 58 { + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr167 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr167 + } + default: + goto tr167 + } + goto tr106 + case 138: + switch (m.data)[(m.p)] { + case 45: + goto tr165 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr166 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr166 + } + default: + goto tr166 + } + goto tr106 + case 139: + switch (m.data)[(m.p)] { + case 45: + goto tr163 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr164 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr164 + } + default: + goto tr164 + } + goto tr106 + case 140: + switch (m.data)[(m.p)] { + case 45: + goto tr161 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr162 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr162 + } + default: + goto tr162 + } + goto tr106 + case 141: + switch (m.data)[(m.p)] { + case 45: + goto tr159 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr160 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr160 + } + default: + goto tr160 + } + goto tr106 + case 142: + switch (m.data)[(m.p)] { + case 45: + goto tr157 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr158 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr158 + } + default: + goto tr158 + } + goto tr106 + case 143: + switch (m.data)[(m.p)] { + case 45: + goto tr155 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr156 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr156 + } + default: + goto tr156 + } + goto tr106 + case 144: + switch (m.data)[(m.p)] { + case 45: + goto tr153 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr154 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr154 + } + default: + goto tr154 + } + goto tr106 + case 145: + switch (m.data)[(m.p)] { + case 45: + goto tr151 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr152 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr152 + } + default: + goto tr152 + } + goto tr106 + case 146: + switch (m.data)[(m.p)] { + case 45: + goto tr149 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr150 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr150 + } + default: + goto tr150 + } + goto tr106 + case 147: + switch (m.data)[(m.p)] { + case 45: + goto tr147 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr148 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr148 + } + default: + goto tr148 + } + goto tr106 + case 148: + switch (m.data)[(m.p)] { + case 45: + goto tr145 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr146 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr146 + } + default: + goto tr146 + } + goto tr106 + case 149: + switch (m.data)[(m.p)] { + case 45: + goto tr143 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr144 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr144 + } + default: + goto tr144 + } + goto tr106 + case 150: + switch (m.data)[(m.p)] { + case 45: + goto tr141 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr142 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr142 + } + default: + goto tr142 + } + goto tr106 + case 151: + switch (m.data)[(m.p)] { + case 45: + goto tr139 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr140 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr140 + } + default: + goto tr140 + } + goto tr106 + case 152: + switch (m.data)[(m.p)] { + case 45: + goto tr137 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr138 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr138 + } + default: + goto tr138 + } + goto tr106 + case 153: + switch (m.data)[(m.p)] { + case 45: + goto tr135 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr136 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr136 + } + default: + goto tr136 + } + goto tr106 + case 154: + switch (m.data)[(m.p)] { + case 45: + goto tr133 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr134 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr134 + } + default: + goto tr134 + } + goto tr106 + case 155: + switch (m.data)[(m.p)] { + case 45: + goto tr131 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr132 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr132 + } + default: + goto tr132 + } + goto tr106 + case 156: + switch (m.data)[(m.p)] { + case 45: + goto tr129 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr130 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr130 + } + default: + goto tr130 + } + goto tr106 + case 157: + switch (m.data)[(m.p)] { + case 45: + goto tr127 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr128 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr128 + } + default: + goto tr128 + } + goto tr106 + case 158: + switch (m.data)[(m.p)] { + case 45: + goto tr125 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr126 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr126 + } + default: + goto tr126 + } + goto tr106 + case 159: + switch (m.data)[(m.p)] { + case 45: + goto tr123 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr124 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr124 + } + default: + goto tr124 + } + goto tr106 + case 160: + switch (m.data)[(m.p)] { + case 45: + goto tr121 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr122 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr122 + } + default: + goto tr122 + } + goto tr106 + case 161: + switch (m.data)[(m.p)] { + case 45: + goto tr119 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr120 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr120 + } + default: + goto tr120 + } + goto tr106 + case 162: + switch (m.data)[(m.p)] { + case 45: + goto tr117 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr118 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr118 + } + default: + goto tr118 + } + goto tr106 + case 163: + switch (m.data)[(m.p)] { + case 45: + goto tr115 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 164: + switch (m.data)[(m.p)] { + case 45: + goto tr113 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr114 + } + default: + goto tr114 + } + goto tr106 + case 165: + switch (m.data)[(m.p)] { + case 45: + goto tr111 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 166: + switch (m.data)[(m.p)] { + case 45: + goto tr109 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr106 + case 167: + switch (m.data)[(m.p)] { + case 45: + goto tr107 + case 82: + goto tr208 + case 114: + goto tr208 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr108 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr108 + } + default: + goto tr108 + } + goto tr103 + case 168: + switch (m.data)[(m.p)] { + case 45: + goto tr109 + case 58: + goto tr168 + case 78: + goto tr209 + case 110: + goto tr209 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr103 + case 169: + switch (m.data)[(m.p)] { + case 45: + goto tr210 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 170: + switch (m.data)[(m.p)] { + case 45: + goto tr113 + case 48: + goto tr211 + } + switch { + case (m.data)[(m.p)] < 65: + if 49 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr211 + } + default: + goto tr211 + } + goto tr106 + case 171: + if (m.data)[(m.p)] == 45 { + goto tr115 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 193: + switch (m.data)[(m.p)] { + case 10: + goto tr183 + case 13: + goto tr183 + } + goto tr249 + } + + tr183: + m.cs = 0 + goto _again + tr0: + m.cs = 0 + goto f0 + tr5: + m.cs = 0 + goto f3 + tr8: + m.cs = 0 + goto f5 + tr41: + m.cs = 0 + goto f7 + tr44: + m.cs = 0 + goto f8 + tr51: + m.cs = 0 + goto f10 + tr56: + m.cs = 0 + goto f11 + tr74: + m.cs = 0 + goto f13 + tr81: + m.cs = 0 + goto f15 + tr83: + m.cs = 0 + goto f17 + tr86: + m.cs = 0 + goto f19 + tr103: + m.cs = 0 + goto f20 + tr106: + m.cs = 0 + goto f21 + tr169: + m.cs = 0 + goto f22 + tr172: + m.cs = 0 + goto f23 + tr177: + m.cs = 0 + goto f24 + tr185: + m.cs = 0 + goto f25 + tr189: + m.cs = 0 + goto f27 + tr194: + m.cs = 0 + goto f28 + tr199: + m.cs = 0 + goto f29 + tr203: + m.cs = 0 + goto f30 + tr236: + m.cs = 0 + goto f46 + tr1: + m.cs = 2 + goto f1 + tr2: + m.cs = 3 + goto _again + tr3: + m.cs = 4 + goto _again + tr4: + m.cs = 5 + goto f2 + tr6: + m.cs = 6 + goto f4 + tr9: + m.cs = 7 + goto _again + tr11: + m.cs = 8 + goto _again + tr12: + m.cs = 9 + goto _again + tr13: + m.cs = 10 + goto _again + tr14: + m.cs = 11 + goto _again + tr15: + m.cs = 12 + goto _again + tr16: + m.cs = 13 + goto _again + tr17: + m.cs = 14 + goto _again + tr18: + m.cs = 15 + goto _again + tr19: + m.cs = 16 + goto _again + tr20: + m.cs = 17 + goto _again + tr21: + m.cs = 18 + goto _again + tr22: + m.cs = 19 + goto _again + tr23: + m.cs = 20 + goto _again + tr24: + m.cs = 21 + goto _again + tr25: + m.cs = 22 + goto _again + tr26: + m.cs = 23 + goto _again + tr27: + m.cs = 24 + goto _again + tr28: + m.cs = 25 + goto _again + tr29: + m.cs = 26 + goto _again + tr30: + m.cs = 27 + goto _again + tr31: + m.cs = 28 + goto _again + tr32: + m.cs = 29 + goto _again + tr33: + m.cs = 30 + goto _again + tr34: + m.cs = 31 + goto _again + tr35: + m.cs = 32 + goto _again + tr36: + m.cs = 33 + goto _again + tr37: + m.cs = 34 + goto _again + tr38: + m.cs = 35 + goto _again + tr39: + m.cs = 36 + goto _again + tr40: + m.cs = 37 + goto _again + tr10: + m.cs = 38 + goto f6 + tr213: + m.cs = 39 + goto _again + tr43: + m.cs = 39 + goto f4 + tr45: + m.cs = 40 + goto _again + tr46: + m.cs = 40 + goto f9 + tr7: + m.cs = 41 + goto f1 + tr49: + m.cs = 42 + goto _again + tr50: + m.cs = 43 + goto _again + tr52: + m.cs = 45 + goto f1 + tr53: + m.cs = 46 + goto _again + tr54: + m.cs = 47 + goto _again + tr55: + m.cs = 48 + goto f2 + tr57: + m.cs = 49 + goto f4 + tr58: + m.cs = 50 + goto _again + tr59: + m.cs = 51 + goto _again + tr60: + m.cs = 52 + goto _again + tr61: + m.cs = 53 + goto _again + tr62: + m.cs = 54 + goto _again + tr63: + m.cs = 55 + goto _again + tr64: + m.cs = 56 + goto _again + tr65: + m.cs = 57 + goto _again + tr66: + m.cs = 58 + goto _again + tr67: + m.cs = 59 + goto _again + tr68: + m.cs = 60 + goto _again + tr69: + m.cs = 61 + goto _again + tr70: + m.cs = 62 + goto _again + tr71: + m.cs = 63 + goto _again + tr72: + m.cs = 64 + goto _again + tr73: + m.cs = 65 + goto f12 + tr75: + m.cs = 66 + goto f4 + tr78: + m.cs = 67 + goto _again + tr79: + m.cs = 68 + goto _again + tr80: + m.cs = 69 + goto f14 + tr215: + m.cs = 70 + goto f35 + tr217: + m.cs = 71 + goto _again + tr85: + m.cs = 71 + goto f18 + tr87: + m.cs = 72 + goto _again + tr88: + m.cs = 72 + goto f9 + tr76: + m.cs = 73 + goto f4 + tr91: + m.cs = 74 + goto _again + tr92: + m.cs = 75 + goto _again + tr93: + m.cs = 76 + goto _again + tr77: + m.cs = 77 + goto f4 + tr94: + m.cs = 78 + goto _again + tr95: + m.cs = 79 + goto _again + tr96: + m.cs = 80 + goto _again + tr97: + m.cs = 81 + goto _again + tr98: + m.cs = 82 + goto _again + tr99: + m.cs = 84 + goto f1 + tr100: + m.cs = 85 + goto _again + tr101: + m.cs = 86 + goto _again + tr102: + m.cs = 87 + goto f2 + tr104: + m.cs = 88 + goto f4 + tr107: + m.cs = 89 + goto _again + tr109: + m.cs = 90 + goto _again + tr111: + m.cs = 91 + goto _again + tr113: + m.cs = 92 + goto _again + tr115: + m.cs = 93 + goto _again + tr117: + m.cs = 94 + goto _again + tr119: + m.cs = 95 + goto _again + tr121: + m.cs = 96 + goto _again + tr123: + m.cs = 97 + goto _again + tr125: + m.cs = 98 + goto _again + tr127: + m.cs = 99 + goto _again + tr129: + m.cs = 100 + goto _again + tr131: + m.cs = 101 + goto _again + tr133: + m.cs = 102 + goto _again + tr135: + m.cs = 103 + goto _again + tr137: + m.cs = 104 + goto _again + tr139: + m.cs = 105 + goto _again + tr141: + m.cs = 106 + goto _again + tr143: + m.cs = 107 + goto _again + tr145: + m.cs = 108 + goto _again + tr147: + m.cs = 109 + goto _again + tr149: + m.cs = 110 + goto _again + tr151: + m.cs = 111 + goto _again + tr153: + m.cs = 112 + goto _again + tr155: + m.cs = 113 + goto _again + tr157: + m.cs = 114 + goto _again + tr159: + m.cs = 115 + goto _again + tr161: + m.cs = 116 + goto _again + tr163: + m.cs = 117 + goto _again + tr165: + m.cs = 118 + goto _again + tr167: + m.cs = 119 + goto _again + tr168: + m.cs = 120 + goto f6 + tr225: + m.cs = 121 + goto _again + tr223: + m.cs = 121 + goto f4 + tr173: + m.cs = 122 + goto _again + tr174: + m.cs = 122 + goto f9 + tr220: + m.cs = 123 + goto _again + tr171: + m.cs = 123 + goto f4 + tr178: + m.cs = 124 + goto _again + tr179: + m.cs = 124 + goto f9 + tr221: + m.cs = 125 + goto f38 + tr182: + m.cs = 126 + goto _again + tr228: + m.cs = 127 + goto _again + tr187: + m.cs = 127 + goto f26 + tr234: + m.cs = 127 + goto f44 + tr190: + m.cs = 128 + goto _again + tr191: + m.cs = 128 + goto f9 + tr240: + m.cs = 129 + goto _again + tr205: + m.cs = 129 + goto f31 + tr245: + m.cs = 129 + goto f50 + tr195: + m.cs = 130 + goto _again + tr196: + m.cs = 130 + goto f9 + tr237: + m.cs = 131 + goto f31 + tr200: + m.cs = 132 + goto _again + tr201: + m.cs = 132 + goto f9 + tr188: + m.cs = 133 + goto f26 + tr247: + m.cs = 134 + goto f45 + tr184: + m.cs = 135 + goto _again + tr206: + m.cs = 136 + goto f31 + tr248: + m.cs = 136 + goto f50 + tr166: + m.cs = 137 + goto _again + tr164: + m.cs = 138 + goto _again + tr162: + m.cs = 139 + goto _again + tr160: + m.cs = 140 + goto _again + tr158: + m.cs = 141 + goto _again + tr156: + m.cs = 142 + goto _again + tr154: + m.cs = 143 + goto _again + tr152: + m.cs = 144 + goto _again + tr150: + m.cs = 145 + goto _again + tr148: + m.cs = 146 + goto _again + tr146: + m.cs = 147 + goto _again + tr144: + m.cs = 148 + goto _again + tr142: + m.cs = 149 + goto _again + tr140: + m.cs = 150 + goto _again + tr138: + m.cs = 151 + goto _again + tr136: + m.cs = 152 + goto _again + tr134: + m.cs = 153 + goto _again + tr132: + m.cs = 154 + goto _again + tr130: + m.cs = 155 + goto _again + tr128: + m.cs = 156 + goto _again + tr126: + m.cs = 157 + goto _again + tr124: + m.cs = 158 + goto _again + tr122: + m.cs = 159 + goto _again + tr120: + m.cs = 160 + goto _again + tr118: + m.cs = 161 + goto _again + tr116: + m.cs = 162 + goto _again + tr114: + m.cs = 163 + goto _again + tr112: + m.cs = 164 + goto _again + tr110: + m.cs = 165 + goto _again + tr108: + m.cs = 166 + goto _again + tr105: + m.cs = 167 + goto f1 + tr208: + m.cs = 168 + goto _again + tr209: + m.cs = 169 + goto _again + tr210: + m.cs = 170 + goto f2 + tr211: + m.cs = 171 + goto _again + tr212: + m.cs = 172 + goto _again + tr42: + m.cs = 172 + goto f4 + tr47: + m.cs = 173 + goto _again + tr48: + m.cs = 173 + goto f9 + tr214: + m.cs = 174 + goto _again + tr82: + m.cs = 174 + goto f16 + tr216: + m.cs = 175 + goto _again + tr84: + m.cs = 175 + goto f18 + tr89: + m.cs = 176 + goto _again + tr90: + m.cs = 176 + goto f9 + tr218: + m.cs = 177 + goto _again + tr170: + m.cs = 177 + goto f4 + tr219: + m.cs = 178 + goto f38 + tr227: + m.cs = 178 + goto f42 + tr233: + m.cs = 178 + goto f45 + tr239: + m.cs = 178 + goto f48 + tr244: + m.cs = 178 + goto f51 + tr224: + m.cs = 179 + goto _again + tr222: + m.cs = 179 + goto f4 + tr175: + m.cs = 180 + goto _again + tr176: + m.cs = 180 + goto f9 + tr180: + m.cs = 181 + goto _again + tr181: + m.cs = 181 + goto f9 + tr226: + m.cs = 182 + goto _again + tr186: + m.cs = 182 + goto f26 + tr232: + m.cs = 182 + goto f44 + tr192: + m.cs = 183 + goto _again + tr193: + m.cs = 183 + goto f9 + tr229: + m.cs = 184 + goto f42 + tr235: + m.cs = 184 + goto f45 + tr230: + m.cs = 185 + goto _again + tr231: + m.cs = 186 + goto _again + tr238: + m.cs = 187 + goto _again + tr204: + m.cs = 187 + goto f31 + tr243: + m.cs = 187 + goto f50 + tr197: + m.cs = 188 + goto _again + tr198: + m.cs = 188 + goto f9 + tr241: + m.cs = 189 + goto _again + tr246: + m.cs = 189 + goto f50 + tr242: + m.cs = 190 + goto _again + tr202: + m.cs = 191 + goto _again + tr207: + m.cs = 192 + goto _again + tr249: + m.cs = 193 + goto _again + + f4: + + m.pb = m.p + + goto _again + f9: + + // List of positions in the buffer to later lowercase + output.tolower = append(output.tolower, m.p-m.pb) + + goto _again + f2: + + output.prefix = string(m.text()) + + goto _again + f6: + + output.ID = string(m.text()) + + goto _again + f38: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + goto _again + f0: + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f5: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f7: + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f23: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + goto _again + f11: + + m.err = fmt.Errorf(errSCIMNamespace, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f13: + + m.err = fmt.Errorf(errSCIMType, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f15: + + m.err = fmt.Errorf(errSCIMName, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f17: + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f14: + + output.scim.Type = scimschema.TypeFromString(string(m.text())) + + goto _again + f16: + + output.scim.pos = m.p + + goto _again + f35: + + output.scim.Name = string(m.data[output.scim.pos:m.p]) + + goto _again + f18: + + output.scim.pos = m.p + + goto _again + f22: + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f21: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f42: + + output.rComponent = string(m.text()) + + goto _again + f48: + + output.qComponent = string(m.text()) + + goto _again + f44: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + goto _again + f50: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.qStart = true + + goto _again + f25: + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f30: + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f1: + + m.pb = m.p + + if m.parsingMode != RFC8141Only { + // Throw an error when: + // - we are entering here matching the the prefix in the namespace identifier part + // - looking ahead (3 chars) we find a colon + if pos := m.p + 3; pos < m.pe && m.data[pos] == 58 && output.prefix != "" { + m.err = fmt.Errorf(errNoUrnWithinID, pos) + (m.p)-- + + m.cs = 193 + goto _again + + } + } + + goto _again + f12: + + output.ID = string(m.text()) + + output.scim = &SCIM{} + + goto _again + f3: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f10: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errNoUrnWithinID, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f8: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f19: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f24: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f27: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f28: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f20: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f26: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true m.pb = m.p - goto st39 - st39: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof39 - } - stCase39: - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st40 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st40 - } - default: - goto tr46 - } - goto tr44 - tr46: + goto _again + f45: - m.tolower = append(m.tolower, m.p-m.pb) + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again - goto st40 - st40: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof40 - } - stCase40: - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st45 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st45 - } - default: - goto tr48 } - goto tr44 - tr48: + output.rStart = true - m.tolower = append(m.tolower, m.p-m.pb) + output.rComponent = string(m.text()) + + goto _again + f31: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again - goto st45 - st45: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof45 - } - stCase45: - switch (m.data)[(m.p)] { - case 33: - goto st44 - case 36: - goto st44 - case 37: - goto st39 - case 61: - goto st44 - case 95: - goto st44 - } - switch { - case (m.data)[(m.p)] < 48: - if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { - goto st44 - } - case (m.data)[(m.p)] > 59: - switch { - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st44 - } - case (m.data)[(m.p)] >= 64: - goto st44 - } - default: - goto st44 } - goto tr44 - tr8: + output.qStart = true m.pb = m.p - goto st41 - st41: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof41 - } - stCase41: - switch (m.data)[(m.p)] { - case 45: - goto st7 - case 58: - goto tr10 - case 82: - goto st42 - case 114: - goto st42 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st7 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st7 - } - default: - goto st7 - } - goto tr6 - st42: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof42 - } - stCase42: - switch (m.data)[(m.p)] { - case 45: - goto st8 - case 58: - goto tr10 - case 78: - goto st43 - case 110: - goto st43 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st8 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st8 - } - default: - goto st8 - } - goto tr50 - st43: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof43 + goto _again + f51: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - stCase43: - if (m.data)[(m.p)] == 45 { - goto st9 + output.qStart = true + + output.qComponent = string(m.text()) + + goto _again + f46: + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f29: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st9 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st9 - } - default: - goto st9 + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + + _again: + switch _toStateActions[m.cs] { + case 33: + + (m.p)-- + + m.err = fmt.Errorf(err8141InformalID, m.p) + m.cs = 193 + goto _again } - goto tr52 - st46: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof46 + + if m.cs == 0 { + goto _out } - stCase46: - switch (m.data)[(m.p)] { - case 10: - goto st0 - case 13: - goto st0 + if (m.p)++; (m.p) != (m.pe) { + goto _resume } - goto st46 - stOut: - _testEof2: - m.cs = 2 - goto _testEof - _testEof3: - m.cs = 3 - goto _testEof - _testEof4: - m.cs = 4 - goto _testEof - _testEof5: - m.cs = 5 - goto _testEof - _testEof6: - m.cs = 6 - goto _testEof - _testEof7: - m.cs = 7 - goto _testEof - _testEof8: - m.cs = 8 - goto _testEof - _testEof9: - m.cs = 9 - goto _testEof - _testEof10: - m.cs = 10 - goto _testEof - _testEof11: - m.cs = 11 - goto _testEof - _testEof12: - m.cs = 12 - goto _testEof - _testEof13: - m.cs = 13 - goto _testEof - _testEof14: - m.cs = 14 - goto _testEof - _testEof15: - m.cs = 15 - goto _testEof - _testEof16: - m.cs = 16 - goto _testEof - _testEof17: - m.cs = 17 - goto _testEof - _testEof18: - m.cs = 18 - goto _testEof - _testEof19: - m.cs = 19 - goto _testEof - _testEof20: - m.cs = 20 - goto _testEof - _testEof21: - m.cs = 21 - goto _testEof - _testEof22: - m.cs = 22 - goto _testEof - _testEof23: - m.cs = 23 - goto _testEof - _testEof24: - m.cs = 24 - goto _testEof - _testEof25: - m.cs = 25 - goto _testEof - _testEof26: - m.cs = 26 - goto _testEof - _testEof27: - m.cs = 27 - goto _testEof - _testEof28: - m.cs = 28 - goto _testEof - _testEof29: - m.cs = 29 - goto _testEof - _testEof30: - m.cs = 30 - goto _testEof - _testEof31: - m.cs = 31 - goto _testEof - _testEof32: - m.cs = 32 - goto _testEof - _testEof33: - m.cs = 33 - goto _testEof - _testEof34: - m.cs = 34 - goto _testEof - _testEof35: - m.cs = 35 - goto _testEof - _testEof36: - m.cs = 36 - goto _testEof - _testEof37: - m.cs = 37 - goto _testEof - _testEof38: - m.cs = 38 - goto _testEof - _testEof44: - m.cs = 44 - goto _testEof - _testEof39: - m.cs = 39 - goto _testEof - _testEof40: - m.cs = 40 - goto _testEof - _testEof45: - m.cs = 45 - goto _testEof - _testEof41: - m.cs = 41 - goto _testEof - _testEof42: - m.cs = 42 - goto _testEof - _testEof43: - m.cs = 43 - goto _testEof - _testEof46: - m.cs = 46 - goto _testEof - _testEof: { } if (m.p) == (m.eof) { - switch m.cs { - case 44, 45: + switch _eofActions[m.cs] { + case 1: - raw := m.text() - output.SS = string(raw) - // Iterate upper letters lowering them - for _, i := range m.tolower { - raw[i] = raw[i] + 32 - } - output.norm = string(raw) + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again - case 1, 2, 4: + case 6: - m.err = fmt.Errorf(errParse, m.p) + m.err = fmt.Errorf(errIdentifier, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 3: + case 8: - m.err = fmt.Errorf(errPrefix, m.p) + m.err = fmt.Errorf(errSpecificString, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 24: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errParse, m.p) + case 12: + + m.err = fmt.Errorf(errSCIMNamespace, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 41: + case 14: - m.err = fmt.Errorf(errIdentifier, m.p) + m.err = fmt.Errorf(errSCIMType, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - m.err = fmt.Errorf(errParse, m.p) + case 16: + + m.err = fmt.Errorf(errSCIMName, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 18: + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) } + (m.p)-- - case 38: + m.cs = 193 + goto _again - m.err = fmt.Errorf(errSpecificString, m.p) + case 23: + + m.err = fmt.Errorf(err8141SpecificString, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - m.err = fmt.Errorf(errParse, m.p) + case 22: + + m.err = fmt.Errorf(err8141Identifier, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 42: + case 26: - m.err = fmt.Errorf(errPrefix, m.p) + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 31: + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 34: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC2141 + + case 38: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC8141 + + case 4: m.err = fmt.Errorf(errIdentifier, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - m.err = fmt.Errorf(errParse, m.p) + m.err = fmt.Errorf(errPrefix, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 43: + case 11: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again m.err = fmt.Errorf(errNoUrnWithinID, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 9: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errIdentifier, m.p) + m.err = fmt.Errorf(errSpecificString, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 20: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errParse, m.p) + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 25: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - case 39, 40: + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 28: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } - m.err = fmt.Errorf(errHex, m.p) + m.err = fmt.Errorf(err8141MalformedRComp, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 29: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errSpecificString, m.p) + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 21: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 42: + + output.rComponent = string(m.text()) + + output.kind = RFC8141 + + case 48: + + output.qComponent = string(m.text()) + + output.kind = RFC8141 + + case 41: + + output.fComponent = string(m.text()) + + output.kind = RFC8141 + + case 40: + + m.pb = m.p + + output.fComponent = string(m.text()) + + output.kind = RFC8141 + + case 30: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errParse, m.p) + m.err = fmt.Errorf(err8141MalformedRComp, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 35: + + output.scim.Name = string(m.data[output.scim.pos:m.p]) + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC7643 + + case 37: + + output.scim.Other = string(m.data[output.scim.pos:m.p]) + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC7643 + + case 44: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + output.rComponent = string(m.text()) + + output.kind = RFC8141 + + case 50: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } + output.qStart = true + output.qComponent = string(m.text()) + + output.kind = RFC8141 } } @@ -1689,3 +5031,16 @@ func (m *machine) Parse(input []byte) (*URN, error) { return output, nil } + +func (m *machine) WithParsingMode(x ParsingMode) { + m.parsingMode = x + switch m.parsingMode { + case RFC2141Only: + m.startParsingAt = enMain + case RFC8141Only: + m.startParsingAt = enRfc8141Only + case RFC7643Only: + m.startParsingAt = enScimOnly + } + m.parsingModeSet = true +} diff --git a/vendor/github.com/leodido/go-urn/machine.go.rl b/vendor/github.com/leodido/go-urn/machine.go.rl index 3bc05a65..0a174219 100644 --- a/vendor/github.com/leodido/go-urn/machine.go.rl +++ b/vendor/github.com/leodido/go-urn/machine.go.rl @@ -2,15 +2,28 @@ package urn import ( "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" ) var ( - errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" - errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its start) [col %d]" - errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" - errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" - errHex = "expecting the specific string hex chars to be well-formed (%%alnum{2}) [col %d]" - errParse = "parsing error [col %d]" + errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" + errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its beginning) [col %d]" + errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" + errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" + errHex = "expecting the percent encoded chars to be well-formed (%%alnum{2}) [col %d]" + errSCIMNamespace = "expecing the SCIM namespace identifier (ietf:params:scim) [col %d]" + errSCIMType = "expecting a correct SCIM type (schemas, api, param) [col %d]" + errSCIMName = "expecting one or more alnum char in the SCIM name part [col %d]" + errSCIMOther = "expecting a well-formed other SCIM part [col %d]" + errSCIMOtherIncomplete = "expecting a not empty SCIM other part after colon [col %d]" + err8141InformalID = "informal URN namespace must be in the form urn-[1-9][0-9] [col %d]" + err8141SpecificString = "expecting the specific string to contain alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] not in first position) chars [col %d]" + err8141Identifier = "expecting the indentifier to be a string with (length 2 to 32 chars) containing alnum (or dashes) not starting or ending with a dash [col %d]" + err8141RComponentStart = "expecting only one r-component (starting with the ?+ sequence) [col %d]" + err8141QComponentStart = "expecting only one q-component (starting with the ?= sequence) [col %d]" + err8141MalformedRComp = "expecting a non-empty r-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" + err8141MalformedQComp = "expecting a non-empty q-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" ) %%{ @@ -24,25 +37,42 @@ action mark { } action tolower { - m.tolower = append(m.tolower, m.p - m.pb) + // List of positions in the buffer to later lowercase + output.tolower = append(output.tolower, m.p - m.pb) } action set_pre { output.prefix = string(m.text()) } +action throw_pre_urn_err { + if m.parsingMode != RFC8141Only { + // Throw an error when: + // - we are entering here matching the the prefix in the namespace identifier part + // - looking ahead (3 chars) we find a colon + if pos := m.p + 3; pos < m.pe && m.data[pos] == 58 && output.prefix != "" { + m.err = fmt.Errorf(errNoUrnWithinID, pos) + fhold; + fgoto fail; + } + } +} + action set_nid { output.ID = string(m.text()) } action set_nss { - raw := m.text() - output.SS = string(raw) + output.SS = string(m.text()) // Iterate upper letters lowering them - for _, i := range m.tolower { - raw[i] = raw[i] + 32 + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 } - output.norm = string(raw) } action err_pre { @@ -70,30 +100,200 @@ action err_urn { } action err_hex { - m.err = fmt.Errorf(errHex, m.p) + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + fhold; + fgoto fail; + } +} + +action base_type { + output.kind = RFC2141; +} + +pre = ([uU] @err(err_pre) [rR] @err(err_pre) [nN] @err(err_pre)) >mark >throw_pre_urn_err %set_pre; + +nid = (alnum >mark (alnum | '-'){0,31}) $err(err_nid) %set_nid; + +hex = '%' (digit | lower | upper >tolower){2} $err(err_hex); + +sss = (alnum | [()+,\-.:=@;$_!*']); + +nss = (sss | hex)+ $err(err_nss); + +nid_not_urn = (nid - pre %err(err_urn)); + +urn = pre ':' @err(err_pre) (nid_not_urn ':' nss >mark %set_nss) %eof(base_type); + +### SCIM BEG + +action err_scim_nid { + m.err = fmt.Errorf(errSCIMNamespace, m.p) fhold; fgoto fail; } -action err_parse { - m.err = fmt.Errorf(errParse, m.p) +action err_scim_type { + m.err = fmt.Errorf(errSCIMType, m.p) fhold; fgoto fail; } -pre = ([uU][rR][nN] @err(err_pre)) >mark %set_pre; +action err_scim_name { + m.err = fmt.Errorf(errSCIMName, m.p) + fhold; + fgoto fail; +} -nid = (alnum >mark (alnum | '-'){0,31}) %set_nid; +action err_scim_other { + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + fhold; + fgoto fail; +} -hex = '%' (digit | lower | upper >tolower){2} $err(err_hex); +action scim_type { + output.kind = RFC7643; +} -sss = (alnum | [()+,\-.:=@;$_!*']); +action create_scim { + output.scim = &SCIM{}; +} -nss = (sss | hex)+ $err(err_nss); +action set_scim_type { + output.scim.Type = scimschema.TypeFromString(string(m.text())) +} + +action mark_scim_name { + output.scim.pos = m.p +} + +action set_scim_name { + output.scim.Name = string(m.data[output.scim.pos:m.p]) +} + +action mark_scim_other { + output.scim.pos = m.p +} + +action set_scim_other { + output.scim.Other = string(m.data[output.scim.pos:m.p]) +} + +scim_nid = 'ietf:params:scim' >mark %set_nid %create_scim $err(err_scim_nid); + +scim_other = ':' (sss | hex)+ >mark_scim_other %set_scim_other $err(err_scim_other); + +scim_name = (alnum)+ >mark_scim_name %set_scim_name $err(err_scim_name); + +scim_type = ('schemas' | 'api' | 'param') >mark %set_scim_type $err(err_scim_type); + +scim_only := pre ':' @err(err_pre) (scim_nid ':' scim_type ':' scim_name scim_other? %set_nss) %eof(scim_type); + +### SCIM END + +### 8141 BEG + +action err_nss_8141 { + m.err = fmt.Errorf(err8141SpecificString, m.p) + fhold; + fgoto fail; +} + +action err_nid_8141 { + m.err = fmt.Errorf(err8141Identifier, m.p) + fhold; + fgoto fail; +} + +action rfc8141_type { + output.kind = RFC8141; +} + +action set_r_component { + output.rComponent = string(m.text()) +} + +action set_q_component { + output.qComponent = string(m.text()) +} + +action set_f_component { + output.fComponent = string(m.text()) +} + +action informal_nid_match { + fhold; + m.err = fmt.Errorf(err8141InformalID, m.p); + fgoto fail; +} + +action mark_r_start { + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + fhold; + fgoto fail; + } + output.rStart = true +} + +action mark_q_start { + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + fhold; + fgoto fail; + } + output.qStart = true +} + +action err_malformed_r_component { + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + fhold; + fgoto fail; +} + +action err_malformed_q_component { + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + fhold; + fgoto fail; +} + +pchar = (sss | '~' | '&' | hex); + +component = pchar (pchar | '/' | '?')*; + +r_start = ('?+') %mark_r_start; + +r_component = r_start <: (r_start | component)+ $err(err_malformed_r_component) >mark %set_r_component; + +q_start = ('?=') %mark_q_start; + +q_component = q_start <: (q_start | component)+ $err(err_malformed_q_component) >mark %set_q_component; + +rq_components = (r_component :>> q_component? | q_component); + +fragment = (pchar | '/' | '?')*; + +f_component = '#' fragment >mark %set_f_component; + +nss_rfc8141 = (pchar >mark (pchar | '/')*) $err(err_nss_8141) %set_nss; + +nid_rfc8141 = (alnum >mark (alnum | '-'){0,30} alnum) $err(err_nid_8141) %set_nid; + +informal_id = pre ('-' [a-zA-z0] %to(informal_nid_match)); + +nid_rfc8141_not_urn = (nid_rfc8141 - informal_id?); + +rfc8141_only := pre ':' @err(err_pre) nid_rfc8141_not_urn ':' nss_rfc8141 rq_components? f_component? %eof(rfc8141_type); + +### 8141 END fail := (any - [\n\r])* @err{ fgoto main; }; -main := (pre ':' (nid - pre %err(err_urn)) $err(err_nid) ':' nss >mark %set_nss) $err(err_parse); +main := urn; }%% @@ -103,6 +303,7 @@ main := (pre ':' (nid - pre %err(err_urn)) $err(err_nid) ':' nss >mark %set_nss) type Machine interface { Error() error Parse(input []byte) (*URN, error) + WithParsingMode(ParsingMode) } type machine struct { @@ -110,12 +311,24 @@ type machine struct { cs int p, pe, eof, pb int err error - tolower []int + startParsingAt int + parsingMode ParsingMode + parsingModeSet bool } // NewMachine creates a new FSM able to parse RFC 2141 strings. -func NewMachine() Machine { - m := &machine{} +func NewMachine(options ...Option) Machine { + m := &machine{ + parsingModeSet: false, + } + + for _, o := range options { + o(m) + } + // Set default parsing mode + if !m.parsingModeSet { + m.WithParsingMode(DefaultParsingMode) + } %% access m.; %% variable p m.p; @@ -137,7 +350,7 @@ func (m *machine) text() []byte { return m.data[m.pb:m.p] } -// Parse parses the input byte array as a RFC 2141 string. +// Parse parses the input byte array as a RFC 2141 or RFC7643 string. func (m *machine) Parse(input []byte) (*URN, error) { m.data = input m.p = 0 @@ -145,10 +358,11 @@ func (m *machine) Parse(input []byte) (*URN, error) { m.pe = len(input) m.eof = len(input) m.err = nil - m.tolower = []int{} - output := &URN{} + m.cs = m.startParsingAt + output := &URN{ + tolower: []int{}, + } - %% write init; %% write exec; if m.cs < first_final || m.cs == en_fail { @@ -157,3 +371,16 @@ func (m *machine) Parse(input []byte) (*URN, error) { return output, nil } + +func (m *machine) WithParsingMode(x ParsingMode) { + m.parsingMode = x + switch m.parsingMode { + case RFC2141Only: + m.startParsingAt = en_main + case RFC8141Only: + m.startParsingAt = en_rfc8141_only + case RFC7643Only: + m.startParsingAt = en_scim_only + } + m.parsingModeSet = true +} \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/makefile b/vendor/github.com/leodido/go-urn/makefile index 47026d50..68d5dd0f 100644 --- a/vendor/github.com/leodido/go-urn/makefile +++ b/vendor/github.com/leodido/go-urn/makefile @@ -1,18 +1,43 @@ SHELL := /bin/bash +RAGEL := ragel +GOFMT := go fmt +export GO_TEST=env GOTRACEBACK=all go test $(GO_ARGS) + +.PHONY: build build: machine.go +.PHONY: clean +clean: + @rm -rf docs + @rm -f machine.go + +.PHONY: images images: docs/urn.png +.PHONY: snake2camel +snake2camel: + @cd ./tools/snake2camel; go build -o ../../snake2camel . + +.PHONY: removecomments +removecomments: + @cd ./tools/removecomments; go build -o ../../removecomments . + machine.go: machine.go.rl - ragel -Z -G2 -e -o $@ $< - @sed -i '/^\/\/line/d' $@ - @$(MAKE) -s file=$@ snake2camel - @gofmt -w -s $@ + +machine.go: snake2camel + +machine.go: removecomments + +machine.go: + $(RAGEL) -Z -G1 -e -o $@ $< + @./removecomments $@ + @./snake2camel $@ + $(GOFMT) $@ docs/urn.dot: machine.go.rl @mkdir -p docs - ragel -Z -e -Vp $< -o $@ + $(RAGEL) -Z -e -Vp $< -o $@ docs/urn.png: docs/urn.dot dot $< -Tpng -o $@ @@ -22,18 +47,5 @@ bench: *_test.go machine.go go test -bench=. -benchmem -benchtime=5s ./... .PHONY: tests -tests: *_test.go machine.go - go test -race -timeout 10s -coverprofile=coverage.out -covermode=atomic -v ./... - -.PHONY: clean -clean: - @rm -rf docs - @rm -f machine.go - -.PHONY: snake2camel -snake2camel: - @awk -i inplace '{ \ - while ( match($$0, /(.*)([a-z]+[0-9]*)_([a-zA-Z0-9])(.*)/, cap) ) \ - $$0 = cap[1] cap[2] toupper(cap[3]) cap[4]; \ - print \ - }' $(file) \ No newline at end of file +tests: *_test.go + $(GO_TEST) ./... diff --git a/vendor/github.com/leodido/go-urn/options.go b/vendor/github.com/leodido/go-urn/options.go new file mode 100644 index 00000000..c543835a --- /dev/null +++ b/vendor/github.com/leodido/go-urn/options.go @@ -0,0 +1,9 @@ +package urn + +type Option func(Machine) + +func WithParsingMode(mode ParsingMode) Option { + return func(m Machine) { + m.WithParsingMode(mode) + } +} diff --git a/vendor/github.com/leodido/go-urn/parsing_mode.go b/vendor/github.com/leodido/go-urn/parsing_mode.go new file mode 100644 index 00000000..fce5aadc --- /dev/null +++ b/vendor/github.com/leodido/go-urn/parsing_mode.go @@ -0,0 +1,12 @@ +package urn + +type ParsingMode int + +const ( + Default ParsingMode = iota + RFC2141Only + RFC7643Only + RFC8141Only +) + +const DefaultParsingMode = RFC2141Only diff --git a/vendor/github.com/leodido/go-urn/scim.go b/vendor/github.com/leodido/go-urn/scim.go new file mode 100644 index 00000000..f6b7aefb --- /dev/null +++ b/vendor/github.com/leodido/go-urn/scim.go @@ -0,0 +1,48 @@ +package urn + +import ( + "encoding/json" + "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" +) + +const errInvalidSCIMURN = "invalid SCIM URN: %s" + +type SCIM struct { + Type scimschema.Type + Name string + Other string + pos int +} + +func (s SCIM) MarshalJSON() ([]byte, error) { + return json.Marshal(s.String()) +} + +func (s *SCIM) UnmarshalJSON(bytes []byte) error { + var str string + if err := json.Unmarshal(bytes, &str); err != nil { + return err + } + // Parse as SCIM + value, ok := Parse([]byte(str), WithParsingMode(RFC7643Only)) + if !ok { + return fmt.Errorf(errInvalidSCIMURN, str) + } + if value.RFC() != RFC7643 { + return fmt.Errorf(errInvalidSCIMURN, str) + } + *s = *value.SCIM() + + return nil +} + +func (s *SCIM) String() string { + ret := fmt.Sprintf("urn:ietf:params:scim:%s:%s", s.Type.String(), s.Name) + if s.Other != "" { + ret += fmt.Sprintf(":%s", s.Other) + } + + return ret +} diff --git a/vendor/github.com/leodido/go-urn/scim/schema/type.go b/vendor/github.com/leodido/go-urn/scim/schema/type.go new file mode 100644 index 00000000..13491823 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/scim/schema/type.go @@ -0,0 +1,36 @@ +package scimschema + +type Type int + +const ( + Unsupported Type = iota + Schemas + API + Param +) + +func (t Type) String() string { + switch t { + case Schemas: + return "schemas" + case API: + return "api" + case Param: + return "param" + } + + return "" +} + +func TypeFromString(input string) Type { + switch input { + case "schemas": + return Schemas + case "api": + return API + case "param": + return Param + } + + return Unsupported +} diff --git a/vendor/github.com/leodido/go-urn/urn.go b/vendor/github.com/leodido/go-urn/urn.go index d51a6c91..894d6258 100644 --- a/vendor/github.com/leodido/go-urn/urn.go +++ b/vendor/github.com/leodido/go-urn/urn.go @@ -16,10 +16,18 @@ const errInvalidURN = "invalid URN: %s" // // Details at https://tools.ietf.org/html/rfc2141. type URN struct { - prefix string // Static prefix. Equal to "urn" when empty. - ID string // Namespace identifier - SS string // Namespace specific string - norm string // Normalized namespace specific string + prefix string // Static prefix. Equal to "urn" when empty. + ID string // Namespace identifier (NID) + SS string // Namespace specific string (NSS) + norm string // Normalized namespace specific string + kind Kind + scim *SCIM + rComponent string // RFC8141 + qComponent string // RFC8141 + fComponent string // RFC8141 + rStart bool // RFC8141 + qStart bool // RFC8141 + tolower []int } // Normalize turns the receiving URN into its norm version. @@ -30,12 +38,21 @@ func (u *URN) Normalize() *URN { prefix: "urn", ID: strings.ToLower(u.ID), SS: u.norm, + // rComponent: u.rComponent, + // qComponent: u.qComponent, + // fComponent: u.fComponent, } } // Equal checks the lexical equivalence of the current URN with another one. func (u *URN) Equal(x *URN) bool { - return *u.Normalize() == *x.Normalize() + if x == nil { + return false + } + nu := u.Normalize() + nx := x.Normalize() + + return nu.prefix == nx.prefix && nu.ID == nx.ID && nu.SS == nx.SS } // String reassembles the URN into a valid URN string. @@ -51,14 +68,23 @@ func (u *URN) String() string { res += "urn" } res += u.prefix + ":" + u.ID + ":" + u.SS + if u.rComponent != "" { + res += "?+" + u.rComponent + } + if u.qComponent != "" { + res += "?=" + u.qComponent + } + if u.fComponent != "" { + res += "#" + u.fComponent + } } return res } -// Parse is responsible to create an URN instance from a byte array matching the correct URN syntax. -func Parse(u []byte) (*URN, bool) { - urn, err := NewMachine().Parse(u) +// Parse is responsible to create an URN instance from a byte array matching the correct URN syntax (RFC 2141). +func Parse(u []byte, options ...Option) (*URN, bool) { + urn, err := NewMachine(options...).Parse(u) if err != nil { return nil, false } @@ -71,7 +97,7 @@ func (u URN) MarshalJSON() ([]byte, error) { return json.Marshal(u.String()) } -// MarshalJSON unmarshals a URN from JSON string form (e.g. `"urn:oid:1.2.3.4"`). +// UnmarshalJSON unmarshals a URN from JSON string form (e.g. `"urn:oid:1.2.3.4"`). func (u *URN) UnmarshalJSON(bytes []byte) error { var str string if err := json.Unmarshal(bytes, &str); err != nil { @@ -82,5 +108,34 @@ func (u *URN) UnmarshalJSON(bytes []byte) error { } else { *u = *value } + return nil -} \ No newline at end of file +} + +func (u *URN) IsSCIM() bool { + return u.kind == RFC7643 +} + +func (u *URN) SCIM() *SCIM { + if u.kind != RFC7643 { + return nil + } + + return u.scim +} + +func (u *URN) RFC() Kind { + return u.kind +} + +func (u *URN) FComponent() string { + return u.fComponent +} + +func (u *URN) QComponent() string { + return u.qComponent +} + +func (u *URN) RComponent() string { + return u.rComponent +} diff --git a/vendor/github.com/leodido/go-urn/urn8141.go b/vendor/github.com/leodido/go-urn/urn8141.go new file mode 100644 index 00000000..da4dd062 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/urn8141.go @@ -0,0 +1,30 @@ +package urn + +import ( + "encoding/json" + "fmt" +) + +const errInvalidURN8141 = "invalid URN per RFC 8141: %s" + +type URN8141 struct { + *URN +} + +func (u URN8141) MarshalJSON() ([]byte, error) { + return json.Marshal(u.String()) +} + +func (u *URN8141) UnmarshalJSON(bytes []byte) error { + var str string + if err := json.Unmarshal(bytes, &str); err != nil { + return err + } + if value, ok := Parse([]byte(str), WithParsingMode(RFC8141Only)); !ok { + return fmt.Errorf(errInvalidURN8141, str) + } else { + *u = URN8141{value} + } + + return nil +} diff --git a/vendor/github.com/mattn/go-isatty/isatty_bsd.go b/vendor/github.com/mattn/go-isatty/isatty_bsd.go index d569c0c9..d0ea68f4 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_bsd.go +++ b/vendor/github.com/mattn/go-isatty/isatty_bsd.go @@ -1,6 +1,7 @@ -//go:build (darwin || freebsd || openbsd || netbsd || dragonfly || hurd) && !appengine +//go:build (darwin || freebsd || openbsd || netbsd || dragonfly || hurd) && !appengine && !tinygo // +build darwin freebsd openbsd netbsd dragonfly hurd // +build !appengine +// +build !tinygo package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_others.go b/vendor/github.com/mattn/go-isatty/isatty_others.go index 31503226..7402e061 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_others.go +++ b/vendor/github.com/mattn/go-isatty/isatty_others.go @@ -1,5 +1,6 @@ -//go:build appengine || js || nacl || wasm -// +build appengine js nacl wasm +//go:build (appengine || js || nacl || tinygo || wasm) && !windows +// +build appengine js nacl tinygo wasm +// +build !windows package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go index 67787657..0337d8cf 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go +++ b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go @@ -1,6 +1,7 @@ -//go:build (linux || aix || zos) && !appengine +//go:build (linux || aix || zos) && !appengine && !tinygo // +build linux aix zos // +build !appengine +// +build !tinygo package isatty diff --git a/vendor/github.com/modern-go/concurrent/.gitignore b/vendor/github.com/modern-go/concurrent/.gitignore new file mode 100644 index 00000000..3f2bc474 --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/.gitignore @@ -0,0 +1 @@ +/coverage.txt diff --git a/vendor/github.com/modern-go/concurrent/.travis.yml b/vendor/github.com/modern-go/concurrent/.travis.yml new file mode 100644 index 00000000..449e67cd --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/.travis.yml @@ -0,0 +1,14 @@ +language: go + +go: + - 1.8.x + - 1.x + +before_install: + - go get -t -v ./... + +script: + - ./test.sh + +after_success: + - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/github.com/modern-go/concurrent/README.md b/vendor/github.com/modern-go/concurrent/README.md index 91d6adb3..acab3200 100644 --- a/vendor/github.com/modern-go/concurrent/README.md +++ b/vendor/github.com/modern-go/concurrent/README.md @@ -1,2 +1,49 @@ # concurrent -concurrency utilities + +[![Sourcegraph](https://sourcegraph.com/github.com/modern-go/concurrent/-/badge.svg)](https://sourcegraph.com/github.com/modern-go/concurrent?badge) +[![GoDoc](http://img.shields.io/badge/go-documentation-blue.svg?style=flat-square)](http://godoc.org/github.com/modern-go/concurrent) +[![Build Status](https://travis-ci.org/modern-go/concurrent.svg?branch=master)](https://travis-ci.org/modern-go/concurrent) +[![codecov](https://codecov.io/gh/modern-go/concurrent/branch/master/graph/badge.svg)](https://codecov.io/gh/modern-go/concurrent) +[![rcard](https://goreportcard.com/badge/github.com/modern-go/concurrent)](https://goreportcard.com/report/github.com/modern-go/concurrent) +[![License](https://img.shields.io/badge/License-Apache%202.0-blue.svg)](https://raw.githubusercontent.com/modern-go/concurrent/master/LICENSE) + +* concurrent.Map: backport sync.Map for go below 1.9 +* concurrent.Executor: goroutine with explicit ownership and cancellable + +# concurrent.Map + +because sync.Map is only available in go 1.9, we can use concurrent.Map to make code portable + +```go +m := concurrent.NewMap() +m.Store("hello", "world") +elem, found := m.Load("hello") +// elem will be "world" +// found will be true +``` + +# concurrent.Executor + +```go +executor := concurrent.NewUnboundedExecutor() +executor.Go(func(ctx context.Context) { + everyMillisecond := time.NewTicker(time.Millisecond) + for { + select { + case <-ctx.Done(): + fmt.Println("goroutine exited") + return + case <-everyMillisecond.C: + // do something + } + } +}) +time.Sleep(time.Second) +executor.StopAndWaitForever() +fmt.Println("executor stopped") +``` + +attach goroutine to executor instance, so that we can + +* cancel it by stop the executor with Stop/StopAndWait/StopAndWaitForever +* handle panic by callback: the default behavior will no longer crash your application \ No newline at end of file diff --git a/vendor/github.com/modern-go/concurrent/executor.go b/vendor/github.com/modern-go/concurrent/executor.go index 56e5d22b..623dba1a 100644 --- a/vendor/github.com/modern-go/concurrent/executor.go +++ b/vendor/github.com/modern-go/concurrent/executor.go @@ -2,6 +2,13 @@ package concurrent import "context" +// Executor replace go keyword to start a new goroutine +// the goroutine should cancel itself if the context passed in has been cancelled +// the goroutine started by the executor, is owned by the executor +// we can cancel all executors owned by the executor just by stop the executor itself +// however Executor interface does not Stop method, the one starting and owning executor +// should use the concrete type of executor, instead of this interface. type Executor interface { + // Go starts a new goroutine controlled by the context Go(handler func(ctx context.Context)) -} \ No newline at end of file +} diff --git a/vendor/github.com/modern-go/concurrent/go_above_19.go b/vendor/github.com/modern-go/concurrent/go_above_19.go index a9f25934..aeabf8c4 100644 --- a/vendor/github.com/modern-go/concurrent/go_above_19.go +++ b/vendor/github.com/modern-go/concurrent/go_above_19.go @@ -4,10 +4,12 @@ package concurrent import "sync" +// Map is a wrapper for sync.Map introduced in go1.9 type Map struct { sync.Map } +// NewMap creates a thread safe Map func NewMap() *Map { return &Map{} -} \ No newline at end of file +} diff --git a/vendor/github.com/modern-go/concurrent/go_below_19.go b/vendor/github.com/modern-go/concurrent/go_below_19.go index 3f79f4fe..b9c8df7f 100644 --- a/vendor/github.com/modern-go/concurrent/go_below_19.go +++ b/vendor/github.com/modern-go/concurrent/go_below_19.go @@ -4,17 +4,20 @@ package concurrent import "sync" +// Map implements a thread safe map for go version below 1.9 using mutex type Map struct { lock sync.RWMutex data map[interface{}]interface{} } +// NewMap creates a thread safe map func NewMap() *Map { return &Map{ data: make(map[interface{}]interface{}, 32), } } +// Load is same as sync.Map Load func (m *Map) Load(key interface{}) (elem interface{}, found bool) { m.lock.RLock() elem, found = m.data[key] @@ -22,9 +25,9 @@ func (m *Map) Load(key interface{}) (elem interface{}, found bool) { return } +// Load is same as sync.Map Store func (m *Map) Store(key interface{}, elem interface{}) { m.lock.Lock() m.data[key] = elem m.lock.Unlock() } - diff --git a/vendor/github.com/modern-go/concurrent/log.go b/vendor/github.com/modern-go/concurrent/log.go new file mode 100644 index 00000000..9756fcc7 --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/log.go @@ -0,0 +1,13 @@ +package concurrent + +import ( + "os" + "log" + "io/ioutil" +) + +// ErrorLogger is used to print out error, can be set to writer other than stderr +var ErrorLogger = log.New(os.Stderr, "", 0) + +// InfoLogger is used to print informational message, default to off +var InfoLogger = log.New(ioutil.Discard, "", 0) \ No newline at end of file diff --git a/vendor/github.com/modern-go/concurrent/test.sh b/vendor/github.com/modern-go/concurrent/test.sh new file mode 100644 index 00000000..d1e6b2ec --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/test.sh @@ -0,0 +1,12 @@ +#!/usr/bin/env bash + +set -e +echo "" > coverage.txt + +for d in $(go list ./... | grep -v vendor); do + go test -coverprofile=profile.out -coverpkg=github.com/modern-go/concurrent $d + if [ -f profile.out ]; then + cat profile.out >> coverage.txt + rm profile.out + fi +done diff --git a/vendor/github.com/modern-go/concurrent/unbounded_executor.go b/vendor/github.com/modern-go/concurrent/unbounded_executor.go index 70a1cf0f..05a77dce 100644 --- a/vendor/github.com/modern-go/concurrent/unbounded_executor.go +++ b/vendor/github.com/modern-go/concurrent/unbounded_executor.go @@ -4,33 +4,37 @@ import ( "context" "fmt" "runtime" + "runtime/debug" "sync" "time" - "runtime/debug" + "reflect" ) -var LogInfo = func(event string, properties ...interface{}) { -} - -var LogPanic = func(recovered interface{}, properties ...interface{}) interface{} { - fmt.Println(fmt.Sprintf("paniced: %v", recovered)) - debug.PrintStack() - return recovered +// HandlePanic logs goroutine panic by default +var HandlePanic = func(recovered interface{}, funcName string) { + ErrorLogger.Println(fmt.Sprintf("%s panic: %v", funcName, recovered)) + ErrorLogger.Println(string(debug.Stack())) } -const StopSignal = "STOP!" - +// UnboundedExecutor is a executor without limits on counts of alive goroutines +// it tracks the goroutine started by it, and can cancel them when shutdown type UnboundedExecutor struct { ctx context.Context cancel context.CancelFunc activeGoroutinesMutex *sync.Mutex activeGoroutines map[string]int + HandlePanic func(recovered interface{}, funcName string) } // GlobalUnboundedExecutor has the life cycle of the program itself // any goroutine want to be shutdown before main exit can be started from this executor +// GlobalUnboundedExecutor expects the main function to call stop +// it does not magically knows the main function exits var GlobalUnboundedExecutor = NewUnboundedExecutor() +// NewUnboundedExecutor creates a new UnboundedExecutor, +// UnboundedExecutor can not be created by &UnboundedExecutor{} +// HandlePanic can be set with a callback to override global HandlePanic func NewUnboundedExecutor() *UnboundedExecutor { ctx, cancel := context.WithCancel(context.TODO()) return &UnboundedExecutor{ @@ -41,8 +45,13 @@ func NewUnboundedExecutor() *UnboundedExecutor { } } +// Go starts a new goroutine and tracks its lifecycle. +// Panic will be recovered and logged automatically, except for StopSignal func (executor *UnboundedExecutor) Go(handler func(ctx context.Context)) { - _, file, line, _ := runtime.Caller(1) + pc := reflect.ValueOf(handler).Pointer() + f := runtime.FuncForPC(pc) + funcName := f.Name() + file, line := f.FileLine(pc) executor.activeGoroutinesMutex.Lock() defer executor.activeGoroutinesMutex.Unlock() startFrom := fmt.Sprintf("%s:%d", file, line) @@ -50,46 +59,57 @@ func (executor *UnboundedExecutor) Go(handler func(ctx context.Context)) { go func() { defer func() { recovered := recover() - if recovered != nil && recovered != StopSignal { - LogPanic(recovered) + // if you want to quit a goroutine without trigger HandlePanic + // use runtime.Goexit() to quit + if recovered != nil { + if executor.HandlePanic == nil { + HandlePanic(recovered, funcName) + } else { + executor.HandlePanic(recovered, funcName) + } } executor.activeGoroutinesMutex.Lock() - defer executor.activeGoroutinesMutex.Unlock() executor.activeGoroutines[startFrom] -= 1 + executor.activeGoroutinesMutex.Unlock() }() handler(executor.ctx) }() } +// Stop cancel all goroutines started by this executor without wait func (executor *UnboundedExecutor) Stop() { executor.cancel() } +// StopAndWaitForever cancel all goroutines started by this executor and +// wait until all goroutines exited func (executor *UnboundedExecutor) StopAndWaitForever() { executor.StopAndWait(context.Background()) } +// StopAndWait cancel all goroutines started by this executor and wait. +// Wait can be cancelled by the context passed in. func (executor *UnboundedExecutor) StopAndWait(ctx context.Context) { executor.cancel() for { - fiveSeconds := time.NewTimer(time.Millisecond * 100) + oneHundredMilliseconds := time.NewTimer(time.Millisecond * 100) select { - case <-fiveSeconds.C: + case <-oneHundredMilliseconds.C: + if executor.checkNoActiveGoroutines() { + return + } case <-ctx.Done(): return } - if executor.checkGoroutines() { - return - } } } -func (executor *UnboundedExecutor) checkGoroutines() bool { +func (executor *UnboundedExecutor) checkNoActiveGoroutines() bool { executor.activeGoroutinesMutex.Lock() defer executor.activeGoroutinesMutex.Unlock() for startFrom, count := range executor.activeGoroutines { if count > 0 { - LogInfo("event!unbounded_executor.still waiting goroutines to quit", + InfoLogger.Println("UnboundedExecutor is still waiting goroutines to quit", "startFrom", startFrom, "count", count) return false diff --git a/vendor/github.com/pelletier/go-toml/v2/.gitignore b/vendor/github.com/pelletier/go-toml/v2/.gitignore index a69e2b0e..4b7c4eda 100644 --- a/vendor/github.com/pelletier/go-toml/v2/.gitignore +++ b/vendor/github.com/pelletier/go-toml/v2/.gitignore @@ -3,4 +3,5 @@ fuzz/ cmd/tomll/tomll cmd/tomljson/tomljson cmd/tomltestgen/tomltestgen -dist \ No newline at end of file +dist +tests/ diff --git a/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml b/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml index 793fb184..ec52857a 100644 --- a/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml +++ b/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml @@ -1,3 +1,4 @@ +version: 2 before: hooks: - go mod tidy @@ -16,7 +17,12 @@ builds: mod_timestamp: '{{ .CommitTimestamp }}' targets: - linux_amd64 + - linux_arm64 + - linux_arm + - linux_riscv64 - windows_amd64 + - windows_arm64 + - windows_arm - darwin_amd64 - darwin_arm64 - id: tomljson @@ -31,7 +37,12 @@ builds: mod_timestamp: '{{ .CommitTimestamp }}' targets: - linux_amd64 + - linux_arm64 + - linux_arm + - linux_riscv64 - windows_amd64 + - windows_arm64 + - windows_arm - darwin_amd64 - darwin_arm64 - id: jsontoml @@ -46,7 +57,12 @@ builds: mod_timestamp: '{{ .CommitTimestamp }}' targets: - linux_amd64 + - linux_arm64 + - linux_riscv64 + - linux_arm - windows_amd64 + - windows_arm64 + - windows_arm - darwin_amd64 - darwin_arm64 universal_binaries: diff --git a/vendor/github.com/pelletier/go-toml/v2/CONTRIBUTING.md b/vendor/github.com/pelletier/go-toml/v2/CONTRIBUTING.md index 04dd12bc..96ecf9e2 100644 --- a/vendor/github.com/pelletier/go-toml/v2/CONTRIBUTING.md +++ b/vendor/github.com/pelletier/go-toml/v2/CONTRIBUTING.md @@ -165,25 +165,22 @@ Checklist: ### New release -1. Decide on the next version number. Use semver. -2. Generate release notes using [`gh`][gh]. Example: +1. Decide on the next version number. Use semver. Review commits since last + version to assess. +2. Tag release. For example: ``` -$ gh api -X POST \ - -F tag_name='v2.0.0-beta.5' \ - -F target_commitish='v2' \ - -F previous_tag_name='v2.0.0-beta.4' \ - --jq '.body' \ - repos/pelletier/go-toml/releases/generate-notes +git checkout v2 +git pull +git tag v2.2.0 +git push --tags ``` -3. Look for "Other changes". That would indicate a pull request not labeled - properly. Tweak labels and pull request titles until changelog looks good for - users. -4. [Draft new release][new-release]. -5. Fill tag and target with the same value used to generate the changelog. -6. Set title to the new tag value. -7. Paste the generated changelog. -8. Check "create discussion", in the "Releases" category. -9. Check pre-release if new version is an alpha or beta. +3. CI automatically builds a draft Github release. Review it and edit as + necessary. Look for "Other changes". That would indicate a pull request not + labeled properly. Tweak labels and pull request titles until changelog looks + good for users. +4. Check "create discussion" box, in the "Releases" category. +5. If new version is an alpha or beta only, check pre-release box. + [issues-tracker]: https://github.com/pelletier/go-toml/issues [bug-report]: https://github.com/pelletier/go-toml/issues/new?template=bug_report.md diff --git a/vendor/github.com/pelletier/go-toml/v2/LICENSE b/vendor/github.com/pelletier/go-toml/v2/LICENSE index 6839d51c..991e2ae9 100644 --- a/vendor/github.com/pelletier/go-toml/v2/LICENSE +++ b/vendor/github.com/pelletier/go-toml/v2/LICENSE @@ -1,6 +1,7 @@ The MIT License (MIT) -Copyright (c) 2013 - 2022 Thomas Pelletier, Eric Anderton +go-toml v2 +Copyright (c) 2021 - 2023 Thomas Pelletier Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/github.com/pelletier/go-toml/v2/README.md b/vendor/github.com/pelletier/go-toml/v2/README.md index a63c3a79..0755e556 100644 --- a/vendor/github.com/pelletier/go-toml/v2/README.md +++ b/vendor/github.com/pelletier/go-toml/v2/README.md @@ -45,16 +45,15 @@ to check for typos. [See example in the documentation][strict]. ### Contextualized errors -When most decoding errors occur, go-toml returns [`DecodeError`][decode-err]), +When most decoding errors occur, go-toml returns [`DecodeError`][decode-err], which contains a human readable contextualized version of the error. For example: ``` -2| key1 = "value1" -3| key2 = "missing2" - | ~~~~ missing field -4| key3 = "missing3" -5| key4 = "value4" +1| [server] +2| path = 100 + | ~~~ cannot decode TOML integer into struct field toml_test.Server.Path of type string +3| port = 50 ``` [decode-err]: https://pkg.go.dev/github.com/pelletier/go-toml/v2#DecodeError @@ -73,15 +72,35 @@ representation. [tlt]: https://pkg.go.dev/github.com/pelletier/go-toml/v2#LocalTime [tldt]: https://pkg.go.dev/github.com/pelletier/go-toml/v2#LocalDateTime +### Commented config + +Since TOML is often used for configuration files, go-toml can emit documents +annotated with [comments and commented-out values][comments-example]. For +example, it can generate the following file: + +```toml +# Host IP to connect to. +host = '127.0.0.1' +# Port of the remote server. +port = 4242 + +# Encryption parameters (optional) +# [TLS] +# cipher = 'AEAD-AES128-GCM-SHA256' +# version = 'TLS 1.3' +``` + +[comments-example]: https://pkg.go.dev/github.com/pelletier/go-toml/v2#example-Marshal-Commented + ## Getting started Given the following struct, let's see how to read it and write it as TOML: ```go type MyConfig struct { - Version int - Name string - Tags []string + Version int + Name string + Tags []string } ``` @@ -100,7 +119,7 @@ tags = ["go", "toml"] var cfg MyConfig err := toml.Unmarshal([]byte(doc), &cfg) if err != nil { - panic(err) + panic(err) } fmt.Println("version:", cfg.Version) fmt.Println("name:", cfg.Name) @@ -121,14 +140,14 @@ as a TOML document: ```go cfg := MyConfig{ - Version: 2, - Name: "go-toml", - Tags: []string{"go", "toml"}, + Version: 2, + Name: "go-toml", + Tags: []string{"go", "toml"}, } b, err := toml.Marshal(cfg) if err != nil { - panic(err) + panic(err) } fmt.Println(string(b)) @@ -140,22 +159,33 @@ fmt.Println(string(b)) [marshal]: https://pkg.go.dev/github.com/pelletier/go-toml/v2#Marshal +## Unstable API + +This API does not yet follow the backward compatibility guarantees of this +library. They provide early access to features that may have rough edges or an +API subject to change. + +### Parser + +Parser is the unstable API that allows iterative parsing of a TOML document at +the AST level. See https://pkg.go.dev/github.com/pelletier/go-toml/v2/unstable. + ## Benchmarks Execution time speedup compared to other Go TOML libraries: - - - - - - - - - - - + + + + + + + + + + +
Benchmarkgo-toml v1BurntSushi/toml
Marshal/HugoFrontMatter-21.9x1.9x
Marshal/ReferenceFile/map-21.7x1.8x
Marshal/ReferenceFile/struct-22.2x2.5x
Unmarshal/HugoFrontMatter-22.9x2.9x
Unmarshal/ReferenceFile/map-22.6x2.9x
Unmarshal/ReferenceFile/struct-24.4x5.3x
Benchmarkgo-toml v1BurntSushi/toml
Marshal/HugoFrontMatter-21.9x2.2x
Marshal/ReferenceFile/map-21.7x2.1x
Marshal/ReferenceFile/struct-22.2x3.0x
Unmarshal/HugoFrontMatter-22.9x2.7x
Unmarshal/ReferenceFile/map-22.6x2.7x
Unmarshal/ReferenceFile/struct-24.6x5.1x
See more

The table above has the results of the most common use-cases. The table below @@ -163,22 +193,22 @@ contains the results of all benchmarks, including unrealistic ones. It is provided for completeness.

- - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + +
Benchmarkgo-toml v1BurntSushi/toml
Marshal/SimpleDocument/map-21.8x2.9x
Marshal/SimpleDocument/struct-22.7x4.2x
Unmarshal/SimpleDocument/map-24.5x3.1x
Unmarshal/SimpleDocument/struct-26.2x3.9x
UnmarshalDataset/example-23.1x3.5x
UnmarshalDataset/code-22.3x3.1x
UnmarshalDataset/twitter-22.5x2.6x
UnmarshalDataset/citm_catalog-22.1x2.2x
UnmarshalDataset/canada-21.6x1.3x
UnmarshalDataset/config-24.3x3.2x
[Geo mean]2.7x2.8x
Benchmarkgo-toml v1BurntSushi/toml
Marshal/SimpleDocument/map-21.8x2.7x
Marshal/SimpleDocument/struct-22.7x3.8x
Unmarshal/SimpleDocument/map-23.8x3.0x
Unmarshal/SimpleDocument/struct-25.6x4.1x
UnmarshalDataset/example-23.0x3.2x
UnmarshalDataset/code-22.3x2.9x
UnmarshalDataset/twitter-22.6x2.7x
UnmarshalDataset/citm_catalog-22.2x2.3x
UnmarshalDataset/canada-21.8x1.5x
UnmarshalDataset/config-24.1x2.9x
geomean2.7x2.8x

This table can be generated with ./ci.sh benchmark -a -html.

@@ -203,24 +233,24 @@ Go-toml provides three handy command line tools: * `tomljson`: Reads a TOML file and outputs its JSON representation. - ``` - $ go install github.com/pelletier/go-toml/v2/cmd/tomljson@latest - $ tomljson --help - ``` + ``` + $ go install github.com/pelletier/go-toml/v2/cmd/tomljson@latest + $ tomljson --help + ``` * `jsontoml`: Reads a JSON file and outputs a TOML representation. - ``` - $ go install github.com/pelletier/go-toml/v2/cmd/jsontoml@latest - $ jsontoml --help - ``` + ``` + $ go install github.com/pelletier/go-toml/v2/cmd/jsontoml@latest + $ jsontoml --help + ``` * `tomll`: Lints and reformats a TOML file. - ``` - $ go install github.com/pelletier/go-toml/v2/cmd/tomll@latest - $ tomll --help - ``` + ``` + $ go install github.com/pelletier/go-toml/v2/cmd/tomll@latest + $ tomll --help + ``` ### Docker image @@ -231,7 +261,7 @@ Those tools are also available as a [Docker image][docker]. For example, to use docker run -i ghcr.io/pelletier/go-toml:v2 tomljson < example.toml ``` -Multiple versions are availble on [ghcr.io][docker]. +Multiple versions are available on [ghcr.io][docker]. [docker]: https://github.com/pelletier/go-toml/pkgs/container/go-toml @@ -263,16 +293,16 @@ element in the interface to decode the object. For example: ```go type inner struct { - B interface{} + B interface{} } type doc struct { - A interface{} + A interface{} } d := doc{ - A: inner{ - B: "Before", - }, + A: inner{ + B: "Before", + }, } data := ` @@ -311,7 +341,7 @@ contained in the doc is superior to the capacity of the array. For example: ```go type doc struct { - A [2]string + A [2]string } d := doc{} err := toml.Unmarshal([]byte(`A = ["one", "two", "many"]`), &d) @@ -486,27 +516,20 @@ is not necessary anymore. V1 used to provide multiple struct tags: `comment`, `commented`, `multiline`, `toml`, and `omitempty`. To behave more like the standard library, v2 has merged -`toml`, `multiline`, and `omitempty`. For example: +`toml`, `multiline`, `commented`, and `omitempty`. For example: ```go type doc struct { // v1 - F string `toml:"field" multiline:"true" omitempty:"true"` + F string `toml:"field" multiline:"true" omitempty:"true" commented:"true"` // v2 - F string `toml:"field,multiline,omitempty"` + F string `toml:"field,multiline,omitempty,commented"` } ``` Has a result, the `Encoder.SetTag*` methods have been removed, as there is just one tag now. - -#### `commented` tag has been removed - -There is no replacement for the `commented` tag. This feature would be better -suited in a proper document model for go-toml v2, which has been [cut from -scope][nodoc] at the moment. - #### `Encoder.ArraysWithOneElementPerLine` has been renamed The new name is `Encoder.SetArraysMultiline`. The behavior should be the same. @@ -542,10 +565,11 @@ complete solutions exist out there. ## Versioning -Go-toml follows [Semantic Versioning](http://semver.org/). The supported version -of [TOML](https://github.com/toml-lang/toml) is indicated at the beginning of -this document. The last two major versions of Go are supported -(see [Go Release Policy](https://golang.org/doc/devel/release.html#policy)). +Expect for parts explicitly marked otherwise, go-toml follows [Semantic +Versioning](https://semver.org). The supported version of +[TOML](https://github.com/toml-lang/toml) is indicated at the beginning of this +document. The last two major versions of Go are supported (see [Go Release +Policy](https://golang.org/doc/devel/release.html#policy)). ## License diff --git a/vendor/github.com/pelletier/go-toml/v2/SECURITY.md b/vendor/github.com/pelletier/go-toml/v2/SECURITY.md index b2f21cfc..d4d554fd 100644 --- a/vendor/github.com/pelletier/go-toml/v2/SECURITY.md +++ b/vendor/github.com/pelletier/go-toml/v2/SECURITY.md @@ -2,9 +2,6 @@ ## Supported Versions -Use this section to tell people about which versions of your project are -currently being supported with security updates. - | Version | Supported | | ---------- | ------------------ | | Latest 2.x | :white_check_mark: | diff --git a/vendor/github.com/pelletier/go-toml/v2/ci.sh b/vendor/github.com/pelletier/go-toml/v2/ci.sh index d916c5f2..86217a9b 100644 --- a/vendor/github.com/pelletier/go-toml/v2/ci.sh +++ b/vendor/github.com/pelletier/go-toml/v2/ci.sh @@ -77,8 +77,9 @@ cover() { pushd "$dir" go test -covermode=atomic -coverpkg=./... -coverprofile=coverage.out.tmp ./... - cat coverage.out.tmp | grep -v testsuite | grep -v tomltestgen | grep -v gotoml-test-decoder > coverage.out + grep -Ev '(fuzz|testsuite|tomltestgen|gotoml-test-decoder|gotoml-test-encoder)' coverage.out.tmp > coverage.out go tool cover -func=coverage.out + echo "Coverage profile for ${branch}: ${dir}/coverage.out" >&2 popd if [ "${branch}" != "HEAD" ]; then @@ -151,7 +152,7 @@ bench() { fi export GOMAXPROCS=2 - nice -n -19 taskset --cpu-list 0,1 go test '-bench=^Benchmark(Un)?[mM]arshal' -count=5 -run=Nothing ./... | tee "${out}" + go test '-bench=^Benchmark(Un)?[mM]arshal' -count=10 -run=Nothing ./... | tee "${out}" popd if [ "${branch}" != "HEAD" ]; then @@ -160,10 +161,12 @@ bench() { } fmktemp() { - if mktemp --version|grep GNU >/dev/null; then - mktemp --suffix=-$1; + if mktemp --version &> /dev/null; then + # GNU + mktemp --suffix=-$1 else - mktemp -t $1; + # BSD + mktemp -t $1 fi } @@ -183,12 +186,14 @@ with open(sys.argv[1]) as f: lines.append(line.split(',')) results = [] -for line in reversed(lines[1:]): +for line in reversed(lines[2:]): + if len(line) < 8 or line[0] == "": + continue v2 = float(line[1]) results.append([ line[0].replace("-32", ""), "%.1fx" % (float(line[3])/v2), # v1 - "%.1fx" % (float(line[5])/v2), # bs + "%.1fx" % (float(line[7])/v2), # bs ]) # move geomean to the end results.append(results[0]) @@ -259,10 +264,10 @@ benchmark() { if [ "$1" = "-html" ]; then tmpcsv=`fmktemp csv` - benchstat -csv -geomean go-toml-v2.txt go-toml-v1.txt bs-toml.txt > $tmpcsv + benchstat -format csv go-toml-v2.txt go-toml-v1.txt bs-toml.txt > $tmpcsv benchstathtml $tmpcsv else - benchstat -geomean go-toml-v2.txt go-toml-v1.txt bs-toml.txt + benchstat go-toml-v2.txt go-toml-v1.txt bs-toml.txt fi rm -f go-toml-v2.txt go-toml-v1.txt bs-toml.txt diff --git a/vendor/github.com/pelletier/go-toml/v2/decode.go b/vendor/github.com/pelletier/go-toml/v2/decode.go index 4af96536..f0ec3b17 100644 --- a/vendor/github.com/pelletier/go-toml/v2/decode.go +++ b/vendor/github.com/pelletier/go-toml/v2/decode.go @@ -5,6 +5,8 @@ import ( "math" "strconv" "time" + + "github.com/pelletier/go-toml/v2/unstable" ) func parseInteger(b []byte) (int64, error) { @@ -32,7 +34,7 @@ func parseLocalDate(b []byte) (LocalDate, error) { var date LocalDate if len(b) != 10 || b[4] != '-' || b[7] != '-' { - return date, newDecodeError(b, "dates are expected to have the format YYYY-MM-DD") + return date, unstable.NewParserError(b, "dates are expected to have the format YYYY-MM-DD") } var err error @@ -53,7 +55,7 @@ func parseLocalDate(b []byte) (LocalDate, error) { } if !isValidDate(date.Year, date.Month, date.Day) { - return LocalDate{}, newDecodeError(b, "impossible date") + return LocalDate{}, unstable.NewParserError(b, "impossible date") } return date, nil @@ -64,7 +66,7 @@ func parseDecimalDigits(b []byte) (int, error) { for i, c := range b { if c < '0' || c > '9' { - return 0, newDecodeError(b[i:i+1], "expected digit (0-9)") + return 0, unstable.NewParserError(b[i:i+1], "expected digit (0-9)") } v *= 10 v += int(c - '0') @@ -97,7 +99,7 @@ func parseDateTime(b []byte) (time.Time, error) { } else { const dateTimeByteLen = 6 if len(b) != dateTimeByteLen { - return time.Time{}, newDecodeError(b, "invalid date-time timezone") + return time.Time{}, unstable.NewParserError(b, "invalid date-time timezone") } var direction int switch b[0] { @@ -106,11 +108,11 @@ func parseDateTime(b []byte) (time.Time, error) { case '+': direction = +1 default: - return time.Time{}, newDecodeError(b[:1], "invalid timezone offset character") + return time.Time{}, unstable.NewParserError(b[:1], "invalid timezone offset character") } if b[3] != ':' { - return time.Time{}, newDecodeError(b[3:4], "expected a : separator") + return time.Time{}, unstable.NewParserError(b[3:4], "expected a : separator") } hours, err := parseDecimalDigits(b[1:3]) @@ -118,7 +120,7 @@ func parseDateTime(b []byte) (time.Time, error) { return time.Time{}, err } if hours > 23 { - return time.Time{}, newDecodeError(b[:1], "invalid timezone offset hours") + return time.Time{}, unstable.NewParserError(b[:1], "invalid timezone offset hours") } minutes, err := parseDecimalDigits(b[4:6]) @@ -126,7 +128,7 @@ func parseDateTime(b []byte) (time.Time, error) { return time.Time{}, err } if minutes > 59 { - return time.Time{}, newDecodeError(b[:1], "invalid timezone offset minutes") + return time.Time{}, unstable.NewParserError(b[:1], "invalid timezone offset minutes") } seconds := direction * (hours*3600 + minutes*60) @@ -139,7 +141,7 @@ func parseDateTime(b []byte) (time.Time, error) { } if len(b) > 0 { - return time.Time{}, newDecodeError(b, "extra bytes at the end of the timezone") + return time.Time{}, unstable.NewParserError(b, "extra bytes at the end of the timezone") } t := time.Date( @@ -160,7 +162,7 @@ func parseLocalDateTime(b []byte) (LocalDateTime, []byte, error) { const localDateTimeByteMinLen = 11 if len(b) < localDateTimeByteMinLen { - return dt, nil, newDecodeError(b, "local datetimes are expected to have the format YYYY-MM-DDTHH:MM:SS[.NNNNNNNNN]") + return dt, nil, unstable.NewParserError(b, "local datetimes are expected to have the format YYYY-MM-DDTHH:MM:SS[.NNNNNNNNN]") } date, err := parseLocalDate(b[:10]) @@ -171,7 +173,7 @@ func parseLocalDateTime(b []byte) (LocalDateTime, []byte, error) { sep := b[10] if sep != 'T' && sep != ' ' && sep != 't' { - return dt, nil, newDecodeError(b[10:11], "datetime separator is expected to be T or a space") + return dt, nil, unstable.NewParserError(b[10:11], "datetime separator is expected to be T or a space") } t, rest, err := parseLocalTime(b[11:]) @@ -195,7 +197,7 @@ func parseLocalTime(b []byte) (LocalTime, []byte, error) { // check if b matches to have expected format HH:MM:SS[.NNNNNN] const localTimeByteLen = 8 if len(b) < localTimeByteLen { - return t, nil, newDecodeError(b, "times are expected to have the format HH:MM:SS[.NNNNNN]") + return t, nil, unstable.NewParserError(b, "times are expected to have the format HH:MM:SS[.NNNNNN]") } var err error @@ -206,10 +208,10 @@ func parseLocalTime(b []byte) (LocalTime, []byte, error) { } if t.Hour > 23 { - return t, nil, newDecodeError(b[0:2], "hour cannot be greater 23") + return t, nil, unstable.NewParserError(b[0:2], "hour cannot be greater 23") } if b[2] != ':' { - return t, nil, newDecodeError(b[2:3], "expecting colon between hours and minutes") + return t, nil, unstable.NewParserError(b[2:3], "expecting colon between hours and minutes") } t.Minute, err = parseDecimalDigits(b[3:5]) @@ -217,10 +219,10 @@ func parseLocalTime(b []byte) (LocalTime, []byte, error) { return t, nil, err } if t.Minute > 59 { - return t, nil, newDecodeError(b[3:5], "minutes cannot be greater 59") + return t, nil, unstable.NewParserError(b[3:5], "minutes cannot be greater 59") } if b[5] != ':' { - return t, nil, newDecodeError(b[5:6], "expecting colon between minutes and seconds") + return t, nil, unstable.NewParserError(b[5:6], "expecting colon between minutes and seconds") } t.Second, err = parseDecimalDigits(b[6:8]) @@ -229,7 +231,7 @@ func parseLocalTime(b []byte) (LocalTime, []byte, error) { } if t.Second > 60 { - return t, nil, newDecodeError(b[6:8], "seconds cannot be greater 60") + return t, nil, unstable.NewParserError(b[6:8], "seconds cannot be greater 60") } b = b[8:] @@ -242,7 +244,7 @@ func parseLocalTime(b []byte) (LocalTime, []byte, error) { for i, c := range b[1:] { if !isDigit(c) { if i == 0 { - return t, nil, newDecodeError(b[0:1], "need at least one digit after fraction point") + return t, nil, unstable.NewParserError(b[0:1], "need at least one digit after fraction point") } break } @@ -266,7 +268,7 @@ func parseLocalTime(b []byte) (LocalTime, []byte, error) { } if precision == 0 { - return t, nil, newDecodeError(b[:1], "nanoseconds need at least one digit") + return t, nil, unstable.NewParserError(b[:1], "nanoseconds need at least one digit") } t.Nanosecond = frac * nspow[precision] @@ -289,24 +291,24 @@ func parseFloat(b []byte) (float64, error) { } if cleaned[0] == '.' { - return 0, newDecodeError(b, "float cannot start with a dot") + return 0, unstable.NewParserError(b, "float cannot start with a dot") } if cleaned[len(cleaned)-1] == '.' { - return 0, newDecodeError(b, "float cannot end with a dot") + return 0, unstable.NewParserError(b, "float cannot end with a dot") } dotAlreadySeen := false for i, c := range cleaned { if c == '.' { if dotAlreadySeen { - return 0, newDecodeError(b[i:i+1], "float can have at most one decimal point") + return 0, unstable.NewParserError(b[i:i+1], "float can have at most one decimal point") } if !isDigit(cleaned[i-1]) { - return 0, newDecodeError(b[i-1:i+1], "float decimal point must be preceded by a digit") + return 0, unstable.NewParserError(b[i-1:i+1], "float decimal point must be preceded by a digit") } if !isDigit(cleaned[i+1]) { - return 0, newDecodeError(b[i:i+2], "float decimal point must be followed by a digit") + return 0, unstable.NewParserError(b[i:i+2], "float decimal point must be followed by a digit") } dotAlreadySeen = true } @@ -316,13 +318,13 @@ func parseFloat(b []byte) (float64, error) { if cleaned[0] == '+' || cleaned[0] == '-' { start = 1 } - if cleaned[start] == '0' && isDigit(cleaned[start+1]) { - return 0, newDecodeError(b, "float integer part cannot have leading zeroes") + if cleaned[start] == '0' && len(cleaned) > start+1 && isDigit(cleaned[start+1]) { + return 0, unstable.NewParserError(b, "float integer part cannot have leading zeroes") } f, err := strconv.ParseFloat(string(cleaned), 64) if err != nil { - return 0, newDecodeError(b, "unable to parse float: %w", err) + return 0, unstable.NewParserError(b, "unable to parse float: %w", err) } return f, nil @@ -336,7 +338,7 @@ func parseIntHex(b []byte) (int64, error) { i, err := strconv.ParseInt(string(cleaned), 16, 64) if err != nil { - return 0, newDecodeError(b, "couldn't parse hexadecimal number: %w", err) + return 0, unstable.NewParserError(b, "couldn't parse hexadecimal number: %w", err) } return i, nil @@ -350,7 +352,7 @@ func parseIntOct(b []byte) (int64, error) { i, err := strconv.ParseInt(string(cleaned), 8, 64) if err != nil { - return 0, newDecodeError(b, "couldn't parse octal number: %w", err) + return 0, unstable.NewParserError(b, "couldn't parse octal number: %w", err) } return i, nil @@ -364,7 +366,7 @@ func parseIntBin(b []byte) (int64, error) { i, err := strconv.ParseInt(string(cleaned), 2, 64) if err != nil { - return 0, newDecodeError(b, "couldn't parse binary number: %w", err) + return 0, unstable.NewParserError(b, "couldn't parse binary number: %w", err) } return i, nil @@ -387,12 +389,12 @@ func parseIntDec(b []byte) (int64, error) { } if len(cleaned) > startIdx+1 && cleaned[startIdx] == '0' { - return 0, newDecodeError(b, "leading zero not allowed on decimal number") + return 0, unstable.NewParserError(b, "leading zero not allowed on decimal number") } i, err := strconv.ParseInt(string(cleaned), 10, 64) if err != nil { - return 0, newDecodeError(b, "couldn't parse decimal number: %w", err) + return 0, unstable.NewParserError(b, "couldn't parse decimal number: %w", err) } return i, nil @@ -409,11 +411,11 @@ func checkAndRemoveUnderscoresIntegers(b []byte) ([]byte, error) { } if b[start] == '_' { - return nil, newDecodeError(b[start:start+1], "number cannot start with underscore") + return nil, unstable.NewParserError(b[start:start+1], "number cannot start with underscore") } if b[len(b)-1] == '_' { - return nil, newDecodeError(b[len(b)-1:], "number cannot end with underscore") + return nil, unstable.NewParserError(b[len(b)-1:], "number cannot end with underscore") } // fast path @@ -435,7 +437,7 @@ func checkAndRemoveUnderscoresIntegers(b []byte) ([]byte, error) { c := b[i] if c == '_' { if !before { - return nil, newDecodeError(b[i-1:i+1], "number must have at least one digit between underscores") + return nil, unstable.NewParserError(b[i-1:i+1], "number must have at least one digit between underscores") } before = false } else { @@ -449,11 +451,11 @@ func checkAndRemoveUnderscoresIntegers(b []byte) ([]byte, error) { func checkAndRemoveUnderscoresFloats(b []byte) ([]byte, error) { if b[0] == '_' { - return nil, newDecodeError(b[0:1], "number cannot start with underscore") + return nil, unstable.NewParserError(b[0:1], "number cannot start with underscore") } if b[len(b)-1] == '_' { - return nil, newDecodeError(b[len(b)-1:], "number cannot end with underscore") + return nil, unstable.NewParserError(b[len(b)-1:], "number cannot end with underscore") } // fast path @@ -476,10 +478,10 @@ func checkAndRemoveUnderscoresFloats(b []byte) ([]byte, error) { switch c { case '_': if !before { - return nil, newDecodeError(b[i-1:i+1], "number must have at least one digit between underscores") + return nil, unstable.NewParserError(b[i-1:i+1], "number must have at least one digit between underscores") } if i < len(b)-1 && (b[i+1] == 'e' || b[i+1] == 'E') { - return nil, newDecodeError(b[i+1:i+2], "cannot have underscore before exponent") + return nil, unstable.NewParserError(b[i+1:i+2], "cannot have underscore before exponent") } before = false case '+', '-': @@ -488,15 +490,15 @@ func checkAndRemoveUnderscoresFloats(b []byte) ([]byte, error) { before = false case 'e', 'E': if i < len(b)-1 && b[i+1] == '_' { - return nil, newDecodeError(b[i+1:i+2], "cannot have underscore after exponent") + return nil, unstable.NewParserError(b[i+1:i+2], "cannot have underscore after exponent") } cleaned = append(cleaned, c) case '.': if i < len(b)-1 && b[i+1] == '_' { - return nil, newDecodeError(b[i+1:i+2], "cannot have underscore after decimal point") + return nil, unstable.NewParserError(b[i+1:i+2], "cannot have underscore after decimal point") } if i > 0 && b[i-1] == '_' { - return nil, newDecodeError(b[i-1:i], "cannot have underscore before decimal point") + return nil, unstable.NewParserError(b[i-1:i], "cannot have underscore before decimal point") } cleaned = append(cleaned, c) default: @@ -542,3 +544,7 @@ func daysIn(m int, year int) int { func isLeap(year int) bool { return year%4 == 0 && (year%100 != 0 || year%400 == 0) } + +func isDigit(r byte) bool { + return r >= '0' && r <= '9' +} diff --git a/vendor/github.com/pelletier/go-toml/v2/errors.go b/vendor/github.com/pelletier/go-toml/v2/errors.go index 5e6635c3..309733f1 100644 --- a/vendor/github.com/pelletier/go-toml/v2/errors.go +++ b/vendor/github.com/pelletier/go-toml/v2/errors.go @@ -6,6 +6,7 @@ import ( "strings" "github.com/pelletier/go-toml/v2/internal/danger" + "github.com/pelletier/go-toml/v2/unstable" ) // DecodeError represents an error encountered during the parsing or decoding @@ -55,25 +56,6 @@ func (s *StrictMissingError) String() string { type Key []string -// internal version of DecodeError that is used as the base to create a -// DecodeError with full context. -type decodeError struct { - highlight []byte - message string - key Key // optional -} - -func (de *decodeError) Error() string { - return de.message -} - -func newDecodeError(highlight []byte, format string, args ...interface{}) error { - return &decodeError{ - highlight: highlight, - message: fmt.Errorf(format, args...).Error(), - } -} - // Error returns the error message contained in the DecodeError. func (e *DecodeError) Error() string { return "toml: " + e.message @@ -103,13 +85,14 @@ func (e *DecodeError) Key() Key { // // The function copies all bytes used in DecodeError, so that document and // highlight can be freely deallocated. +// //nolint:funlen -func wrapDecodeError(document []byte, de *decodeError) *DecodeError { - offset := danger.SubsliceOffset(document, de.highlight) +func wrapDecodeError(document []byte, de *unstable.ParserError) *DecodeError { + offset := danger.SubsliceOffset(document, de.Highlight) errMessage := de.Error() errLine, errColumn := positionAtEnd(document[:offset]) - before, after := linesOfContext(document, de.highlight, offset, 3) + before, after := linesOfContext(document, de.Highlight, offset, 3) var buf strings.Builder @@ -139,7 +122,7 @@ func wrapDecodeError(document []byte, de *decodeError) *DecodeError { buf.Write(before[0]) } - buf.Write(de.highlight) + buf.Write(de.Highlight) if len(after) > 0 { buf.Write(after[0]) @@ -157,7 +140,7 @@ func wrapDecodeError(document []byte, de *decodeError) *DecodeError { buf.WriteString(strings.Repeat(" ", len(before[0]))) } - buf.WriteString(strings.Repeat("~", len(de.highlight))) + buf.WriteString(strings.Repeat("~", len(de.Highlight))) if len(errMessage) > 0 { buf.WriteString(" ") @@ -182,7 +165,7 @@ func wrapDecodeError(document []byte, de *decodeError) *DecodeError { message: errMessage, line: errLine, column: errColumn, - key: de.key, + key: de.Key, human: buf.String(), } } diff --git a/vendor/github.com/pelletier/go-toml/v2/internal/ast/builder.go b/vendor/github.com/pelletier/go-toml/v2/internal/ast/builder.go deleted file mode 100644 index 120f16e5..00000000 --- a/vendor/github.com/pelletier/go-toml/v2/internal/ast/builder.go +++ /dev/null @@ -1,51 +0,0 @@ -package ast - -type Reference int - -const InvalidReference Reference = -1 - -func (r Reference) Valid() bool { - return r != InvalidReference -} - -type Builder struct { - tree Root - lastIdx int -} - -func (b *Builder) Tree() *Root { - return &b.tree -} - -func (b *Builder) NodeAt(ref Reference) *Node { - return b.tree.at(ref) -} - -func (b *Builder) Reset() { - b.tree.nodes = b.tree.nodes[:0] - b.lastIdx = 0 -} - -func (b *Builder) Push(n Node) Reference { - b.lastIdx = len(b.tree.nodes) - b.tree.nodes = append(b.tree.nodes, n) - return Reference(b.lastIdx) -} - -func (b *Builder) PushAndChain(n Node) Reference { - newIdx := len(b.tree.nodes) - b.tree.nodes = append(b.tree.nodes, n) - if b.lastIdx >= 0 { - b.tree.nodes[b.lastIdx].next = newIdx - b.lastIdx - } - b.lastIdx = newIdx - return Reference(b.lastIdx) -} - -func (b *Builder) AttachChild(parent Reference, child Reference) { - b.tree.nodes[parent].child = int(child) - int(parent) -} - -func (b *Builder) Chain(from Reference, to Reference) { - b.tree.nodes[from].next = int(to) - int(from) -} diff --git a/vendor/github.com/pelletier/go-toml/v2/internal/characters/ascii.go b/vendor/github.com/pelletier/go-toml/v2/internal/characters/ascii.go new file mode 100644 index 00000000..80f698db --- /dev/null +++ b/vendor/github.com/pelletier/go-toml/v2/internal/characters/ascii.go @@ -0,0 +1,42 @@ +package characters + +var invalidAsciiTable = [256]bool{ + 0x00: true, + 0x01: true, + 0x02: true, + 0x03: true, + 0x04: true, + 0x05: true, + 0x06: true, + 0x07: true, + 0x08: true, + // 0x09 TAB + // 0x0A LF + 0x0B: true, + 0x0C: true, + // 0x0D CR + 0x0E: true, + 0x0F: true, + 0x10: true, + 0x11: true, + 0x12: true, + 0x13: true, + 0x14: true, + 0x15: true, + 0x16: true, + 0x17: true, + 0x18: true, + 0x19: true, + 0x1A: true, + 0x1B: true, + 0x1C: true, + 0x1D: true, + 0x1E: true, + 0x1F: true, + // 0x20 - 0x7E Printable ASCII characters + 0x7F: true, +} + +func InvalidAscii(b byte) bool { + return invalidAsciiTable[b] +} diff --git a/vendor/github.com/pelletier/go-toml/v2/utf8.go b/vendor/github.com/pelletier/go-toml/v2/internal/characters/utf8.go similarity index 87% rename from vendor/github.com/pelletier/go-toml/v2/utf8.go rename to vendor/github.com/pelletier/go-toml/v2/internal/characters/utf8.go index d47a4f20..db4f45ac 100644 --- a/vendor/github.com/pelletier/go-toml/v2/utf8.go +++ b/vendor/github.com/pelletier/go-toml/v2/internal/characters/utf8.go @@ -1,4 +1,4 @@ -package toml +package characters import ( "unicode/utf8" @@ -32,7 +32,7 @@ func (u utf8Err) Zero() bool { // 0x9 => tab, ok // 0xA - 0x1F => invalid // 0x7F => invalid -func utf8TomlValidAlreadyEscaped(p []byte) (err utf8Err) { +func Utf8TomlValidAlreadyEscaped(p []byte) (err utf8Err) { // Fast path. Check for and skip 8 bytes of ASCII characters per iteration. offset := 0 for len(p) >= 8 { @@ -48,7 +48,7 @@ func utf8TomlValidAlreadyEscaped(p []byte) (err utf8Err) { } for i, b := range p[:8] { - if invalidAscii(b) { + if InvalidAscii(b) { err.Index = offset + i err.Size = 1 return @@ -62,7 +62,7 @@ func utf8TomlValidAlreadyEscaped(p []byte) (err utf8Err) { for i := 0; i < n; { pi := p[i] if pi < utf8.RuneSelf { - if invalidAscii(pi) { + if InvalidAscii(pi) { err.Index = offset + i err.Size = 1 return @@ -106,11 +106,11 @@ func utf8TomlValidAlreadyEscaped(p []byte) (err utf8Err) { } // Return the size of the next rune if valid, 0 otherwise. -func utf8ValidNext(p []byte) int { +func Utf8ValidNext(p []byte) int { c := p[0] if c < utf8.RuneSelf { - if invalidAscii(c) { + if InvalidAscii(c) { return 0 } return 1 @@ -140,47 +140,6 @@ func utf8ValidNext(p []byte) int { return size } -var invalidAsciiTable = [256]bool{ - 0x00: true, - 0x01: true, - 0x02: true, - 0x03: true, - 0x04: true, - 0x05: true, - 0x06: true, - 0x07: true, - 0x08: true, - // 0x09 TAB - // 0x0A LF - 0x0B: true, - 0x0C: true, - // 0x0D CR - 0x0E: true, - 0x0F: true, - 0x10: true, - 0x11: true, - 0x12: true, - 0x13: true, - 0x14: true, - 0x15: true, - 0x16: true, - 0x17: true, - 0x18: true, - 0x19: true, - 0x1A: true, - 0x1B: true, - 0x1C: true, - 0x1D: true, - 0x1E: true, - 0x1F: true, - // 0x20 - 0x7E Printable ASCII characters - 0x7F: true, -} - -func invalidAscii(b byte) bool { - return invalidAsciiTable[b] -} - // acceptRange gives the range of valid values for the second byte in a UTF-8 // sequence. type acceptRange struct { diff --git a/vendor/github.com/pelletier/go-toml/v2/internal/tracker/key.go b/vendor/github.com/pelletier/go-toml/v2/internal/tracker/key.go index 7c148f48..149b17f5 100644 --- a/vendor/github.com/pelletier/go-toml/v2/internal/tracker/key.go +++ b/vendor/github.com/pelletier/go-toml/v2/internal/tracker/key.go @@ -1,8 +1,6 @@ package tracker -import ( - "github.com/pelletier/go-toml/v2/internal/ast" -) +import "github.com/pelletier/go-toml/v2/unstable" // KeyTracker is a tracker that keeps track of the current Key as the AST is // walked. @@ -11,19 +9,19 @@ type KeyTracker struct { } // UpdateTable sets the state of the tracker with the AST table node. -func (t *KeyTracker) UpdateTable(node *ast.Node) { +func (t *KeyTracker) UpdateTable(node *unstable.Node) { t.reset() t.Push(node) } // UpdateArrayTable sets the state of the tracker with the AST array table node. -func (t *KeyTracker) UpdateArrayTable(node *ast.Node) { +func (t *KeyTracker) UpdateArrayTable(node *unstable.Node) { t.reset() t.Push(node) } // Push the given key on the stack. -func (t *KeyTracker) Push(node *ast.Node) { +func (t *KeyTracker) Push(node *unstable.Node) { it := node.Key() for it.Next() { t.k = append(t.k, string(it.Node().Data)) @@ -31,7 +29,7 @@ func (t *KeyTracker) Push(node *ast.Node) { } // Pop key from stack. -func (t *KeyTracker) Pop(node *ast.Node) { +func (t *KeyTracker) Pop(node *unstable.Node) { it := node.Key() for it.Next() { t.k = t.k[:len(t.k)-1] diff --git a/vendor/github.com/pelletier/go-toml/v2/internal/tracker/seen.go b/vendor/github.com/pelletier/go-toml/v2/internal/tracker/seen.go index a7ee05ba..76df2d5b 100644 --- a/vendor/github.com/pelletier/go-toml/v2/internal/tracker/seen.go +++ b/vendor/github.com/pelletier/go-toml/v2/internal/tracker/seen.go @@ -5,7 +5,7 @@ import ( "fmt" "sync" - "github.com/pelletier/go-toml/v2/internal/ast" + "github.com/pelletier/go-toml/v2/unstable" ) type keyKind uint8 @@ -57,7 +57,11 @@ type SeenTracker struct { currentIdx int } -var pool sync.Pool +var pool = sync.Pool{ + New: func() interface{} { + return &SeenTracker{} + }, +} func (s *SeenTracker) reset() { // Always contains a root element at index 0. @@ -149,24 +153,25 @@ func (s *SeenTracker) setExplicitFlag(parentIdx int) { // CheckExpression takes a top-level node and checks that it does not contain // keys that have been seen in previous calls, and validates that types are -// consistent. -func (s *SeenTracker) CheckExpression(node *ast.Node) error { +// consistent. It returns true if it is the first time this node's key is seen. +// Useful to clear array tables on first use. +func (s *SeenTracker) CheckExpression(node *unstable.Node) (bool, error) { if s.entries == nil { s.reset() } switch node.Kind { - case ast.KeyValue: + case unstable.KeyValue: return s.checkKeyValue(node) - case ast.Table: + case unstable.Table: return s.checkTable(node) - case ast.ArrayTable: + case unstable.ArrayTable: return s.checkArrayTable(node) default: panic(fmt.Errorf("this should not be a top level node type: %s", node.Kind)) } } -func (s *SeenTracker) checkTable(node *ast.Node) error { +func (s *SeenTracker) checkTable(node *unstable.Node) (bool, error) { if s.currentIdx >= 0 { s.setExplicitFlag(s.currentIdx) } @@ -192,7 +197,7 @@ func (s *SeenTracker) checkTable(node *ast.Node) error { } else { entry := s.entries[idx] if entry.kind == valueKind { - return fmt.Errorf("toml: expected %s to be a table, not a %s", string(k), entry.kind) + return false, fmt.Errorf("toml: expected %s to be a table, not a %s", string(k), entry.kind) } } parentIdx = idx @@ -201,25 +206,27 @@ func (s *SeenTracker) checkTable(node *ast.Node) error { k := it.Node().Data idx := s.find(parentIdx, k) + first := false if idx >= 0 { kind := s.entries[idx].kind if kind != tableKind { - return fmt.Errorf("toml: key %s should be a table, not a %s", string(k), kind) + return false, fmt.Errorf("toml: key %s should be a table, not a %s", string(k), kind) } if s.entries[idx].explicit { - return fmt.Errorf("toml: table %s already exists", string(k)) + return false, fmt.Errorf("toml: table %s already exists", string(k)) } s.entries[idx].explicit = true } else { idx = s.create(parentIdx, k, tableKind, true, false) + first = true } s.currentIdx = idx - return nil + return first, nil } -func (s *SeenTracker) checkArrayTable(node *ast.Node) error { +func (s *SeenTracker) checkArrayTable(node *unstable.Node) (bool, error) { if s.currentIdx >= 0 { s.setExplicitFlag(s.currentIdx) } @@ -242,7 +249,7 @@ func (s *SeenTracker) checkArrayTable(node *ast.Node) error { } else { entry := s.entries[idx] if entry.kind == valueKind { - return fmt.Errorf("toml: expected %s to be a table, not a %s", string(k), entry.kind) + return false, fmt.Errorf("toml: expected %s to be a table, not a %s", string(k), entry.kind) } } @@ -252,22 +259,23 @@ func (s *SeenTracker) checkArrayTable(node *ast.Node) error { k := it.Node().Data idx := s.find(parentIdx, k) - if idx >= 0 { + firstTime := idx < 0 + if firstTime { + idx = s.create(parentIdx, k, arrayTableKind, true, false) + } else { kind := s.entries[idx].kind if kind != arrayTableKind { - return fmt.Errorf("toml: key %s already exists as a %s, but should be an array table", kind, string(k)) + return false, fmt.Errorf("toml: key %s already exists as a %s, but should be an array table", kind, string(k)) } s.clear(idx) - } else { - idx = s.create(parentIdx, k, arrayTableKind, true, false) } s.currentIdx = idx - return nil + return firstTime, nil } -func (s *SeenTracker) checkKeyValue(node *ast.Node) error { +func (s *SeenTracker) checkKeyValue(node *unstable.Node) (bool, error) { parentIdx := s.currentIdx it := node.Key() @@ -281,11 +289,11 @@ func (s *SeenTracker) checkKeyValue(node *ast.Node) error { } else { entry := s.entries[idx] if it.IsLast() { - return fmt.Errorf("toml: key %s is already defined", string(k)) + return false, fmt.Errorf("toml: key %s is already defined", string(k)) } else if entry.kind != tableKind { - return fmt.Errorf("toml: expected %s to be a table, not a %s", string(k), entry.kind) + return false, fmt.Errorf("toml: expected %s to be a table, not a %s", string(k), entry.kind) } else if entry.explicit { - return fmt.Errorf("toml: cannot redefine table %s that has already been explicitly defined", string(k)) + return false, fmt.Errorf("toml: cannot redefine table %s that has already been explicitly defined", string(k)) } } @@ -297,51 +305,45 @@ func (s *SeenTracker) checkKeyValue(node *ast.Node) error { value := node.Value() switch value.Kind { - case ast.InlineTable: + case unstable.InlineTable: return s.checkInlineTable(value) - case ast.Array: + case unstable.Array: return s.checkArray(value) } - return nil + return false, nil } -func (s *SeenTracker) checkArray(node *ast.Node) error { +func (s *SeenTracker) checkArray(node *unstable.Node) (first bool, err error) { it := node.Children() for it.Next() { n := it.Node() switch n.Kind { - case ast.InlineTable: - err := s.checkInlineTable(n) + case unstable.InlineTable: + first, err = s.checkInlineTable(n) if err != nil { - return err + return false, err } - case ast.Array: - err := s.checkArray(n) + case unstable.Array: + first, err = s.checkArray(n) if err != nil { - return err + return false, err } } } - return nil + return first, nil } -func (s *SeenTracker) checkInlineTable(node *ast.Node) error { - if pool.New == nil { - pool.New = func() interface{} { - return &SeenTracker{} - } - } - +func (s *SeenTracker) checkInlineTable(node *unstable.Node) (first bool, err error) { s = pool.Get().(*SeenTracker) s.reset() it := node.Children() for it.Next() { n := it.Node() - err := s.checkKeyValue(n) + first, err = s.checkKeyValue(n) if err != nil { - return err + return false, err } } @@ -352,5 +354,5 @@ func (s *SeenTracker) checkInlineTable(node *ast.Node) error { // redefinition of its keys: check* functions cannot walk into // a value. pool.Put(s) - return nil + return first, nil } diff --git a/vendor/github.com/pelletier/go-toml/v2/localtime.go b/vendor/github.com/pelletier/go-toml/v2/localtime.go index 30a31dcb..a856bfdb 100644 --- a/vendor/github.com/pelletier/go-toml/v2/localtime.go +++ b/vendor/github.com/pelletier/go-toml/v2/localtime.go @@ -4,6 +4,8 @@ import ( "fmt" "strings" "time" + + "github.com/pelletier/go-toml/v2/unstable" ) // LocalDate represents a calendar day in no specific timezone. @@ -75,7 +77,7 @@ func (d LocalTime) MarshalText() ([]byte, error) { func (d *LocalTime) UnmarshalText(b []byte) error { res, left, err := parseLocalTime(b) if err == nil && len(left) != 0 { - err = newDecodeError(left, "extra characters") + err = unstable.NewParserError(left, "extra characters") } if err != nil { return err @@ -109,7 +111,7 @@ func (d LocalDateTime) MarshalText() ([]byte, error) { func (d *LocalDateTime) UnmarshalText(data []byte) error { res, left, err := parseLocalDateTime(data) if err == nil && len(left) != 0 { - err = newDecodeError(left, "extra characters") + err = unstable.NewParserError(left, "extra characters") } if err != nil { return err diff --git a/vendor/github.com/pelletier/go-toml/v2/marshaler.go b/vendor/github.com/pelletier/go-toml/v2/marshaler.go index c14c1cea..161acd93 100644 --- a/vendor/github.com/pelletier/go-toml/v2/marshaler.go +++ b/vendor/github.com/pelletier/go-toml/v2/marshaler.go @@ -3,15 +3,18 @@ package toml import ( "bytes" "encoding" + "encoding/json" "fmt" "io" "math" "reflect" - "sort" + "slices" "strconv" "strings" "time" "unicode" + + "github.com/pelletier/go-toml/v2/internal/characters" ) // Marshal serializes a Go value as a TOML document. @@ -35,10 +38,11 @@ type Encoder struct { w io.Writer // global settings - tablesInline bool - arraysMultiline bool - indentSymbol string - indentTables bool + tablesInline bool + arraysMultiline bool + indentSymbol string + indentTables bool + marshalJsonNumbers bool } // NewEncoder returns a new Encoder that writes to w. @@ -54,7 +58,7 @@ func NewEncoder(w io.Writer) *Encoder { // This behavior can be controlled on an individual struct field basis with the // inline tag: // -// MyField `inline:"true"` +// MyField `toml:",inline"` func (enc *Encoder) SetTablesInline(inline bool) *Encoder { enc.tablesInline = inline return enc @@ -65,7 +69,7 @@ func (enc *Encoder) SetTablesInline(inline bool) *Encoder { // // This behavior can be controlled on an individual struct field basis with the multiline tag: // -// MyField `multiline:"true"` +// MyField `multiline:"true"` func (enc *Encoder) SetArraysMultiline(multiline bool) *Encoder { enc.arraysMultiline = multiline return enc @@ -85,11 +89,22 @@ func (enc *Encoder) SetIndentTables(indent bool) *Encoder { return enc } +// SetMarshalJsonNumbers forces the encoder to serialize `json.Number` as a +// float or integer instead of relying on TextMarshaler to emit a string. +// +// *Unstable:* This method does not follow the compatibility guarantees of +// semver. It can be changed or removed without a new major version being +// issued. +func (enc *Encoder) SetMarshalJsonNumbers(indent bool) *Encoder { + enc.marshalJsonNumbers = indent + return enc +} + // Encode writes a TOML representation of v to the stream. // // If v cannot be represented to TOML it returns an error. // -// Encoding rules +// # Encoding rules // // A top level slice containing only maps or structs is encoded as [[table // array]]. @@ -107,10 +122,30 @@ func (enc *Encoder) SetIndentTables(indent bool) *Encoder { // a newline character or a single quote. In that case they are emitted as // quoted strings. // +// Unsigned integers larger than math.MaxInt64 cannot be encoded. Doing so +// results in an error. This rule exists because the TOML specification only +// requires parsers to support at least the 64 bits integer range. Allowing +// larger numbers would create non-standard TOML documents, which may not be +// readable (at best) by other implementations. To encode such numbers, a +// solution is a custom type that implements encoding.TextMarshaler. +// // When encoding structs, fields are encoded in order of definition, with their // exact name. // -// Struct tags +// Tables and array tables are separated by empty lines. However, consecutive +// subtables definitions are not. For example: +// +// [top1] +// +// [top2] +// [top2.child1] +// +// [[array]] +// +// [[array]] +// [array.child2] +// +// # Struct tags // // The encoding of each public struct field can be customized by the format // string in the "toml" key of the struct field's tag. This follows @@ -126,6 +161,9 @@ func (enc *Encoder) SetIndentTables(indent bool) *Encoder { // // The "omitempty" option prevents empty values or groups from being emitted. // +// The "commented" option prefixes the value and all its children with a comment +// symbol. +// // In addition to the "toml" tag struct tag, a "comment" tag can be used to emit // a TOML comment before the value being annotated. Comments are ignored inside // inline tables. For array tables, the comment is only present before the first @@ -158,6 +196,7 @@ func (enc *Encoder) Encode(v interface{}) error { type valueOptions struct { multiline bool omitempty bool + commented bool comment string } @@ -183,6 +222,9 @@ type encoderCtx struct { // Indentation level indent int + // Prefix the current value with a comment. + commented bool + // Options coming from struct tags options valueOptions } @@ -223,10 +265,22 @@ func (enc *Encoder) encode(b []byte, ctx encoderCtx, v reflect.Value) ([]byte, e return append(b, x.String()...), nil case LocalDateTime: return append(b, x.String()...), nil + case json.Number: + if enc.marshalJsonNumbers { + if x == "" { /// Useful zero value. + return append(b, "0"...), nil + } else if v, err := x.Int64(); err == nil { + return enc.encode(b, ctx, reflect.ValueOf(v)) + } else if f, err := x.Float64(); err == nil { + return enc.encode(b, ctx, reflect.ValueOf(f)) + } else { + return nil, fmt.Errorf("toml: unable to convert %q to int64 or float64", x) + } + } } hasTextMarshaler := v.Type().Implements(textMarshalerType) - if hasTextMarshaler || (v.CanAddr() && reflect.PtrTo(v.Type()).Implements(textMarshalerType)) { + if hasTextMarshaler || (v.CanAddr() && reflect.PointerTo(v.Type()).Implements(textMarshalerType)) { if !hasTextMarshaler { v = v.Addr() } @@ -251,7 +305,7 @@ func (enc *Encoder) encode(b []byte, ctx encoderCtx, v reflect.Value) ([]byte, e return enc.encodeMap(b, ctx, v) case reflect.Struct: return enc.encodeStruct(b, ctx, v) - case reflect.Slice: + case reflect.Slice, reflect.Array: return enc.encodeSlice(b, ctx, v) case reflect.Interface: if v.IsNil() { @@ -303,7 +357,11 @@ func (enc *Encoder) encode(b []byte, ctx encoderCtx, v reflect.Value) ([]byte, e b = append(b, "false"...) } case reflect.Uint64, reflect.Uint32, reflect.Uint16, reflect.Uint8, reflect.Uint: - b = strconv.AppendUint(b, v.Uint(), 10) + x := v.Uint() + if x > uint64(math.MaxInt64) { + return nil, fmt.Errorf("toml: not encoding uint (%d) greater than max int64 (%d)", x, int64(math.MaxInt64)) + } + b = strconv.AppendUint(b, x, 10) case reflect.Int64, reflect.Int32, reflect.Int16, reflect.Int8, reflect.Int: b = strconv.AppendInt(b, v.Int(), 10) default: @@ -322,18 +380,19 @@ func isNil(v reflect.Value) bool { } } +func shouldOmitEmpty(options valueOptions, v reflect.Value) bool { + return options.omitempty && isEmptyValue(v) +} + func (enc *Encoder) encodeKv(b []byte, ctx encoderCtx, options valueOptions, v reflect.Value) ([]byte, error) { var err error - if (ctx.options.omitempty || options.omitempty) && isEmptyValue(v) { - return b, nil - } - if !ctx.inline { b = enc.encodeComment(ctx.indent, options.comment, b) + b = enc.commented(ctx.commented, b) + b = enc.indent(ctx.indent, b) } - b = enc.indent(ctx.indent, b) b = enc.encodeKey(b, ctx.key) b = append(b, " = "...) @@ -352,8 +411,17 @@ func (enc *Encoder) encodeKv(b []byte, ctx encoderCtx, options valueOptions, v r return b, nil } +func (enc *Encoder) commented(commented bool, b []byte) []byte { + if commented { + return append(b, "# "...) + } + return b +} + func isEmptyValue(v reflect.Value) bool { switch v.Kind() { + case reflect.Struct: + return isEmptyStruct(v) case reflect.Array, reflect.Map, reflect.Slice, reflect.String: return v.Len() == 0 case reflect.Bool: @@ -370,6 +438,34 @@ func isEmptyValue(v reflect.Value) bool { return false } +func isEmptyStruct(v reflect.Value) bool { + // TODO: merge with walkStruct and cache. + typ := v.Type() + for i := 0; i < typ.NumField(); i++ { + fieldType := typ.Field(i) + + // only consider exported fields + if fieldType.PkgPath != "" { + continue + } + + tag := fieldType.Tag.Get("toml") + + // special field name to skip field + if tag == "-" { + continue + } + + f := v.Field(i) + + if !isEmptyValue(f) { + return false + } + } + + return true +} + const literalQuote = '\'' func (enc *Encoder) encodeString(b []byte, v string, options valueOptions) []byte { @@ -383,7 +479,7 @@ func (enc *Encoder) encodeString(b []byte, v string, options valueOptions) []byt func needsQuoting(v string) bool { // TODO: vectorize for _, b := range []byte(v) { - if b == '\'' || b == '\r' || b == '\n' || invalidAscii(b) { + if b == '\'' || b == '\r' || b == '\n' || characters.InvalidAscii(b) { return true } } @@ -399,7 +495,6 @@ func (enc *Encoder) encodeLiteralString(b []byte, v string) []byte { return b } -//nolint:cyclop func (enc *Encoder) encodeQuotedString(multiline bool, b []byte, v string) []byte { stringQuote := `"` @@ -471,6 +566,8 @@ func (enc *Encoder) encodeTableHeader(ctx encoderCtx, b []byte) ([]byte, error) b = enc.encodeComment(ctx.indent, ctx.options.comment, b) + b = enc.commented(ctx.commented, b) + b = enc.indent(ctx.indent, b) b = append(b, '[') @@ -522,11 +619,35 @@ func (enc *Encoder) encodeKey(b []byte, k string) []byte { } } -func (enc *Encoder) encodeMap(b []byte, ctx encoderCtx, v reflect.Value) ([]byte, error) { - if v.Type().Key().Kind() != reflect.String { - return nil, fmt.Errorf("toml: type %s is not supported as a map key", v.Type().Key().Kind()) +func (enc *Encoder) keyToString(k reflect.Value) (string, error) { + keyType := k.Type() + switch { + case keyType.Kind() == reflect.String: + return k.String(), nil + + case keyType.Implements(textMarshalerType): + keyB, err := k.Interface().(encoding.TextMarshaler).MarshalText() + if err != nil { + return "", fmt.Errorf("toml: error marshalling key %v from text: %w", k, err) + } + return string(keyB), nil + + case keyType.Kind() == reflect.Int || keyType.Kind() == reflect.Int8 || keyType.Kind() == reflect.Int16 || keyType.Kind() == reflect.Int32 || keyType.Kind() == reflect.Int64: + return strconv.FormatInt(k.Int(), 10), nil + + case keyType.Kind() == reflect.Uint || keyType.Kind() == reflect.Uint8 || keyType.Kind() == reflect.Uint16 || keyType.Kind() == reflect.Uint32 || keyType.Kind() == reflect.Uint64: + return strconv.FormatUint(k.Uint(), 10), nil + + case keyType.Kind() == reflect.Float32: + return strconv.FormatFloat(k.Float(), 'f', -1, 32), nil + + case keyType.Kind() == reflect.Float64: + return strconv.FormatFloat(k.Float(), 'f', -1, 64), nil } + return "", fmt.Errorf("toml: type %s is not supported as a map key", keyType.Kind()) +} +func (enc *Encoder) encodeMap(b []byte, ctx encoderCtx, v reflect.Value) ([]byte, error) { var ( t table emptyValueOptions valueOptions @@ -534,13 +655,17 @@ func (enc *Encoder) encodeMap(b []byte, ctx encoderCtx, v reflect.Value) ([]byte iter := v.MapRange() for iter.Next() { - k := iter.Key().String() v := iter.Value() if isNil(v) { continue } + k, err := enc.keyToString(iter.Key()) + if err != nil { + return nil, err + } + if willConvertToTableOrArrayTable(ctx, v) { t.pushTable(k, v, emptyValueOptions) } else { @@ -555,8 +680,8 @@ func (enc *Encoder) encodeMap(b []byte, ctx encoderCtx, v reflect.Value) ([]byte } func sortEntriesByKey(e []entry) { - sort.Slice(e, func(i, j int) bool { - return e[i].Key < e[j].Key + slices.SortFunc(e, func(a, b entry) int { + return strings.Compare(a.Key, b.Key) }) } @@ -619,6 +744,8 @@ func walkStruct(ctx encoderCtx, t *table, v reflect.Value) { if fieldType.Anonymous { if fieldType.Type.Kind() == reflect.Struct { walkStruct(ctx, t, f) + } else if fieldType.Type.Kind() == reflect.Ptr && !f.IsNil() && f.Elem().Kind() == reflect.Struct { + walkStruct(ctx, t, f.Elem()) } continue } else { @@ -633,6 +760,7 @@ func walkStruct(ctx encoderCtx, t *table, v reflect.Value) { options := valueOptions{ multiline: opts.multiline, omitempty: opts.omitempty, + commented: opts.commented, comment: fieldType.Tag.Get("comment"), } @@ -692,6 +820,7 @@ type tagOptions struct { multiline bool inline bool omitempty bool + commented bool } func parseTag(tag string) (string, tagOptions) { @@ -719,6 +848,8 @@ func parseTag(tag string) (string, tagOptions) { opts.inline = true case "omitempty": opts.omitempty = true + case "commented": + opts.commented = true } } @@ -746,10 +877,18 @@ func (enc *Encoder) encodeTable(b []byte, ctx encoderCtx, t table) ([]byte, erro } ctx.skipTableHeader = false + hasNonEmptyKV := false for _, kv := range t.kvs { + if shouldOmitEmpty(kv.Options, kv.Value) { + continue + } + hasNonEmptyKV = true + ctx.setKey(kv.Key) + ctx2 := ctx + ctx2.commented = kv.Options.commented || ctx2.commented - b, err = enc.encodeKv(b, ctx, kv.Options, kv.Value) + b, err = enc.encodeKv(b, ctx2, kv.Options, kv.Value) if err != nil { return nil, err } @@ -757,17 +896,30 @@ func (enc *Encoder) encodeTable(b []byte, ctx encoderCtx, t table) ([]byte, erro b = append(b, '\n') } + first := true for _, table := range t.tables { + if shouldOmitEmpty(table.Options, table.Value) { + continue + } + if first { + first = false + if hasNonEmptyKV { + b = append(b, '\n') + } + } else { + b = append(b, "\n"...) + } + ctx.setKey(table.Key) ctx.options = table.Options + ctx2 := ctx + ctx2.commented = ctx2.commented || ctx.options.commented - b, err = enc.encode(b, ctx, table.Value) + b, err = enc.encode(b, ctx2, table.Value) if err != nil { return nil, err } - - b = append(b, '\n') } return b, nil @@ -780,6 +932,10 @@ func (enc *Encoder) encodeTableInline(b []byte, ctx encoderCtx, t table) ([]byte first := true for _, kv := range t.kvs { + if shouldOmitEmpty(kv.Options, kv.Value) { + continue + } + if first { first = false } else { @@ -795,7 +951,7 @@ func (enc *Encoder) encodeTableInline(b []byte, ctx encoderCtx, t table) ([]byte } if len(t.tables) > 0 { - panic("inline table cannot contain nested tables, online key-values") + panic("inline table cannot contain nested tables, only key-values") } b = append(b, "}"...) @@ -807,7 +963,7 @@ func willConvertToTable(ctx encoderCtx, v reflect.Value) bool { if !v.IsValid() { return false } - if v.Type() == timeType || v.Type().Implements(textMarshalerType) || (v.Kind() != reflect.Ptr && v.CanAddr() && reflect.PtrTo(v.Type()).Implements(textMarshalerType)) { + if v.Type() == timeType || v.Type().Implements(textMarshalerType) || (v.Kind() != reflect.Ptr && v.CanAddr() && reflect.PointerTo(v.Type()).Implements(textMarshalerType)) { return false } @@ -838,7 +994,7 @@ func willConvertToTableOrArrayTable(ctx encoderCtx, v reflect.Value) bool { return willConvertToTableOrArrayTable(ctx, v.Elem()) } - if t.Kind() == reflect.Slice { + if t.Kind() == reflect.Slice || t.Kind() == reflect.Array { if v.Len() == 0 { // An empty slice should be a kv = []. return false @@ -878,6 +1034,13 @@ func (enc *Encoder) encodeSliceAsArrayTable(b []byte, ctx encoderCtx, v reflect. ctx.shiftKey() scratch := make([]byte, 0, 64) + + scratch = enc.commented(ctx.commented, scratch) + + if enc.indentTables { + scratch = enc.indent(ctx.indent, scratch) + } + scratch = append(scratch, "[["...) for i, k := range ctx.parentKey { @@ -893,7 +1056,15 @@ func (enc *Encoder) encodeSliceAsArrayTable(b []byte, ctx encoderCtx, v reflect. b = enc.encodeComment(ctx.indent, ctx.options.comment, b) + if enc.indentTables { + ctx.indent++ + } + for i := 0; i < v.Len(); i++ { + if i != 0 { + b = append(b, "\n"...) + } + b = append(b, scratch...) var err error diff --git a/vendor/github.com/pelletier/go-toml/v2/strict.go b/vendor/github.com/pelletier/go-toml/v2/strict.go index b7830d13..802e7e4d 100644 --- a/vendor/github.com/pelletier/go-toml/v2/strict.go +++ b/vendor/github.com/pelletier/go-toml/v2/strict.go @@ -1,9 +1,9 @@ package toml import ( - "github.com/pelletier/go-toml/v2/internal/ast" "github.com/pelletier/go-toml/v2/internal/danger" "github.com/pelletier/go-toml/v2/internal/tracker" + "github.com/pelletier/go-toml/v2/unstable" ) type strict struct { @@ -12,10 +12,10 @@ type strict struct { // Tracks the current key being processed. key tracker.KeyTracker - missing []decodeError + missing []unstable.ParserError } -func (s *strict) EnterTable(node *ast.Node) { +func (s *strict) EnterTable(node *unstable.Node) { if !s.Enabled { return } @@ -23,7 +23,7 @@ func (s *strict) EnterTable(node *ast.Node) { s.key.UpdateTable(node) } -func (s *strict) EnterArrayTable(node *ast.Node) { +func (s *strict) EnterArrayTable(node *unstable.Node) { if !s.Enabled { return } @@ -31,7 +31,7 @@ func (s *strict) EnterArrayTable(node *ast.Node) { s.key.UpdateArrayTable(node) } -func (s *strict) EnterKeyValue(node *ast.Node) { +func (s *strict) EnterKeyValue(node *unstable.Node) { if !s.Enabled { return } @@ -39,7 +39,7 @@ func (s *strict) EnterKeyValue(node *ast.Node) { s.key.Push(node) } -func (s *strict) ExitKeyValue(node *ast.Node) { +func (s *strict) ExitKeyValue(node *unstable.Node) { if !s.Enabled { return } @@ -47,27 +47,27 @@ func (s *strict) ExitKeyValue(node *ast.Node) { s.key.Pop(node) } -func (s *strict) MissingTable(node *ast.Node) { +func (s *strict) MissingTable(node *unstable.Node) { if !s.Enabled { return } - s.missing = append(s.missing, decodeError{ - highlight: keyLocation(node), - message: "missing table", - key: s.key.Key(), + s.missing = append(s.missing, unstable.ParserError{ + Highlight: keyLocation(node), + Message: "missing table", + Key: s.key.Key(), }) } -func (s *strict) MissingField(node *ast.Node) { +func (s *strict) MissingField(node *unstable.Node) { if !s.Enabled { return } - s.missing = append(s.missing, decodeError{ - highlight: keyLocation(node), - message: "missing field", - key: s.key.Key(), + s.missing = append(s.missing, unstable.ParserError{ + Highlight: keyLocation(node), + Message: "missing field", + Key: s.key.Key(), }) } @@ -88,7 +88,7 @@ func (s *strict) Error(doc []byte) error { return err } -func keyLocation(node *ast.Node) []byte { +func keyLocation(node *unstable.Node) []byte { k := node.Key() hasOne := k.Next() diff --git a/vendor/github.com/pelletier/go-toml/v2/types.go b/vendor/github.com/pelletier/go-toml/v2/types.go index 630a4546..3c6b8fe5 100644 --- a/vendor/github.com/pelletier/go-toml/v2/types.go +++ b/vendor/github.com/pelletier/go-toml/v2/types.go @@ -6,9 +6,9 @@ import ( "time" ) -var timeType = reflect.TypeOf(time.Time{}) -var textMarshalerType = reflect.TypeOf(new(encoding.TextMarshaler)).Elem() -var textUnmarshalerType = reflect.TypeOf(new(encoding.TextUnmarshaler)).Elem() -var mapStringInterfaceType = reflect.TypeOf(map[string]interface{}{}) -var sliceInterfaceType = reflect.TypeOf([]interface{}{}) +var timeType = reflect.TypeOf((*time.Time)(nil)).Elem() +var textMarshalerType = reflect.TypeOf((*encoding.TextMarshaler)(nil)).Elem() +var textUnmarshalerType = reflect.TypeOf((*encoding.TextUnmarshaler)(nil)).Elem() +var mapStringInterfaceType = reflect.TypeOf(map[string]interface{}(nil)) +var sliceInterfaceType = reflect.TypeOf([]interface{}(nil)) var stringType = reflect.TypeOf("") diff --git a/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go b/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go index b3596f6d..c3df8bee 100644 --- a/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go +++ b/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go @@ -5,26 +5,24 @@ import ( "errors" "fmt" "io" - "io/ioutil" "math" "reflect" + "strconv" "strings" "sync/atomic" "time" - "github.com/pelletier/go-toml/v2/internal/ast" "github.com/pelletier/go-toml/v2/internal/danger" "github.com/pelletier/go-toml/v2/internal/tracker" + "github.com/pelletier/go-toml/v2/unstable" ) // Unmarshal deserializes a TOML document into a Go value. // // It is a shortcut for Decoder.Decode() with the default options. func Unmarshal(data []byte, v interface{}) error { - p := parser{} - p.Reset(data) - d := decoder{p: &p} - + d := decoder{} + d.p.Reset(data) return d.FromParser(v) } @@ -35,6 +33,9 @@ type Decoder struct { // global settings strict bool + + // toggles unmarshaler interface + unmarshalerInterface bool } // NewDecoder creates a new Decoder that will read from r. @@ -54,13 +55,31 @@ func (d *Decoder) DisallowUnknownFields() *Decoder { return d } +// EnableUnmarshalerInterface allows to enable unmarshaler interface. +// +// With this feature enabled, types implementing the unstable/Unmarshaler +// interface can be decoded from any structure of the document. It allows types +// that don't have a straightfoward TOML representation to provide their own +// decoding logic. +// +// Currently, types can only decode from a single value. Tables and array tables +// are not supported. +// +// *Unstable:* This method does not follow the compatibility guarantees of +// semver. It can be changed or removed without a new major version being +// issued. +func (d *Decoder) EnableUnmarshalerInterface() *Decoder { + d.unmarshalerInterface = true + return d +} + // Decode the whole content of r into v. // // By default, values in the document that don't exist in the target Go value // are ignored. See Decoder.DisallowUnknownFields() to change this behavior. // // When a TOML local date, time, or date-time is decoded into a time.Time, its -// value is represented in time.Local timezone. Otherwise the approriate Local* +// value is represented in time.Local timezone. Otherwise the appropriate Local* // structure is used. For time values, precision up to the nanosecond is // supported by truncating extra digits. // @@ -79,43 +98,42 @@ func (d *Decoder) DisallowUnknownFields() *Decoder { // strict mode and a field is missing, a `toml.StrictMissingError` is // returned. In any other case, this function returns a standard Go error. // -// Type mapping +// # Type mapping // // List of supported TOML types and their associated accepted Go types: // -// String -> string -// Integer -> uint*, int*, depending on size -// Float -> float*, depending on size -// Boolean -> bool -// Offset Date-Time -> time.Time -// Local Date-time -> LocalDateTime, time.Time -// Local Date -> LocalDate, time.Time -// Local Time -> LocalTime, time.Time -// Array -> slice and array, depending on elements types -// Table -> map and struct -// Inline Table -> same as Table -// Array of Tables -> same as Array and Table +// String -> string +// Integer -> uint*, int*, depending on size +// Float -> float*, depending on size +// Boolean -> bool +// Offset Date-Time -> time.Time +// Local Date-time -> LocalDateTime, time.Time +// Local Date -> LocalDate, time.Time +// Local Time -> LocalTime, time.Time +// Array -> slice and array, depending on elements types +// Table -> map and struct +// Inline Table -> same as Table +// Array of Tables -> same as Array and Table func (d *Decoder) Decode(v interface{}) error { - b, err := ioutil.ReadAll(d.r) + b, err := io.ReadAll(d.r) if err != nil { return fmt.Errorf("toml: %w", err) } - p := parser{} - p.Reset(b) dec := decoder{ - p: &p, strict: strict{ Enabled: d.strict, }, + unmarshalerInterface: d.unmarshalerInterface, } + dec.p.Reset(b) return dec.FromParser(v) } type decoder struct { // Which parser instance in use for this decoding session. - p *parser + p unstable.Parser // Flag indicating that the current expression is stashed. // If set to true, calling nextExpr will not actually pull a new expression @@ -123,10 +141,14 @@ type decoder struct { stashedExpr bool // Skip expressions until a table is found. This is set to true when a - // table could not be create (missing field in map), so all KV expressions + // table could not be created (missing field in map), so all KV expressions // need to be skipped. skipUntilTable bool + // Flag indicating that the current array/slice table should be cleared because + // it is the first encounter of an array table. + clearArrayTable bool + // Tracks position in Go arrays. // This is used when decoding [[array tables]] into Go arrays. Given array // tables are separate TOML expression, we need to keep track of where we @@ -139,6 +161,9 @@ type decoder struct { // Strict mode strict strict + // Flag that enables/disables unmarshaler interface. + unmarshalerInterface bool + // Current context for the error. errorContext *errorContext } @@ -149,15 +174,19 @@ type errorContext struct { } func (d *decoder) typeMismatchError(toml string, target reflect.Type) error { + return fmt.Errorf("toml: %s", d.typeMismatchString(toml, target)) +} + +func (d *decoder) typeMismatchString(toml string, target reflect.Type) string { if d.errorContext != nil && d.errorContext.Struct != nil { ctx := d.errorContext f := ctx.Struct.FieldByIndex(ctx.Field) - return fmt.Errorf("toml: cannot decode TOML %s into struct field %s.%s of type %s", toml, ctx.Struct, f.Name, f.Type) + return fmt.Sprintf("cannot decode TOML %s into struct field %s.%s of type %s", toml, ctx.Struct, f.Name, f.Type) } - return fmt.Errorf("toml: cannot decode TOML %s into a Go value of type %s", toml, target) + return fmt.Sprintf("cannot decode TOML %s into a Go value of type %s", toml, target) } -func (d *decoder) expr() *ast.Node { +func (d *decoder) expr() *unstable.Node { return d.p.Expression() } @@ -208,12 +237,12 @@ func (d *decoder) FromParser(v interface{}) error { err := d.fromParser(r) if err == nil { - return d.strict.Error(d.p.data) + return d.strict.Error(d.p.Data()) } - var e *decodeError + var e *unstable.ParserError if errors.As(err, &e) { - return wrapDecodeError(d.p.data, e) + return wrapDecodeError(d.p.Data(), e) } return err @@ -234,42 +263,44 @@ func (d *decoder) fromParser(root reflect.Value) error { Rules for the unmarshal code: - The stack is used to keep track of which values need to be set where. -- handle* functions <=> switch on a given ast.Kind. +- handle* functions <=> switch on a given unstable.Kind. - unmarshalX* functions need to unmarshal a node of kind X. - An "object" is either a struct or a map. */ -func (d *decoder) handleRootExpression(expr *ast.Node, v reflect.Value) error { +func (d *decoder) handleRootExpression(expr *unstable.Node, v reflect.Value) error { var x reflect.Value var err error + var first bool // used for to clear array tables on first use - if !(d.skipUntilTable && expr.Kind == ast.KeyValue) { - err = d.seen.CheckExpression(expr) + if !(d.skipUntilTable && expr.Kind == unstable.KeyValue) { + first, err = d.seen.CheckExpression(expr) if err != nil { return err } } switch expr.Kind { - case ast.KeyValue: + case unstable.KeyValue: if d.skipUntilTable { return nil } x, err = d.handleKeyValue(expr, v) - case ast.Table: + case unstable.Table: d.skipUntilTable = false d.strict.EnterTable(expr) x, err = d.handleTable(expr.Key(), v) - case ast.ArrayTable: + case unstable.ArrayTable: d.skipUntilTable = false d.strict.EnterArrayTable(expr) + d.clearArrayTable = first x, err = d.handleArrayTable(expr.Key(), v) default: panic(fmt.Errorf("parser should not permit expression of kind %s at document root", expr.Kind)) } if d.skipUntilTable { - if expr.Kind == ast.Table || expr.Kind == ast.ArrayTable { + if expr.Kind == unstable.Table || expr.Kind == unstable.ArrayTable { d.strict.MissingTable(expr) } } else if err == nil && x.IsValid() { @@ -279,14 +310,14 @@ func (d *decoder) handleRootExpression(expr *ast.Node, v reflect.Value) error { return err } -func (d *decoder) handleArrayTable(key ast.Iterator, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleArrayTable(key unstable.Iterator, v reflect.Value) (reflect.Value, error) { if key.Next() { return d.handleArrayTablePart(key, v) } return d.handleKeyValues(v) } -func (d *decoder) handleArrayTableCollectionLast(key ast.Iterator, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleArrayTableCollectionLast(key unstable.Iterator, v reflect.Value) (reflect.Value, error) { switch v.Kind() { case reflect.Interface: elem := v.Elem() @@ -303,6 +334,10 @@ func (d *decoder) handleArrayTableCollectionLast(key ast.Iterator, v reflect.Val reflect.Copy(nelem, elem) elem = nelem } + if d.clearArrayTable && elem.Len() > 0 { + elem.SetLen(0) + d.clearArrayTable = false + } } return d.handleArrayTableCollectionLast(key, elem) case reflect.Ptr: @@ -321,6 +356,10 @@ func (d *decoder) handleArrayTableCollectionLast(key ast.Iterator, v reflect.Val return v, nil case reflect.Slice: + if d.clearArrayTable && v.Len() > 0 { + v.SetLen(0) + d.clearArrayTable = false + } elemType := v.Type().Elem() var elem reflect.Value if elemType.Kind() == reflect.Interface { @@ -339,21 +378,21 @@ func (d *decoder) handleArrayTableCollectionLast(key ast.Iterator, v reflect.Val case reflect.Array: idx := d.arrayIndex(true, v) if idx >= v.Len() { - return v, fmt.Errorf("toml: cannot decode array table into %s at position %d", v.Type(), idx) + return v, fmt.Errorf("%s at position %d", d.typeMismatchError("array table", v.Type()), idx) } elem := v.Index(idx) _, err := d.handleArrayTable(key, elem) return v, err + default: + return reflect.Value{}, d.typeMismatchError("array table", v.Type()) } - - return d.handleArrayTable(key, v) } // When parsing an array table expression, each part of the key needs to be // evaluated like a normal key, but if it returns a collection, it also needs to // point to the last element of the collection. Unless it is the last part of // the key, then it needs to create a new element at the end. -func (d *decoder) handleArrayTableCollection(key ast.Iterator, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleArrayTableCollection(key unstable.Iterator, v reflect.Value) (reflect.Value, error) { if key.IsLast() { return d.handleArrayTableCollectionLast(key, v) } @@ -390,7 +429,7 @@ func (d *decoder) handleArrayTableCollection(key ast.Iterator, v reflect.Value) case reflect.Array: idx := d.arrayIndex(false, v) if idx >= v.Len() { - return v, fmt.Errorf("toml: cannot decode array table into %s at position %d", v.Type(), idx) + return v, fmt.Errorf("%s at position %d", d.typeMismatchError("array table", v.Type()), idx) } elem := v.Index(idx) _, err := d.handleArrayTable(key, elem) @@ -400,7 +439,7 @@ func (d *decoder) handleArrayTableCollection(key ast.Iterator, v reflect.Value) return d.handleArrayTable(key, v) } -func (d *decoder) handleKeyPart(key ast.Iterator, v reflect.Value, nextFn handlerFn, makeFn valueMakerFn) (reflect.Value, error) { +func (d *decoder) handleKeyPart(key unstable.Iterator, v reflect.Value, nextFn handlerFn, makeFn valueMakerFn) (reflect.Value, error) { var rv reflect.Value // First, dispatch over v to make sure it is a valid object. @@ -417,7 +456,10 @@ func (d *decoder) handleKeyPart(key ast.Iterator, v reflect.Value, nextFn handle vt := v.Type() // Create the key for the map element. Convert to key type. - mk := reflect.ValueOf(string(key.Node().Data)).Convert(vt.Key()) + mk, err := d.keyFromData(vt.Key(), key.Node().Data) + if err != nil { + return reflect.Value{}, err + } // If the map does not exist, create it. if v.IsNil() { @@ -483,7 +525,7 @@ func (d *decoder) handleKeyPart(key ast.Iterator, v reflect.Value, nextFn handle d.errorContext.Struct = t d.errorContext.Field = path - f := v.FieldByIndex(path) + f := fieldByIndex(v, path) x, err := nextFn(key, f) if err != nil || d.skipUntilTable { return reflect.Value{}, err @@ -518,7 +560,7 @@ func (d *decoder) handleKeyPart(key ast.Iterator, v reflect.Value, nextFn handle // HandleArrayTablePart navigates the Go structure v using the key v. It is // only used for the prefix (non-last) parts of an array-table. When // encountering a collection, it should go to the last element. -func (d *decoder) handleArrayTablePart(key ast.Iterator, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleArrayTablePart(key unstable.Iterator, v reflect.Value) (reflect.Value, error) { var makeFn valueMakerFn if key.IsLast() { makeFn = makeSliceInterface @@ -530,10 +572,10 @@ func (d *decoder) handleArrayTablePart(key ast.Iterator, v reflect.Value) (refle // HandleTable returns a reference when it has checked the next expression but // cannot handle it. -func (d *decoder) handleTable(key ast.Iterator, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleTable(key unstable.Iterator, v reflect.Value) (reflect.Value, error) { if v.Kind() == reflect.Slice { if v.Len() == 0 { - return reflect.Value{}, newDecodeError(key.Node().Data, "cannot store a table in a slice") + return reflect.Value{}, unstable.NewParserError(key.Node().Data, "cannot store a table in a slice") } elem := v.Index(v.Len() - 1) x, err := d.handleTable(key, elem) @@ -560,7 +602,7 @@ func (d *decoder) handleKeyValues(v reflect.Value) (reflect.Value, error) { var rv reflect.Value for d.nextExpr() { expr := d.expr() - if expr.Kind != ast.KeyValue { + if expr.Kind != unstable.KeyValue { // Stash the expression so that fromParser can just loop and use // the right handler. // We could just recurse ourselves here, but at least this gives a @@ -569,7 +611,7 @@ func (d *decoder) handleKeyValues(v reflect.Value) (reflect.Value, error) { break } - err := d.seen.CheckExpression(expr) + _, err := d.seen.CheckExpression(expr) if err != nil { return reflect.Value{}, err } @@ -587,7 +629,7 @@ func (d *decoder) handleKeyValues(v reflect.Value) (reflect.Value, error) { } type ( - handlerFn func(key ast.Iterator, v reflect.Value) (reflect.Value, error) + handlerFn func(key unstable.Iterator, v reflect.Value) (reflect.Value, error) valueMakerFn func() reflect.Value ) @@ -599,11 +641,11 @@ func makeSliceInterface() reflect.Value { return reflect.MakeSlice(sliceInterfaceType, 0, 16) } -func (d *decoder) handleTablePart(key ast.Iterator, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleTablePart(key unstable.Iterator, v reflect.Value) (reflect.Value, error) { return d.handleKeyPart(key, v, d.handleTable, makeMapStringInterface) } -func (d *decoder) tryTextUnmarshaler(node *ast.Node, v reflect.Value) (bool, error) { +func (d *decoder) tryTextUnmarshaler(node *unstable.Node, v reflect.Value) (bool, error) { // Special case for time, because we allow to unmarshal to it from // different kind of AST nodes. if v.Type() == timeType { @@ -613,7 +655,7 @@ func (d *decoder) tryTextUnmarshaler(node *ast.Node, v reflect.Value) (bool, err if v.CanAddr() && v.Addr().Type().Implements(textUnmarshalerType) { err := v.Addr().Interface().(encoding.TextUnmarshaler).UnmarshalText(node.Data) if err != nil { - return false, newDecodeError(d.p.Raw(node.Raw), "%w", err) + return false, unstable.NewParserError(d.p.Raw(node.Raw), "%w", err) } return true, nil @@ -622,43 +664,51 @@ func (d *decoder) tryTextUnmarshaler(node *ast.Node, v reflect.Value) (bool, err return false, nil } -func (d *decoder) handleValue(value *ast.Node, v reflect.Value) error { +func (d *decoder) handleValue(value *unstable.Node, v reflect.Value) error { for v.Kind() == reflect.Ptr { v = initAndDereferencePointer(v) } + if d.unmarshalerInterface { + if v.CanAddr() && v.Addr().CanInterface() { + if outi, ok := v.Addr().Interface().(unstable.Unmarshaler); ok { + return outi.UnmarshalTOML(value) + } + } + } + ok, err := d.tryTextUnmarshaler(value, v) if ok || err != nil { return err } switch value.Kind { - case ast.String: + case unstable.String: return d.unmarshalString(value, v) - case ast.Integer: + case unstable.Integer: return d.unmarshalInteger(value, v) - case ast.Float: + case unstable.Float: return d.unmarshalFloat(value, v) - case ast.Bool: + case unstable.Bool: return d.unmarshalBool(value, v) - case ast.DateTime: + case unstable.DateTime: return d.unmarshalDateTime(value, v) - case ast.LocalDate: + case unstable.LocalDate: return d.unmarshalLocalDate(value, v) - case ast.LocalTime: + case unstable.LocalTime: return d.unmarshalLocalTime(value, v) - case ast.LocalDateTime: + case unstable.LocalDateTime: return d.unmarshalLocalDateTime(value, v) - case ast.InlineTable: + case unstable.InlineTable: return d.unmarshalInlineTable(value, v) - case ast.Array: + case unstable.Array: return d.unmarshalArray(value, v) default: panic(fmt.Errorf("handleValue not implemented for %s", value.Kind)) } } -func (d *decoder) unmarshalArray(array *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalArray(array *unstable.Node, v reflect.Value) error { switch v.Kind() { case reflect.Slice: if v.IsNil() { @@ -729,7 +779,7 @@ func (d *decoder) unmarshalArray(array *ast.Node, v reflect.Value) error { return nil } -func (d *decoder) unmarshalInlineTable(itable *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalInlineTable(itable *unstable.Node, v reflect.Value) error { // Make sure v is an initialized object. switch v.Kind() { case reflect.Map: @@ -746,7 +796,7 @@ func (d *decoder) unmarshalInlineTable(itable *ast.Node, v reflect.Value) error } return d.unmarshalInlineTable(itable, elem) default: - return newDecodeError(itable.Data, "cannot store inline table in Go type %s", v.Kind()) + return unstable.NewParserError(d.p.Raw(itable.Raw), "cannot store inline table in Go type %s", v.Kind()) } it := itable.Children() @@ -765,7 +815,7 @@ func (d *decoder) unmarshalInlineTable(itable *ast.Node, v reflect.Value) error return nil } -func (d *decoder) unmarshalDateTime(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalDateTime(value *unstable.Node, v reflect.Value) error { dt, err := parseDateTime(value.Data) if err != nil { return err @@ -775,7 +825,7 @@ func (d *decoder) unmarshalDateTime(value *ast.Node, v reflect.Value) error { return nil } -func (d *decoder) unmarshalLocalDate(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalLocalDate(value *unstable.Node, v reflect.Value) error { ld, err := parseLocalDate(value.Data) if err != nil { return err @@ -792,28 +842,28 @@ func (d *decoder) unmarshalLocalDate(value *ast.Node, v reflect.Value) error { return nil } -func (d *decoder) unmarshalLocalTime(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalLocalTime(value *unstable.Node, v reflect.Value) error { lt, rest, err := parseLocalTime(value.Data) if err != nil { return err } if len(rest) > 0 { - return newDecodeError(rest, "extra characters at the end of a local time") + return unstable.NewParserError(rest, "extra characters at the end of a local time") } v.Set(reflect.ValueOf(lt)) return nil } -func (d *decoder) unmarshalLocalDateTime(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalLocalDateTime(value *unstable.Node, v reflect.Value) error { ldt, rest, err := parseLocalDateTime(value.Data) if err != nil { return err } if len(rest) > 0 { - return newDecodeError(rest, "extra characters at the end of a local date time") + return unstable.NewParserError(rest, "extra characters at the end of a local date time") } if v.Type() == timeType { @@ -828,7 +878,7 @@ func (d *decoder) unmarshalLocalDateTime(value *ast.Node, v reflect.Value) error return nil } -func (d *decoder) unmarshalBool(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalBool(value *unstable.Node, v reflect.Value) error { b := value.Data[0] == 't' switch v.Kind() { @@ -837,13 +887,13 @@ func (d *decoder) unmarshalBool(value *ast.Node, v reflect.Value) error { case reflect.Interface: v.Set(reflect.ValueOf(b)) default: - return newDecodeError(value.Data, "cannot assign boolean to a %t", b) + return unstable.NewParserError(value.Data, "cannot assign boolean to a %t", b) } return nil } -func (d *decoder) unmarshalFloat(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalFloat(value *unstable.Node, v reflect.Value) error { f, err := parseFloat(value.Data) if err != nil { return err @@ -854,13 +904,13 @@ func (d *decoder) unmarshalFloat(value *ast.Node, v reflect.Value) error { v.SetFloat(f) case reflect.Float32: if f > math.MaxFloat32 { - return newDecodeError(value.Data, "number %f does not fit in a float32", f) + return unstable.NewParserError(value.Data, "number %f does not fit in a float32", f) } v.SetFloat(f) case reflect.Interface: v.Set(reflect.ValueOf(f)) default: - return newDecodeError(value.Data, "float cannot be assigned to %s", v.Kind()) + return unstable.NewParserError(value.Data, "float cannot be assigned to %s", v.Kind()) } return nil @@ -886,7 +936,12 @@ func init() { } } -func (d *decoder) unmarshalInteger(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalInteger(value *unstable.Node, v reflect.Value) error { + kind := v.Kind() + if kind == reflect.Float32 || kind == reflect.Float64 { + return d.unmarshalFloat(value, v) + } + i, err := parseInteger(value.Data) if err != nil { return err @@ -894,7 +949,7 @@ func (d *decoder) unmarshalInteger(value *ast.Node, v reflect.Value) error { var r reflect.Value - switch v.Kind() { + switch kind { case reflect.Int64: v.SetInt(i) return nil @@ -955,7 +1010,7 @@ func (d *decoder) unmarshalInteger(value *ast.Node, v reflect.Value) error { case reflect.Interface: r = reflect.ValueOf(i) default: - return d.typeMismatchError("integer", v.Type()) + return unstable.NewParserError(d.p.Raw(value.Raw), d.typeMismatchString("integer", v.Type())) } if !r.Type().AssignableTo(v.Type()) { @@ -967,20 +1022,20 @@ func (d *decoder) unmarshalInteger(value *ast.Node, v reflect.Value) error { return nil } -func (d *decoder) unmarshalString(value *ast.Node, v reflect.Value) error { +func (d *decoder) unmarshalString(value *unstable.Node, v reflect.Value) error { switch v.Kind() { case reflect.String: v.SetString(string(value.Data)) case reflect.Interface: v.Set(reflect.ValueOf(string(value.Data))) default: - return newDecodeError(d.p.Raw(value.Raw), "cannot store TOML string into a Go %s", v.Kind()) + return unstable.NewParserError(d.p.Raw(value.Raw), d.typeMismatchString("string", v.Type())) } return nil } -func (d *decoder) handleKeyValue(expr *ast.Node, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleKeyValue(expr *unstable.Node, v reflect.Value) (reflect.Value, error) { d.strict.EnterKeyValue(expr) v, err := d.handleKeyValueInner(expr.Key(), expr.Value(), v) @@ -994,7 +1049,7 @@ func (d *decoder) handleKeyValue(expr *ast.Node, v reflect.Value) (reflect.Value return v, err } -func (d *decoder) handleKeyValueInner(key ast.Iterator, value *ast.Node, v reflect.Value) (reflect.Value, error) { +func (d *decoder) handleKeyValueInner(key unstable.Iterator, value *unstable.Node, v reflect.Value) (reflect.Value, error) { if key.Next() { // Still scoping the key return d.handleKeyValuePart(key, value, v) @@ -1004,7 +1059,59 @@ func (d *decoder) handleKeyValueInner(key ast.Iterator, value *ast.Node, v refle return reflect.Value{}, d.handleValue(value, v) } -func (d *decoder) handleKeyValuePart(key ast.Iterator, value *ast.Node, v reflect.Value) (reflect.Value, error) { +func (d *decoder) keyFromData(keyType reflect.Type, data []byte) (reflect.Value, error) { + switch { + case stringType.AssignableTo(keyType): + return reflect.ValueOf(string(data)), nil + + case stringType.ConvertibleTo(keyType): + return reflect.ValueOf(string(data)).Convert(keyType), nil + + case keyType.Implements(textUnmarshalerType): + mk := reflect.New(keyType.Elem()) + if err := mk.Interface().(encoding.TextUnmarshaler).UnmarshalText(data); err != nil { + return reflect.Value{}, fmt.Errorf("toml: error unmarshalling key type %s from text: %w", stringType, err) + } + return mk, nil + + case reflect.PointerTo(keyType).Implements(textUnmarshalerType): + mk := reflect.New(keyType) + if err := mk.Interface().(encoding.TextUnmarshaler).UnmarshalText(data); err != nil { + return reflect.Value{}, fmt.Errorf("toml: error unmarshalling key type %s from text: %w", stringType, err) + } + return mk.Elem(), nil + + case keyType.Kind() == reflect.Int || keyType.Kind() == reflect.Int8 || keyType.Kind() == reflect.Int16 || keyType.Kind() == reflect.Int32 || keyType.Kind() == reflect.Int64: + key, err := strconv.ParseInt(string(data), 10, 64) + if err != nil { + return reflect.Value{}, fmt.Errorf("toml: error parsing key of type %s from integer: %w", stringType, err) + } + return reflect.ValueOf(key).Convert(keyType), nil + case keyType.Kind() == reflect.Uint || keyType.Kind() == reflect.Uint8 || keyType.Kind() == reflect.Uint16 || keyType.Kind() == reflect.Uint32 || keyType.Kind() == reflect.Uint64: + key, err := strconv.ParseUint(string(data), 10, 64) + if err != nil { + return reflect.Value{}, fmt.Errorf("toml: error parsing key of type %s from unsigned integer: %w", stringType, err) + } + return reflect.ValueOf(key).Convert(keyType), nil + + case keyType.Kind() == reflect.Float32: + key, err := strconv.ParseFloat(string(data), 32) + if err != nil { + return reflect.Value{}, fmt.Errorf("toml: error parsing key of type %s from float: %w", stringType, err) + } + return reflect.ValueOf(float32(key)), nil + + case keyType.Kind() == reflect.Float64: + key, err := strconv.ParseFloat(string(data), 64) + if err != nil { + return reflect.Value{}, fmt.Errorf("toml: error parsing key of type %s from float: %w", stringType, err) + } + return reflect.ValueOf(float64(key)), nil + } + return reflect.Value{}, fmt.Errorf("toml: cannot convert map key of type %s to expected type %s", stringType, keyType) +} + +func (d *decoder) handleKeyValuePart(key unstable.Iterator, value *unstable.Node, v reflect.Value) (reflect.Value, error) { // contains the replacement for v var rv reflect.Value @@ -1014,16 +1121,9 @@ func (d *decoder) handleKeyValuePart(key ast.Iterator, value *ast.Node, v reflec case reflect.Map: vt := v.Type() - mk := reflect.ValueOf(string(key.Node().Data)) - mkt := stringType - - keyType := vt.Key() - if !mkt.AssignableTo(keyType) { - if !mkt.ConvertibleTo(keyType) { - return reflect.Value{}, fmt.Errorf("toml: cannot convert map key of type %s to expected type %s", mkt, keyType) - } - - mk = mk.Convert(keyType) + mk, err := d.keyFromData(vt.Key(), key.Node().Data) + if err != nil { + return reflect.Value{}, err } // If the map does not exist, create it. @@ -1034,15 +1134,9 @@ func (d *decoder) handleKeyValuePart(key ast.Iterator, value *ast.Node, v reflec mv := v.MapIndex(mk) set := false - if !mv.IsValid() { + if !mv.IsValid() || key.IsLast() { set = true mv = reflect.New(v.Type().Elem()).Elem() - } else { - if key.IsLast() { - var x interface{} - mv = reflect.ValueOf(&x).Elem() - set = true - } } nv, err := d.handleKeyValueInner(key, value, mv) @@ -1071,7 +1165,20 @@ func (d *decoder) handleKeyValuePart(key ast.Iterator, value *ast.Node, v reflec d.errorContext.Struct = t d.errorContext.Field = path - f := v.FieldByIndex(path) + f := fieldByIndex(v, path) + + if !f.CanAddr() { + // If the field is not addressable, need to take a slower path and + // make a copy of the struct itself to a new location. + nvp := reflect.New(v.Type()) + nvp.Elem().Set(v) + v = nvp.Elem() + _, err := d.handleKeyValuePart(key, value, v) + if err != nil { + return reflect.Value{}, err + } + return nvp.Elem(), nil + } x, err := d.handleKeyValueInner(key, value, f) if err != nil { return reflect.Value{}, err @@ -1135,6 +1242,21 @@ func initAndDereferencePointer(v reflect.Value) reflect.Value { return elem } +// Same as reflect.Value.FieldByIndex, but creates pointers if needed. +func fieldByIndex(v reflect.Value, path []int) reflect.Value { + for _, x := range path { + v = v.Field(x) + + if v.Kind() == reflect.Ptr { + if v.IsNil() { + v.Set(reflect.New(v.Type().Elem())) + } + v = v.Elem() + } + } + return v +} + type fieldPathsMap = map[string][]int var globalFieldPathsCache atomic.Value // map[danger.TypeID]fieldPathsMap @@ -1192,7 +1314,14 @@ func forEachField(t reflect.Type, path []int, do func(name string, path []int)) } if f.Anonymous && name == "" { - forEachField(f.Type, fieldPath, do) + t2 := f.Type + if t2.Kind() == reflect.Ptr { + t2 = t2.Elem() + } + + if t2.Kind() == reflect.Struct { + forEachField(t2, fieldPath, do) + } continue } diff --git a/vendor/github.com/pelletier/go-toml/v2/internal/ast/ast.go b/vendor/github.com/pelletier/go-toml/v2/unstable/ast.go similarity index 59% rename from vendor/github.com/pelletier/go-toml/v2/internal/ast/ast.go rename to vendor/github.com/pelletier/go-toml/v2/unstable/ast.go index 33c7f915..f526bf2c 100644 --- a/vendor/github.com/pelletier/go-toml/v2/internal/ast/ast.go +++ b/vendor/github.com/pelletier/go-toml/v2/unstable/ast.go @@ -1,4 +1,4 @@ -package ast +package unstable import ( "fmt" @@ -7,14 +7,17 @@ import ( "github.com/pelletier/go-toml/v2/internal/danger" ) -// Iterator starts uninitialized, you need to call Next() first. +// Iterator over a sequence of nodes. +// +// Starts uninitialized, you need to call Next() first. // // For example: // -// it := n.Children() -// for it.Next() { -// it.Node() -// } +// it := n.Children() +// for it.Next() { +// n := it.Node() +// // do something with n +// } type Iterator struct { started bool node *Node @@ -32,42 +35,31 @@ func (c *Iterator) Next() bool { } // IsLast returns true if the current node of the iterator is the last -// one. Subsequent call to Next() will return false. +// one. Subsequent calls to Next() will return false. func (c *Iterator) IsLast() bool { return c.node.next == 0 } -// Node returns a copy of the node pointed at by the iterator. +// Node returns a pointer to the node pointed at by the iterator. func (c *Iterator) Node() *Node { return c.node } -// Root contains a full AST. +// Node in a TOML expression AST. // -// It is immutable once constructed with Builder. -type Root struct { - nodes []Node -} - -// Iterator over the top level nodes. -func (r *Root) Iterator() Iterator { - it := Iterator{} - if len(r.nodes) > 0 { - it.node = &r.nodes[0] - } - return it -} - -func (r *Root) at(idx Reference) *Node { - return &r.nodes[idx] -} - -// Arrays have one child per element in the array. InlineTables have -// one child per key-value pair in the table. KeyValues have at least -// two children. The first one is the value. The rest make a -// potentially dotted key. Table and Array table have one child per -// element of the key they represent (same as KeyValue, but without -// the last node being the value). +// Depending on Kind, its sequence of children should be interpreted +// differently. +// +// - Array have one child per element in the array. +// - InlineTable have one child per key-value in the table (each of kind +// InlineTable). +// - KeyValue have at least two children. The first one is the value. The rest +// make a potentially dotted key. +// - Table and ArrayTable's children represent a dotted key (same as +// KeyValue, but without the first node being the value). +// +// When relevant, Raw describes the range of bytes this node is referring to in +// the input document. Use Parser.Raw() to retrieve the actual bytes. type Node struct { Kind Kind Raw Range // Raw bytes from the input. @@ -80,13 +72,13 @@ type Node struct { child int // 0 if no child } +// Range of bytes in the document. type Range struct { Offset uint32 Length uint32 } -// Next returns a copy of the next node, or an invalid Node if there -// is no next node. +// Next returns a pointer to the next node, or nil if there is no next node. func (n *Node) Next() *Node { if n.next == 0 { return nil @@ -96,9 +88,9 @@ func (n *Node) Next() *Node { return (*Node)(danger.Stride(ptr, size, n.next)) } -// Child returns a copy of the first child node of this node. Other -// children can be accessed calling Next on the first child. Returns -// an invalid Node if there is none. +// Child returns a pointer to the first child node of this node. Other children +// can be accessed calling Next on the first child. Returns an nil if this Node +// has no child. func (n *Node) Child() *Node { if n.child == 0 { return nil @@ -113,9 +105,9 @@ func (n *Node) Valid() bool { return n != nil } -// Key returns the child nodes making the Key on a supported -// node. Panics otherwise. They are guaranteed to be all be of the -// Kind Key. A simple key would return just one element. +// Key returns the children nodes making the Key on a supported node. Panics +// otherwise. They are guaranteed to be all be of the Kind Key. A simple key +// would return just one element. func (n *Node) Key() Iterator { switch n.Kind { case KeyValue: diff --git a/vendor/github.com/pelletier/go-toml/v2/unstable/builder.go b/vendor/github.com/pelletier/go-toml/v2/unstable/builder.go new file mode 100644 index 00000000..9538e30d --- /dev/null +++ b/vendor/github.com/pelletier/go-toml/v2/unstable/builder.go @@ -0,0 +1,71 @@ +package unstable + +// root contains a full AST. +// +// It is immutable once constructed with Builder. +type root struct { + nodes []Node +} + +// Iterator over the top level nodes. +func (r *root) Iterator() Iterator { + it := Iterator{} + if len(r.nodes) > 0 { + it.node = &r.nodes[0] + } + return it +} + +func (r *root) at(idx reference) *Node { + return &r.nodes[idx] +} + +type reference int + +const invalidReference reference = -1 + +func (r reference) Valid() bool { + return r != invalidReference +} + +type builder struct { + tree root + lastIdx int +} + +func (b *builder) Tree() *root { + return &b.tree +} + +func (b *builder) NodeAt(ref reference) *Node { + return b.tree.at(ref) +} + +func (b *builder) Reset() { + b.tree.nodes = b.tree.nodes[:0] + b.lastIdx = 0 +} + +func (b *builder) Push(n Node) reference { + b.lastIdx = len(b.tree.nodes) + b.tree.nodes = append(b.tree.nodes, n) + return reference(b.lastIdx) +} + +func (b *builder) PushAndChain(n Node) reference { + newIdx := len(b.tree.nodes) + b.tree.nodes = append(b.tree.nodes, n) + if b.lastIdx >= 0 { + b.tree.nodes[b.lastIdx].next = newIdx - b.lastIdx + } + b.lastIdx = newIdx + return reference(b.lastIdx) +} + +func (b *builder) AttachChild(parent reference, child reference) { + b.tree.nodes[parent].child = int(child) - int(parent) +} + +func (b *builder) Chain(from reference, to reference) { + b.tree.nodes[from].next = int(to) - int(from) +} diff --git a/vendor/github.com/pelletier/go-toml/v2/unstable/doc.go b/vendor/github.com/pelletier/go-toml/v2/unstable/doc.go new file mode 100644 index 00000000..7ff26c53 --- /dev/null +++ b/vendor/github.com/pelletier/go-toml/v2/unstable/doc.go @@ -0,0 +1,3 @@ +// Package unstable provides APIs that do not meet the backward compatibility +// guarantees yet. +package unstable diff --git a/vendor/github.com/pelletier/go-toml/v2/internal/ast/kind.go b/vendor/github.com/pelletier/go-toml/v2/unstable/kind.go similarity index 81% rename from vendor/github.com/pelletier/go-toml/v2/internal/ast/kind.go rename to vendor/github.com/pelletier/go-toml/v2/unstable/kind.go index 2b50c67f..ff9df1be 100644 --- a/vendor/github.com/pelletier/go-toml/v2/internal/ast/kind.go +++ b/vendor/github.com/pelletier/go-toml/v2/unstable/kind.go @@ -1,25 +1,26 @@ -package ast +package unstable import "fmt" +// Kind represents the type of TOML structure contained in a given Node. type Kind int const ( - // meta + // Meta Invalid Kind = iota Comment Key - // top level structures + // Top level structures Table ArrayTable KeyValue - // containers values + // Containers values Array InlineTable - // values + // Values String Bool Float @@ -30,6 +31,7 @@ const ( DateTime ) +// String implementation of fmt.Stringer. func (k Kind) String() string { switch k { case Invalid: diff --git a/vendor/github.com/pelletier/go-toml/v2/parser.go b/vendor/github.com/pelletier/go-toml/v2/unstable/parser.go similarity index 62% rename from vendor/github.com/pelletier/go-toml/v2/parser.go rename to vendor/github.com/pelletier/go-toml/v2/unstable/parser.go index 9859a795..50358a44 100644 --- a/vendor/github.com/pelletier/go-toml/v2/parser.go +++ b/vendor/github.com/pelletier/go-toml/v2/unstable/parser.go @@ -1,50 +1,108 @@ -package toml +package unstable import ( "bytes" + "fmt" "unicode" - "github.com/pelletier/go-toml/v2/internal/ast" + "github.com/pelletier/go-toml/v2/internal/characters" "github.com/pelletier/go-toml/v2/internal/danger" ) -type parser struct { - builder ast.Builder - ref ast.Reference +// ParserError describes an error relative to the content of the document. +// +// It cannot outlive the instance of Parser it refers to, and may cause panics +// if the parser is reset. +type ParserError struct { + Highlight []byte + Message string + Key []string // optional +} + +// Error is the implementation of the error interface. +func (e *ParserError) Error() string { + return e.Message +} + +// NewParserError is a convenience function to create a ParserError +// +// Warning: Highlight needs to be a subslice of Parser.data, so only slices +// returned by Parser.Raw are valid candidates. +func NewParserError(highlight []byte, format string, args ...interface{}) error { + return &ParserError{ + Highlight: highlight, + Message: fmt.Errorf(format, args...).Error(), + } +} + +// Parser scans over a TOML-encoded document and generates an iterative AST. +// +// To prime the Parser, first reset it with the contents of a TOML document. +// Then, process all top-level expressions sequentially. See Example. +// +// Don't forget to check Error() after you're done parsing. +// +// Each top-level expression needs to be fully processed before calling +// NextExpression() again. Otherwise, calls to various Node methods may panic if +// the parser has moved on the next expression. +// +// For performance reasons, go-toml doesn't make a copy of the input bytes to +// the parser. Make sure to copy all the bytes you need to outlive the slice +// given to the parser. +type Parser struct { data []byte + builder builder + ref reference left []byte err error first bool + + KeepComments bool +} + +// Data returns the slice provided to the last call to Reset. +func (p *Parser) Data() []byte { + return p.data } -func (p *parser) Range(b []byte) ast.Range { - return ast.Range{ +// Range returns a range description that corresponds to a given slice of the +// input. If the argument is not a subslice of the parser input, this function +// panics. +func (p *Parser) Range(b []byte) Range { + return Range{ Offset: uint32(danger.SubsliceOffset(p.data, b)), Length: uint32(len(b)), } } -func (p *parser) Raw(raw ast.Range) []byte { +// Raw returns the slice corresponding to the bytes in the given range. +func (p *Parser) Raw(raw Range) []byte { return p.data[raw.Offset : raw.Offset+raw.Length] } -func (p *parser) Reset(b []byte) { +// Reset brings the parser to its initial state for a given input. It wipes an +// reuses internal storage to reduce allocation. +func (p *Parser) Reset(b []byte) { p.builder.Reset() - p.ref = ast.InvalidReference + p.ref = invalidReference p.data = b p.left = b p.err = nil p.first = true } -//nolint:cyclop -func (p *parser) NextExpression() bool { +// NextExpression parses the next top-level expression. If an expression was +// successfully parsed, it returns true. If the parser is at the end of the +// document or an error occurred, it returns false. +// +// Retrieve the parsed expression with Expression(). +func (p *Parser) NextExpression() bool { if len(p.left) == 0 || p.err != nil { return false } p.builder.Reset() - p.ref = ast.InvalidReference + p.ref = invalidReference for { if len(p.left) == 0 || p.err != nil { @@ -73,15 +131,56 @@ func (p *parser) NextExpression() bool { } } -func (p *parser) Expression() *ast.Node { +// Expression returns a pointer to the node representing the last successfully +// parsed expression. +func (p *Parser) Expression() *Node { return p.builder.NodeAt(p.ref) } -func (p *parser) Error() error { +// Error returns any error that has occurred during parsing. +func (p *Parser) Error() error { return p.err } -func (p *parser) parseNewline(b []byte) ([]byte, error) { +// Position describes a position in the input. +type Position struct { + // Number of bytes from the beginning of the input. + Offset int + // Line number, starting at 1. + Line int + // Column number, starting at 1. + Column int +} + +// Shape describes the position of a range in the input. +type Shape struct { + Start Position + End Position +} + +func (p *Parser) position(b []byte) Position { + offset := danger.SubsliceOffset(p.data, b) + + lead := p.data[:offset] + + return Position{ + Offset: offset, + Line: bytes.Count(lead, []byte{'\n'}) + 1, + Column: len(lead) - bytes.LastIndex(lead, []byte{'\n'}), + } +} + +// Shape returns the shape of the given range in the input. Will +// panic if the range is not a subslice of the input. +func (p *Parser) Shape(r Range) Shape { + raw := p.Raw(r) + return Shape{ + Start: p.position(raw), + End: p.position(raw[r.Length:]), + } +} + +func (p *Parser) parseNewline(b []byte) ([]byte, error) { if b[0] == '\n' { return b[1:], nil } @@ -91,14 +190,27 @@ func (p *parser) parseNewline(b []byte) ([]byte, error) { return rest, err } - return nil, newDecodeError(b[0:1], "expected newline but got %#U", b[0]) + return nil, NewParserError(b[0:1], "expected newline but got %#U", b[0]) +} + +func (p *Parser) parseComment(b []byte) (reference, []byte, error) { + ref := invalidReference + data, rest, err := scanComment(b) + if p.KeepComments && err == nil { + ref = p.builder.Push(Node{ + Kind: Comment, + Raw: p.Range(data), + Data: data, + }) + } + return ref, rest, err } -func (p *parser) parseExpression(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseExpression(b []byte) (reference, []byte, error) { // expression = ws [ comment ] // expression =/ ws keyval ws [ comment ] // expression =/ ws table ws [ comment ] - ref := ast.InvalidReference + ref := invalidReference b = p.parseWhitespace(b) @@ -107,7 +219,7 @@ func (p *parser) parseExpression(b []byte) (ast.Reference, []byte, error) { } if b[0] == '#' { - _, rest, err := scanComment(b) + ref, rest, err := p.parseComment(b) return ref, rest, err } @@ -129,14 +241,17 @@ func (p *parser) parseExpression(b []byte) (ast.Reference, []byte, error) { b = p.parseWhitespace(b) if len(b) > 0 && b[0] == '#' { - _, rest, err := scanComment(b) + cref, rest, err := p.parseComment(b) + if cref != invalidReference { + p.builder.Chain(ref, cref) + } return ref, rest, err } return ref, b, nil } -func (p *parser) parseTable(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseTable(b []byte) (reference, []byte, error) { // table = std-table / array-table if len(b) > 1 && b[1] == '[' { return p.parseArrayTable(b) @@ -145,12 +260,12 @@ func (p *parser) parseTable(b []byte) (ast.Reference, []byte, error) { return p.parseStdTable(b) } -func (p *parser) parseArrayTable(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseArrayTable(b []byte) (reference, []byte, error) { // array-table = array-table-open key array-table-close // array-table-open = %x5B.5B ws ; [[ Double left square bracket // array-table-close = ws %x5D.5D ; ]] Double right square bracket - ref := p.builder.Push(ast.Node{ - Kind: ast.ArrayTable, + ref := p.builder.Push(Node{ + Kind: ArrayTable, }) b = b[2:] @@ -174,12 +289,12 @@ func (p *parser) parseArrayTable(b []byte) (ast.Reference, []byte, error) { return ref, b, err } -func (p *parser) parseStdTable(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseStdTable(b []byte) (reference, []byte, error) { // std-table = std-table-open key std-table-close // std-table-open = %x5B ws ; [ Left square bracket // std-table-close = ws %x5D ; ] Right square bracket - ref := p.builder.Push(ast.Node{ - Kind: ast.Table, + ref := p.builder.Push(Node{ + Kind: Table, }) b = b[1:] @@ -199,15 +314,15 @@ func (p *parser) parseStdTable(b []byte) (ast.Reference, []byte, error) { return ref, b, err } -func (p *parser) parseKeyval(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseKeyval(b []byte) (reference, []byte, error) { // keyval = key keyval-sep val - ref := p.builder.Push(ast.Node{ - Kind: ast.KeyValue, + ref := p.builder.Push(Node{ + Kind: KeyValue, }) key, b, err := p.parseKey(b) if err != nil { - return ast.InvalidReference, nil, err + return invalidReference, nil, err } // keyval-sep = ws %x3D ws ; = @@ -215,12 +330,12 @@ func (p *parser) parseKeyval(b []byte) (ast.Reference, []byte, error) { b = p.parseWhitespace(b) if len(b) == 0 { - return ast.InvalidReference, nil, newDecodeError(b, "expected = after a key, but the document ends there") + return invalidReference, nil, NewParserError(b, "expected = after a key, but the document ends there") } b, err = expect('=', b) if err != nil { - return ast.InvalidReference, nil, err + return invalidReference, nil, err } b = p.parseWhitespace(b) @@ -237,12 +352,12 @@ func (p *parser) parseKeyval(b []byte) (ast.Reference, []byte, error) { } //nolint:cyclop,funlen -func (p *parser) parseVal(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseVal(b []byte) (reference, []byte, error) { // val = string / boolean / array / inline-table / date-time / float / integer - ref := ast.InvalidReference + ref := invalidReference if len(b) == 0 { - return ref, nil, newDecodeError(b, "expected value, not eof") + return ref, nil, NewParserError(b, "expected value, not eof") } var err error @@ -259,8 +374,8 @@ func (p *parser) parseVal(b []byte) (ast.Reference, []byte, error) { } if err == nil { - ref = p.builder.Push(ast.Node{ - Kind: ast.String, + ref = p.builder.Push(Node{ + Kind: String, Raw: p.Range(raw), Data: v, }) @@ -277,8 +392,8 @@ func (p *parser) parseVal(b []byte) (ast.Reference, []byte, error) { } if err == nil { - ref = p.builder.Push(ast.Node{ - Kind: ast.String, + ref = p.builder.Push(Node{ + Kind: String, Raw: p.Range(raw), Data: v, }) @@ -287,22 +402,22 @@ func (p *parser) parseVal(b []byte) (ast.Reference, []byte, error) { return ref, b, err case 't': if !scanFollowsTrue(b) { - return ref, nil, newDecodeError(atmost(b, 4), "expected 'true'") + return ref, nil, NewParserError(atmost(b, 4), "expected 'true'") } - ref = p.builder.Push(ast.Node{ - Kind: ast.Bool, + ref = p.builder.Push(Node{ + Kind: Bool, Data: b[:4], }) return ref, b[4:], nil case 'f': if !scanFollowsFalse(b) { - return ref, nil, newDecodeError(atmost(b, 5), "expected 'false'") + return ref, nil, NewParserError(atmost(b, 5), "expected 'false'") } - ref = p.builder.Push(ast.Node{ - Kind: ast.Bool, + ref = p.builder.Push(Node{ + Kind: Bool, Data: b[:5], }) @@ -324,7 +439,7 @@ func atmost(b []byte, n int) []byte { return b[:n] } -func (p *parser) parseLiteralString(b []byte) ([]byte, []byte, []byte, error) { +func (p *Parser) parseLiteralString(b []byte) ([]byte, []byte, []byte, error) { v, rest, err := scanLiteralString(b) if err != nil { return nil, nil, nil, err @@ -333,19 +448,20 @@ func (p *parser) parseLiteralString(b []byte) ([]byte, []byte, []byte, error) { return v, v[1 : len(v)-1], rest, nil } -func (p *parser) parseInlineTable(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseInlineTable(b []byte) (reference, []byte, error) { // inline-table = inline-table-open [ inline-table-keyvals ] inline-table-close // inline-table-open = %x7B ws ; { // inline-table-close = ws %x7D ; } // inline-table-sep = ws %x2C ws ; , Comma // inline-table-keyvals = keyval [ inline-table-sep inline-table-keyvals ] - parent := p.builder.Push(ast.Node{ - Kind: ast.InlineTable, + parent := p.builder.Push(Node{ + Kind: InlineTable, + Raw: p.Range(b[:1]), }) first := true - var child ast.Reference + var child reference b = b[1:] @@ -356,7 +472,7 @@ func (p *parser) parseInlineTable(b []byte) (ast.Reference, []byte, error) { b = p.parseWhitespace(b) if len(b) == 0 { - return parent, nil, newDecodeError(previousB[:1], "inline table is incomplete") + return parent, nil, NewParserError(previousB[:1], "inline table is incomplete") } if b[0] == '}' { @@ -371,7 +487,7 @@ func (p *parser) parseInlineTable(b []byte) (ast.Reference, []byte, error) { b = p.parseWhitespace(b) } - var kv ast.Reference + var kv reference kv, b, err = p.parseKeyval(b) if err != nil { @@ -394,7 +510,7 @@ func (p *parser) parseInlineTable(b []byte) (ast.Reference, []byte, error) { } //nolint:funlen,cyclop -func (p *parser) parseValArray(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseValArray(b []byte) (reference, []byte, error) { // array = array-open [ array-values ] ws-comment-newline array-close // array-open = %x5B ; [ // array-close = %x5D ; ] @@ -405,23 +521,39 @@ func (p *parser) parseValArray(b []byte) (ast.Reference, []byte, error) { arrayStart := b b = b[1:] - parent := p.builder.Push(ast.Node{ - Kind: ast.Array, + parent := p.builder.Push(Node{ + Kind: Array, }) + // First indicates whether the parser is looking for the first element + // (non-comment) of the array. first := true - var lastChild ast.Reference + lastChild := invalidReference + + addChild := func(valueRef reference) { + if lastChild == invalidReference { + p.builder.AttachChild(parent, valueRef) + } else { + p.builder.Chain(lastChild, valueRef) + } + lastChild = valueRef + } var err error for len(b) > 0 { - b, err = p.parseOptionalWhitespaceCommentNewline(b) + cref := invalidReference + cref, b, err = p.parseOptionalWhitespaceCommentNewline(b) if err != nil { return parent, nil, err } + if cref != invalidReference { + addChild(cref) + } + if len(b) == 0 { - return parent, nil, newDecodeError(arrayStart[:1], "array is incomplete") + return parent, nil, NewParserError(arrayStart[:1], "array is incomplete") } if b[0] == ']' { @@ -430,16 +562,19 @@ func (p *parser) parseValArray(b []byte) (ast.Reference, []byte, error) { if b[0] == ',' { if first { - return parent, nil, newDecodeError(b[0:1], "array cannot start with comma") + return parent, nil, NewParserError(b[0:1], "array cannot start with comma") } b = b[1:] - b, err = p.parseOptionalWhitespaceCommentNewline(b) + cref, b, err = p.parseOptionalWhitespaceCommentNewline(b) if err != nil { return parent, nil, err } + if cref != invalidReference { + addChild(cref) + } } else if !first { - return parent, nil, newDecodeError(b[0:1], "array elements must be separated by commas") + return parent, nil, NewParserError(b[0:1], "array elements must be separated by commas") } // TOML allows trailing commas in arrays. @@ -447,23 +582,22 @@ func (p *parser) parseValArray(b []byte) (ast.Reference, []byte, error) { break } - var valueRef ast.Reference + var valueRef reference valueRef, b, err = p.parseVal(b) if err != nil { return parent, nil, err } - if first { - p.builder.AttachChild(parent, valueRef) - } else { - p.builder.Chain(lastChild, valueRef) - } - lastChild = valueRef + addChild(valueRef) - b, err = p.parseOptionalWhitespaceCommentNewline(b) + cref, b, err = p.parseOptionalWhitespaceCommentNewline(b) if err != nil { return parent, nil, err } + if cref != invalidReference { + addChild(cref) + } + first = false } @@ -472,15 +606,34 @@ func (p *parser) parseValArray(b []byte) (ast.Reference, []byte, error) { return parent, rest, err } -func (p *parser) parseOptionalWhitespaceCommentNewline(b []byte) ([]byte, error) { +func (p *Parser) parseOptionalWhitespaceCommentNewline(b []byte) (reference, []byte, error) { + rootCommentRef := invalidReference + latestCommentRef := invalidReference + + addComment := func(ref reference) { + if rootCommentRef == invalidReference { + rootCommentRef = ref + } else if latestCommentRef == invalidReference { + p.builder.AttachChild(rootCommentRef, ref) + latestCommentRef = ref + } else { + p.builder.Chain(latestCommentRef, ref) + latestCommentRef = ref + } + } + for len(b) > 0 { var err error b = p.parseWhitespace(b) if len(b) > 0 && b[0] == '#' { - _, b, err = scanComment(b) + var ref reference + ref, b, err = p.parseComment(b) if err != nil { - return nil, err + return invalidReference, nil, err + } + if ref != invalidReference { + addComment(ref) } } @@ -491,17 +644,17 @@ func (p *parser) parseOptionalWhitespaceCommentNewline(b []byte) ([]byte, error) if b[0] == '\n' || b[0] == '\r' { b, err = p.parseNewline(b) if err != nil { - return nil, err + return invalidReference, nil, err } } else { break } } - return b, nil + return rootCommentRef, b, nil } -func (p *parser) parseMultilineLiteralString(b []byte) ([]byte, []byte, []byte, error) { +func (p *Parser) parseMultilineLiteralString(b []byte) ([]byte, []byte, []byte, error) { token, rest, err := scanMultilineLiteralString(b) if err != nil { return nil, nil, nil, err @@ -520,7 +673,7 @@ func (p *parser) parseMultilineLiteralString(b []byte) ([]byte, []byte, []byte, } //nolint:funlen,gocognit,cyclop -func (p *parser) parseMultilineBasicString(b []byte) ([]byte, []byte, []byte, error) { +func (p *Parser) parseMultilineBasicString(b []byte) ([]byte, []byte, []byte, error) { // ml-basic-string = ml-basic-string-delim [ newline ] ml-basic-body // ml-basic-string-delim // ml-basic-string-delim = 3quotation-mark @@ -551,11 +704,11 @@ func (p *parser) parseMultilineBasicString(b []byte) ([]byte, []byte, []byte, er if !escaped { str := token[startIdx:endIdx] - verr := utf8TomlValidAlreadyEscaped(str) + verr := characters.Utf8TomlValidAlreadyEscaped(str) if verr.Zero() { return token, str, rest, nil } - return nil, nil, nil, newDecodeError(str[verr.Index:verr.Index+verr.Size], "invalid UTF-8") + return nil, nil, nil, NewParserError(str[verr.Index:verr.Index+verr.Size], "invalid UTF-8") } var builder bytes.Buffer @@ -635,13 +788,13 @@ func (p *parser) parseMultilineBasicString(b []byte) ([]byte, []byte, []byte, er builder.WriteRune(x) i += 8 default: - return nil, nil, nil, newDecodeError(token[i:i+1], "invalid escaped character %#U", c) + return nil, nil, nil, NewParserError(token[i:i+1], "invalid escaped character %#U", c) } i++ } else { - size := utf8ValidNext(token[i:]) + size := characters.Utf8ValidNext(token[i:]) if size == 0 { - return nil, nil, nil, newDecodeError(token[i:i+1], "invalid character %#U", c) + return nil, nil, nil, NewParserError(token[i:i+1], "invalid character %#U", c) } builder.Write(token[i : i+size]) i += size @@ -651,7 +804,7 @@ func (p *parser) parseMultilineBasicString(b []byte) ([]byte, []byte, []byte, er return token, builder.Bytes(), rest, nil } -func (p *parser) parseKey(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseKey(b []byte) (reference, []byte, error) { // key = simple-key / dotted-key // simple-key = quoted-key / unquoted-key // @@ -662,11 +815,11 @@ func (p *parser) parseKey(b []byte) (ast.Reference, []byte, error) { // dot-sep = ws %x2E ws ; . Period raw, key, b, err := p.parseSimpleKey(b) if err != nil { - return ast.InvalidReference, nil, err + return invalidReference, nil, err } - ref := p.builder.Push(ast.Node{ - Kind: ast.Key, + ref := p.builder.Push(Node{ + Kind: Key, Raw: p.Range(raw), Data: key, }) @@ -681,8 +834,8 @@ func (p *parser) parseKey(b []byte) (ast.Reference, []byte, error) { return ref, nil, err } - p.builder.PushAndChain(ast.Node{ - Kind: ast.Key, + p.builder.PushAndChain(Node{ + Kind: Key, Raw: p.Range(raw), Data: key, }) @@ -694,9 +847,9 @@ func (p *parser) parseKey(b []byte) (ast.Reference, []byte, error) { return ref, b, nil } -func (p *parser) parseSimpleKey(b []byte) (raw, key, rest []byte, err error) { +func (p *Parser) parseSimpleKey(b []byte) (raw, key, rest []byte, err error) { if len(b) == 0 { - return nil, nil, nil, newDecodeError(b, "expected key but found none") + return nil, nil, nil, NewParserError(b, "expected key but found none") } // simple-key = quoted-key / unquoted-key @@ -711,12 +864,12 @@ func (p *parser) parseSimpleKey(b []byte) (raw, key, rest []byte, err error) { key, rest = scanUnquotedKey(b) return key, key, rest, nil default: - return nil, nil, nil, newDecodeError(b[0:1], "invalid character at start of key: %c", b[0]) + return nil, nil, nil, NewParserError(b[0:1], "invalid character at start of key: %c", b[0]) } } //nolint:funlen,cyclop -func (p *parser) parseBasicString(b []byte) ([]byte, []byte, []byte, error) { +func (p *Parser) parseBasicString(b []byte) ([]byte, []byte, []byte, error) { // basic-string = quotation-mark *basic-char quotation-mark // quotation-mark = %x22 ; " // basic-char = basic-unescaped / escaped @@ -744,11 +897,11 @@ func (p *parser) parseBasicString(b []byte) ([]byte, []byte, []byte, error) { // validate the string and return a direct reference to the buffer. if !escaped { str := token[startIdx:endIdx] - verr := utf8TomlValidAlreadyEscaped(str) + verr := characters.Utf8TomlValidAlreadyEscaped(str) if verr.Zero() { return token, str, rest, nil } - return nil, nil, nil, newDecodeError(str[verr.Index:verr.Index+verr.Size], "invalid UTF-8") + return nil, nil, nil, NewParserError(str[verr.Index:verr.Index+verr.Size], "invalid UTF-8") } i := startIdx @@ -795,13 +948,13 @@ func (p *parser) parseBasicString(b []byte) ([]byte, []byte, []byte, error) { builder.WriteRune(x) i += 8 default: - return nil, nil, nil, newDecodeError(token[i:i+1], "invalid escaped character %#U", c) + return nil, nil, nil, NewParserError(token[i:i+1], "invalid escaped character %#U", c) } i++ } else { - size := utf8ValidNext(token[i:]) + size := characters.Utf8ValidNext(token[i:]) if size == 0 { - return nil, nil, nil, newDecodeError(token[i:i+1], "invalid character %#U", c) + return nil, nil, nil, NewParserError(token[i:i+1], "invalid character %#U", c) } builder.Write(token[i : i+size]) i += size @@ -813,7 +966,7 @@ func (p *parser) parseBasicString(b []byte) ([]byte, []byte, []byte, error) { func hexToRune(b []byte, length int) (rune, error) { if len(b) < length { - return -1, newDecodeError(b, "unicode point needs %d character, not %d", length, len(b)) + return -1, NewParserError(b, "unicode point needs %d character, not %d", length, len(b)) } b = b[:length] @@ -828,19 +981,19 @@ func hexToRune(b []byte, length int) (rune, error) { case 'A' <= c && c <= 'F': d = uint32(c - 'A' + 10) default: - return -1, newDecodeError(b[i:i+1], "non-hex character") + return -1, NewParserError(b[i:i+1], "non-hex character") } r = r*16 + d } if r > unicode.MaxRune || 0xD800 <= r && r < 0xE000 { - return -1, newDecodeError(b, "escape sequence is invalid Unicode code point") + return -1, NewParserError(b, "escape sequence is invalid Unicode code point") } return rune(r), nil } -func (p *parser) parseWhitespace(b []byte) []byte { +func (p *Parser) parseWhitespace(b []byte) []byte { // ws = *wschar // wschar = %x20 ; Space // wschar =/ %x09 ; Horizontal tab @@ -850,25 +1003,27 @@ func (p *parser) parseWhitespace(b []byte) []byte { } //nolint:cyclop -func (p *parser) parseIntOrFloatOrDateTime(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) parseIntOrFloatOrDateTime(b []byte) (reference, []byte, error) { switch b[0] { case 'i': if !scanFollowsInf(b) { - return ast.InvalidReference, nil, newDecodeError(atmost(b, 3), "expected 'inf'") + return invalidReference, nil, NewParserError(atmost(b, 3), "expected 'inf'") } - return p.builder.Push(ast.Node{ - Kind: ast.Float, + return p.builder.Push(Node{ + Kind: Float, Data: b[:3], + Raw: p.Range(b[:3]), }), b[3:], nil case 'n': if !scanFollowsNan(b) { - return ast.InvalidReference, nil, newDecodeError(atmost(b, 3), "expected 'nan'") + return invalidReference, nil, NewParserError(atmost(b, 3), "expected 'nan'") } - return p.builder.Push(ast.Node{ - Kind: ast.Float, + return p.builder.Push(Node{ + Kind: Float, Data: b[:3], + Raw: p.Range(b[:3]), }), b[3:], nil case '+', '-': return p.scanIntOrFloat(b) @@ -898,7 +1053,7 @@ func (p *parser) parseIntOrFloatOrDateTime(b []byte) (ast.Reference, []byte, err return p.scanIntOrFloat(b) } -func (p *parser) scanDateTime(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) scanDateTime(b []byte) (reference, []byte, error) { // scans for contiguous characters in [0-9T:Z.+-], and up to one space if // followed by a digit. hasDate := false @@ -941,30 +1096,30 @@ byteLoop: } } - var kind ast.Kind + var kind Kind if hasTime { if hasDate { if hasTz { - kind = ast.DateTime + kind = DateTime } else { - kind = ast.LocalDateTime + kind = LocalDateTime } } else { - kind = ast.LocalTime + kind = LocalTime } } else { - kind = ast.LocalDate + kind = LocalDate } - return p.builder.Push(ast.Node{ + return p.builder.Push(Node{ Kind: kind, Data: b[:i], }), b[i:], nil } //nolint:funlen,gocognit,cyclop -func (p *parser) scanIntOrFloat(b []byte) (ast.Reference, []byte, error) { +func (p *Parser) scanIntOrFloat(b []byte) (reference, []byte, error) { i := 0 if len(b) > 2 && b[0] == '0' && b[1] != '.' && b[1] != 'e' && b[1] != 'E' { @@ -990,9 +1145,10 @@ func (p *parser) scanIntOrFloat(b []byte) (ast.Reference, []byte, error) { } } - return p.builder.Push(ast.Node{ - Kind: ast.Integer, + return p.builder.Push(Node{ + Kind: Integer, Data: b[:i], + Raw: p.Range(b[:i]), }), b[i:], nil } @@ -1013,42 +1169,45 @@ func (p *parser) scanIntOrFloat(b []byte) (ast.Reference, []byte, error) { if c == 'i' { if scanFollowsInf(b[i:]) { - return p.builder.Push(ast.Node{ - Kind: ast.Float, + return p.builder.Push(Node{ + Kind: Float, Data: b[:i+3], + Raw: p.Range(b[:i+3]), }), b[i+3:], nil } - return ast.InvalidReference, nil, newDecodeError(b[i:i+1], "unexpected character 'i' while scanning for a number") + return invalidReference, nil, NewParserError(b[i:i+1], "unexpected character 'i' while scanning for a number") } if c == 'n' { if scanFollowsNan(b[i:]) { - return p.builder.Push(ast.Node{ - Kind: ast.Float, + return p.builder.Push(Node{ + Kind: Float, Data: b[:i+3], + Raw: p.Range(b[:i+3]), }), b[i+3:], nil } - return ast.InvalidReference, nil, newDecodeError(b[i:i+1], "unexpected character 'n' while scanning for a number") + return invalidReference, nil, NewParserError(b[i:i+1], "unexpected character 'n' while scanning for a number") } break } if i == 0 { - return ast.InvalidReference, b, newDecodeError(b, "incomplete number") + return invalidReference, b, NewParserError(b, "incomplete number") } - kind := ast.Integer + kind := Integer if isFloat { - kind = ast.Float + kind = Float } - return p.builder.Push(ast.Node{ + return p.builder.Push(Node{ Kind: kind, Data: b[:i], + Raw: p.Range(b[:i]), }), b[i:], nil } @@ -1075,11 +1234,11 @@ func isValidBinaryRune(r byte) bool { func expect(x byte, b []byte) ([]byte, error) { if len(b) == 0 { - return nil, newDecodeError(b, "expected character %c but the document ended here", x) + return nil, NewParserError(b, "expected character %c but the document ended here", x) } if b[0] != x { - return nil, newDecodeError(b[0:1], "expected character %c", x) + return nil, NewParserError(b[0:1], "expected character %c", x) } return b[1:], nil diff --git a/vendor/github.com/pelletier/go-toml/v2/scanner.go b/vendor/github.com/pelletier/go-toml/v2/unstable/scanner.go similarity index 79% rename from vendor/github.com/pelletier/go-toml/v2/scanner.go rename to vendor/github.com/pelletier/go-toml/v2/unstable/scanner.go index bb445fab..0512181d 100644 --- a/vendor/github.com/pelletier/go-toml/v2/scanner.go +++ b/vendor/github.com/pelletier/go-toml/v2/unstable/scanner.go @@ -1,4 +1,6 @@ -package toml +package unstable + +import "github.com/pelletier/go-toml/v2/internal/characters" func scanFollows(b []byte, pattern string) bool { n := len(pattern) @@ -54,16 +56,16 @@ func scanLiteralString(b []byte) ([]byte, []byte, error) { case '\'': return b[:i+1], b[i+1:], nil case '\n', '\r': - return nil, nil, newDecodeError(b[i:i+1], "literal strings cannot have new lines") + return nil, nil, NewParserError(b[i:i+1], "literal strings cannot have new lines") } - size := utf8ValidNext(b[i:]) + size := characters.Utf8ValidNext(b[i:]) if size == 0 { - return nil, nil, newDecodeError(b[i:i+1], "invalid character") + return nil, nil, NewParserError(b[i:i+1], "invalid character") } i += size } - return nil, nil, newDecodeError(b[len(b):], "unterminated literal string") + return nil, nil, NewParserError(b[len(b):], "unterminated literal string") } func scanMultilineLiteralString(b []byte) ([]byte, []byte, error) { @@ -98,39 +100,39 @@ func scanMultilineLiteralString(b []byte) ([]byte, []byte, error) { i++ if i < len(b) && b[i] == '\'' { - return nil, nil, newDecodeError(b[i-3:i+1], "''' not allowed in multiline literal string") + return nil, nil, NewParserError(b[i-3:i+1], "''' not allowed in multiline literal string") } return b[:i], b[i:], nil } case '\r': if len(b) < i+2 { - return nil, nil, newDecodeError(b[len(b):], `need a \n after \r`) + return nil, nil, NewParserError(b[len(b):], `need a \n after \r`) } if b[i+1] != '\n' { - return nil, nil, newDecodeError(b[i:i+2], `need a \n after \r`) + return nil, nil, NewParserError(b[i:i+2], `need a \n after \r`) } i += 2 // skip the \n continue } - size := utf8ValidNext(b[i:]) + size := characters.Utf8ValidNext(b[i:]) if size == 0 { - return nil, nil, newDecodeError(b[i:i+1], "invalid character") + return nil, nil, NewParserError(b[i:i+1], "invalid character") } i += size } - return nil, nil, newDecodeError(b[len(b):], `multiline literal string not terminated by '''`) + return nil, nil, NewParserError(b[len(b):], `multiline literal string not terminated by '''`) } func scanWindowsNewline(b []byte) ([]byte, []byte, error) { const lenCRLF = 2 if len(b) < lenCRLF { - return nil, nil, newDecodeError(b, "windows new line expected") + return nil, nil, NewParserError(b, "windows new line expected") } if b[1] != '\n' { - return nil, nil, newDecodeError(b, `windows new line should be \r\n`) + return nil, nil, NewParserError(b, `windows new line should be \r\n`) } return b[:lenCRLF], b[lenCRLF:], nil @@ -149,7 +151,6 @@ func scanWhitespace(b []byte) ([]byte, []byte) { return b, b[len(b):] } -//nolint:unparam func scanComment(b []byte) ([]byte, []byte, error) { // comment-start-symbol = %x23 ; # // non-ascii = %x80-D7FF / %xE000-10FFFF @@ -165,11 +166,11 @@ func scanComment(b []byte) ([]byte, []byte, error) { if i+1 < len(b) && b[i+1] == '\n' { return b[:i+1], b[i+1:], nil } - return nil, nil, newDecodeError(b[i:i+1], "invalid character in comment") + return nil, nil, NewParserError(b[i:i+1], "invalid character in comment") } - size := utf8ValidNext(b[i:]) + size := characters.Utf8ValidNext(b[i:]) if size == 0 { - return nil, nil, newDecodeError(b[i:i+1], "invalid character in comment") + return nil, nil, NewParserError(b[i:i+1], "invalid character in comment") } i += size @@ -192,17 +193,17 @@ func scanBasicString(b []byte) ([]byte, bool, []byte, error) { case '"': return b[:i+1], escaped, b[i+1:], nil case '\n', '\r': - return nil, escaped, nil, newDecodeError(b[i:i+1], "basic strings cannot have new lines") + return nil, escaped, nil, NewParserError(b[i:i+1], "basic strings cannot have new lines") case '\\': if len(b) < i+2 { - return nil, escaped, nil, newDecodeError(b[i:i+1], "need a character after \\") + return nil, escaped, nil, NewParserError(b[i:i+1], "need a character after \\") } escaped = true i++ // skip the next character } } - return nil, escaped, nil, newDecodeError(b[len(b):], `basic string not terminated by "`) + return nil, escaped, nil, NewParserError(b[len(b):], `basic string not terminated by "`) } func scanMultilineBasicString(b []byte) ([]byte, bool, []byte, error) { @@ -243,27 +244,27 @@ func scanMultilineBasicString(b []byte) ([]byte, bool, []byte, error) { i++ if i < len(b) && b[i] == '"' { - return nil, escaped, nil, newDecodeError(b[i-3:i+1], `""" not allowed in multiline basic string`) + return nil, escaped, nil, NewParserError(b[i-3:i+1], `""" not allowed in multiline basic string`) } return b[:i], escaped, b[i:], nil } case '\\': if len(b) < i+2 { - return nil, escaped, nil, newDecodeError(b[len(b):], "need a character after \\") + return nil, escaped, nil, NewParserError(b[len(b):], "need a character after \\") } escaped = true i++ // skip the next character case '\r': if len(b) < i+2 { - return nil, escaped, nil, newDecodeError(b[len(b):], `need a \n after \r`) + return nil, escaped, nil, NewParserError(b[len(b):], `need a \n after \r`) } if b[i+1] != '\n' { - return nil, escaped, nil, newDecodeError(b[i:i+2], `need a \n after \r`) + return nil, escaped, nil, NewParserError(b[i:i+2], `need a \n after \r`) } i++ // skip the \n } } - return nil, escaped, nil, newDecodeError(b[len(b):], `multiline basic string not terminated by """`) + return nil, escaped, nil, NewParserError(b[len(b):], `multiline basic string not terminated by """`) } diff --git a/vendor/github.com/pelletier/go-toml/v2/unstable/unmarshaler.go b/vendor/github.com/pelletier/go-toml/v2/unstable/unmarshaler.go new file mode 100644 index 00000000..00cfd6de --- /dev/null +++ b/vendor/github.com/pelletier/go-toml/v2/unstable/unmarshaler.go @@ -0,0 +1,7 @@ +package unstable + +// The Unmarshaler interface may be implemented by types to customize their +// behavior when being unmarshaled from a TOML document. +type Unmarshaler interface { + UnmarshalTOML(value *Node) error +} diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare.go b/vendor/github.com/stretchr/testify/assert/assertion_compare.go index 95d8e59d..7e19eba0 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_compare.go @@ -7,10 +7,13 @@ import ( "time" ) -type CompareType int +// Deprecated: CompareType has only ever been for internal use and has accidentally been published since v1.6.0. Do not use it. +type CompareType = compareResult + +type compareResult int const ( - compareLess CompareType = iota - 1 + compareLess compareResult = iota - 1 compareEqual compareGreater ) @@ -28,6 +31,8 @@ var ( uint32Type = reflect.TypeOf(uint32(1)) uint64Type = reflect.TypeOf(uint64(1)) + uintptrType = reflect.TypeOf(uintptr(1)) + float32Type = reflect.TypeOf(float32(1)) float64Type = reflect.TypeOf(float64(1)) @@ -37,7 +42,7 @@ var ( bytesType = reflect.TypeOf([]byte{}) ) -func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { +func compare(obj1, obj2 interface{}, kind reflect.Kind) (compareResult, bool) { obj1Value := reflect.ValueOf(obj1) obj2Value := reflect.ValueOf(obj2) @@ -308,11 +313,11 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { case reflect.Struct: { // All structs enter here. We're not interested in most types. - if !canConvert(obj1Value, timeType) { + if !obj1Value.CanConvert(timeType) { break } - // time.Time can compared! + // time.Time can be compared! timeObj1, ok := obj1.(time.Time) if !ok { timeObj1 = obj1Value.Convert(timeType).Interface().(time.Time) @@ -323,12 +328,18 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { timeObj2 = obj2Value.Convert(timeType).Interface().(time.Time) } - return compare(timeObj1.UnixNano(), timeObj2.UnixNano(), reflect.Int64) + if timeObj1.Before(timeObj2) { + return compareLess, true + } + if timeObj1.Equal(timeObj2) { + return compareEqual, true + } + return compareGreater, true } case reflect.Slice: { // We only care about the []byte type. - if !canConvert(obj1Value, bytesType) { + if !obj1Value.CanConvert(bytesType) { break } @@ -343,7 +354,27 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { bytesObj2 = obj2Value.Convert(bytesType).Interface().([]byte) } - return CompareType(bytes.Compare(bytesObj1, bytesObj2)), true + return compareResult(bytes.Compare(bytesObj1, bytesObj2)), true + } + case reflect.Uintptr: + { + uintptrObj1, ok := obj1.(uintptr) + if !ok { + uintptrObj1 = obj1Value.Convert(uintptrType).Interface().(uintptr) + } + uintptrObj2, ok := obj2.(uintptr) + if !ok { + uintptrObj2 = obj2Value.Convert(uintptrType).Interface().(uintptr) + } + if uintptrObj1 > uintptrObj2 { + return compareGreater, true + } + if uintptrObj1 == uintptrObj2 { + return compareEqual, true + } + if uintptrObj1 < uintptrObj2 { + return compareLess, true + } } } @@ -352,79 +383,79 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { // Greater asserts that the first element is greater than the second // -// assert.Greater(t, 2, 1) -// assert.Greater(t, float64(2), float64(1)) -// assert.Greater(t, "b", "a") +// assert.Greater(t, 2, 1) +// assert.Greater(t, float64(2), float64(1)) +// assert.Greater(t, "b", "a") func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqual(t, 2, 1) -// assert.GreaterOrEqual(t, 2, 2) -// assert.GreaterOrEqual(t, "b", "a") -// assert.GreaterOrEqual(t, "b", "b") +// assert.GreaterOrEqual(t, 2, 1) +// assert.GreaterOrEqual(t, 2, 2) +// assert.GreaterOrEqual(t, "b", "a") +// assert.GreaterOrEqual(t, "b", "b") func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareGreater, compareEqual}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareGreater, compareEqual}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // Less asserts that the first element is less than the second // -// assert.Less(t, 1, 2) -// assert.Less(t, float64(1), float64(2)) -// assert.Less(t, "a", "b") +// assert.Less(t, 1, 2) +// assert.Less(t, float64(1), float64(2)) +// assert.Less(t, "a", "b") func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // LessOrEqual asserts that the first element is less than or equal to the second // -// assert.LessOrEqual(t, 1, 2) -// assert.LessOrEqual(t, 2, 2) -// assert.LessOrEqual(t, "a", "b") -// assert.LessOrEqual(t, "b", "b") +// assert.LessOrEqual(t, 1, 2) +// assert.LessOrEqual(t, 2, 2) +// assert.LessOrEqual(t, "a", "b") +// assert.LessOrEqual(t, "b", "b") func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } // Positive asserts that the specified element is positive // -// assert.Positive(t, 1) -// assert.Positive(t, 1.23) +// assert.Positive(t, 1) +// assert.Positive(t, 1.23) func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } zero := reflect.Zero(reflect.TypeOf(e)) - return compareTwoValues(t, e, zero.Interface(), []CompareType{compareGreater}, "\"%v\" is not positive", msgAndArgs...) + return compareTwoValues(t, e, zero.Interface(), []compareResult{compareGreater}, "\"%v\" is not positive", msgAndArgs...) } // Negative asserts that the specified element is negative // -// assert.Negative(t, -1) -// assert.Negative(t, -1.23) +// assert.Negative(t, -1) +// assert.Negative(t, -1.23) func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } zero := reflect.Zero(reflect.TypeOf(e)) - return compareTwoValues(t, e, zero.Interface(), []CompareType{compareLess}, "\"%v\" is not negative", msgAndArgs...) + return compareTwoValues(t, e, zero.Interface(), []compareResult{compareLess}, "\"%v\" is not negative", msgAndArgs...) } -func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { +func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedComparesResults []compareResult, failMessage string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } @@ -447,7 +478,7 @@ func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedCompare return true } -func containsValue(values []CompareType, value CompareType) bool { +func containsValue(values []compareResult, value compareResult) bool { for _, v := range values { if v == value { return true diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare_can_convert.go b/vendor/github.com/stretchr/testify/assert/assertion_compare_can_convert.go deleted file mode 100644 index da867903..00000000 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare_can_convert.go +++ /dev/null @@ -1,16 +0,0 @@ -//go:build go1.17 -// +build go1.17 - -// TODO: once support for Go 1.16 is dropped, this file can be -// merged/removed with assertion_compare_go1.17_test.go and -// assertion_compare_legacy.go - -package assert - -import "reflect" - -// Wrapper around reflect.Value.CanConvert, for compatibility -// reasons. -func canConvert(value reflect.Value, to reflect.Type) bool { - return value.CanConvert(to) -} diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare_legacy.go b/vendor/github.com/stretchr/testify/assert/assertion_compare_legacy.go deleted file mode 100644 index 1701af2a..00000000 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare_legacy.go +++ /dev/null @@ -1,16 +0,0 @@ -//go:build !go1.17 -// +build !go1.17 - -// TODO: once support for Go 1.16 is dropped, this file can be -// merged/removed with assertion_compare_go1.17_test.go and -// assertion_compare_can_convert.go - -package assert - -import "reflect" - -// Older versions of Go does not have the reflect.Value.CanConvert -// method. -func canConvert(value reflect.Value, to reflect.Type) bool { - return false -} diff --git a/vendor/github.com/stretchr/testify/assert/assertion_format.go b/vendor/github.com/stretchr/testify/assert/assertion_format.go index 7880b8f9..19063416 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_format.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_format.go @@ -1,7 +1,4 @@ -/* -* CODE GENERATED AUTOMATICALLY WITH github.com/stretchr/testify/_codegen -* THIS FILE MUST NOT BE EDITED BY HAND - */ +// Code generated with github.com/stretchr/testify/_codegen; DO NOT EDIT. package assert @@ -22,9 +19,9 @@ func Conditionf(t TestingT, comp Comparison, msg string, args ...interface{}) bo // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") -// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") -// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") +// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") +// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") +// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") func Containsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -56,7 +53,7 @@ func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Emptyf(t, obj, "error message %s", "formatted") +// assert.Emptyf(t, obj, "error message %s", "formatted") func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -66,7 +63,7 @@ func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) boo // Equalf asserts that two objects are equal. // -// assert.Equalf(t, 123, 123, "error message %s", "formatted") +// assert.Equalf(t, 123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -81,8 +78,8 @@ func Equalf(t TestingT, expected interface{}, actual interface{}, msg string, ar // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") func EqualErrorf(t TestingT, theError error, errString string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -90,10 +87,27 @@ func EqualErrorf(t TestingT, theError error, errString string, msg string, args return EqualError(t, theError, errString, append([]interface{}{msg}, args...)...) } -// EqualValuesf asserts that two objects are equal or convertable to the same types -// and equal. +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. // -// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// assert.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return EqualExportedValues(t, expected, actual, append([]interface{}{msg}, args...)...) +} + +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. +// +// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -103,10 +117,10 @@ func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg stri // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Errorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if assert.Errorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func Errorf(t TestingT, err error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -126,8 +140,8 @@ func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...int // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") func ErrorContainsf(t TestingT, theError error, contains string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -147,7 +161,7 @@ func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -155,9 +169,34 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick return Eventually(t, condition, waitFor, tick, append([]interface{}{msg}, args...)...) } +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithTf(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return EventuallyWithT(t, condition, waitFor, tick, append([]interface{}{msg}, args...)...) +} + // Exactlyf asserts that two objects are equal in value and type. // -// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") +// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") func Exactlyf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -183,7 +222,7 @@ func FailNowf(t TestingT, failureMessage string, msg string, args ...interface{} // Falsef asserts that the specified value is false. // -// assert.Falsef(t, myBool, "error message %s", "formatted") +// assert.Falsef(t, myBool, "error message %s", "formatted") func Falsef(t TestingT, value bool, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -202,9 +241,9 @@ func FileExistsf(t TestingT, path string, msg string, args ...interface{}) bool // Greaterf asserts that the first element is greater than the second // -// assert.Greaterf(t, 2, 1, "error message %s", "formatted") -// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") -// assert.Greaterf(t, "b", "a", "error message %s", "formatted") +// assert.Greaterf(t, 2, 1, "error message %s", "formatted") +// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") +// assert.Greaterf(t, "b", "a", "error message %s", "formatted") func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -214,10 +253,10 @@ func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...in // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -228,7 +267,7 @@ func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, arg // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -241,7 +280,7 @@ func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -253,7 +292,7 @@ func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, u // HTTPErrorf asserts that a specified handler returns an error status code. // -// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -265,7 +304,7 @@ func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -277,7 +316,7 @@ func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url stri // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) bool { @@ -289,7 +328,7 @@ func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -301,7 +340,7 @@ func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url strin // Implementsf asserts that an object is implemented by the specified interface. // -// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -311,7 +350,7 @@ func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, ms // InDeltaf asserts that the two numerals are within delta of each other. // -// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func InDeltaf(t TestingT, expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -353,9 +392,9 @@ func InEpsilonSlicef(t TestingT, expected interface{}, actual interface{}, epsil // IsDecreasingf asserts that the collection is decreasing // -// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -365,9 +404,9 @@ func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface // IsIncreasingf asserts that the collection is increasing // -// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -377,9 +416,9 @@ func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -389,9 +428,9 @@ func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interf // IsNonIncreasingf asserts that the collection is not increasing // -// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -409,7 +448,7 @@ func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg strin // JSONEqf asserts that two JSON strings are equivalent. // -// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func JSONEqf(t TestingT, expected string, actual string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -420,7 +459,7 @@ func JSONEqf(t TestingT, expected string, actual string, msg string, args ...int // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") +// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") func Lenf(t TestingT, object interface{}, length int, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -430,9 +469,9 @@ func Lenf(t TestingT, object interface{}, length int, msg string, args ...interf // Lessf asserts that the first element is less than the second // -// assert.Lessf(t, 1, 2, "error message %s", "formatted") -// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") -// assert.Lessf(t, "a", "b", "error message %s", "formatted") +// assert.Lessf(t, 1, 2, "error message %s", "formatted") +// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") +// assert.Lessf(t, "a", "b", "error message %s", "formatted") func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -442,10 +481,10 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter // LessOrEqualf asserts that the first element is less than or equal to the second // -// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") -// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -455,8 +494,8 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . // Negativef asserts that the specified element is negative // -// assert.Negativef(t, -1, "error message %s", "formatted") -// assert.Negativef(t, -1.23, "error message %s", "formatted") +// assert.Negativef(t, -1, "error message %s", "formatted") +// assert.Negativef(t, -1.23, "error message %s", "formatted") func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -467,7 +506,7 @@ func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) bool // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -477,7 +516,7 @@ func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time. // Nilf asserts that the specified object is nil. // -// assert.Nilf(t, err, "error message %s", "formatted") +// assert.Nilf(t, err, "error message %s", "formatted") func Nilf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -496,10 +535,10 @@ func NoDirExistsf(t TestingT, path string, msg string, args ...interface{}) bool // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoErrorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoErrorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func NoErrorf(t TestingT, err error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -519,9 +558,9 @@ func NoFileExistsf(t TestingT, path string, msg string, args ...interface{}) boo // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -529,12 +568,29 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a return NotContains(t, s, contains, append([]interface{}{msg}, args...)...) } +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// assert.NotElementsMatchf(t, [1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// assert.NotElementsMatchf(t, [1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// assert.NotElementsMatchf(t, [1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func NotElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotElementsMatch(t, listA, listB, append([]interface{}{msg}, args...)...) +} + // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -544,7 +600,7 @@ func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) // NotEqualf asserts that the specified values are NOT equal. // -// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -557,7 +613,7 @@ func NotEqualf(t TestingT, expected interface{}, actual interface{}, msg string, // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -565,7 +621,16 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s return NotEqualValues(t, expected, actual, append([]interface{}{msg}, args...)...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotErrorAs(t, err, target, append([]interface{}{msg}, args...)...) +} + +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -574,9 +639,19 @@ func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interf return NotErrorIs(t, err, target, append([]interface{}{msg}, args...)...) } +// NotImplementsf asserts that an object does not implement the specified interface. +// +// assert.NotImplementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +func NotImplementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotImplements(t, interfaceObject, object, append([]interface{}{msg}, args...)...) +} + // NotNilf asserts that the specified object is not nil. // -// assert.NotNilf(t, err, "error message %s", "formatted") +// assert.NotNilf(t, err, "error message %s", "formatted") func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -586,7 +661,7 @@ func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) bo // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") +// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") func NotPanicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -596,8 +671,8 @@ func NotPanicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bo // NotRegexpf asserts that a specified regexp does not match a string. // -// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") +// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -607,7 +682,7 @@ func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args .. // NotSamef asserts that two pointers do not reference the same object. // -// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -618,10 +693,12 @@ func NotSamef(t TestingT, expected interface{}, actual interface{}, msg string, return NotSame(t, expected, actual, append([]interface{}{msg}, args...)...) } -// NotSubsetf asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubsetf asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "error message %s", "formatted") +// assert.NotSubsetf(t, {"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") func NotSubsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -639,7 +716,7 @@ func NotZerof(t TestingT, i interface{}, msg string, args ...interface{}) bool { // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") +// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") func Panicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -651,7 +728,7 @@ func Panicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithErrorf(t TestingT, errString string, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -662,7 +739,7 @@ func PanicsWithErrorf(t TestingT, errString string, f PanicTestFunc, msg string, // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithValuef(t TestingT, expected interface{}, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -672,8 +749,8 @@ func PanicsWithValuef(t TestingT, expected interface{}, f PanicTestFunc, msg str // Positivef asserts that the specified element is positive // -// assert.Positivef(t, 1, "error message %s", "formatted") -// assert.Positivef(t, 1.23, "error message %s", "formatted") +// assert.Positivef(t, 1, "error message %s", "formatted") +// assert.Positivef(t, 1.23, "error message %s", "formatted") func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -683,8 +760,8 @@ func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) bool // Regexpf asserts that a specified regexp matches a string. // -// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") +// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -694,7 +771,7 @@ func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...in // Samef asserts that two pointers reference the same object. // -// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -705,10 +782,11 @@ func Samef(t TestingT, expected interface{}, actual interface{}, msg string, arg return Same(t, expected, actual, append([]interface{}{msg}, args...)...) } -// Subsetf asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subsetf asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// assert.Subsetf(t, [1, 2, 3], [1, 2], "error message %s", "formatted") +// assert.Subsetf(t, {"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -718,7 +796,7 @@ func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args // Truef asserts that the specified value is true. // -// assert.Truef(t, myBool, "error message %s", "formatted") +// assert.Truef(t, myBool, "error message %s", "formatted") func Truef(t TestingT, value bool, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -728,7 +806,7 @@ func Truef(t TestingT, value bool, msg string, args ...interface{}) bool { // WithinDurationf asserts that the two times are within duration delta of each other. // -// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -738,7 +816,7 @@ func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta tim // WithinRangef asserts that a time is within a time range (inclusive). // -// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func WithinRangef(t TestingT, actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_forward.go b/vendor/github.com/stretchr/testify/assert/assertion_forward.go index 339515b8..21629087 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_forward.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_forward.go @@ -1,7 +1,4 @@ -/* -* CODE GENERATED AUTOMATICALLY WITH github.com/stretchr/testify/_codegen -* THIS FILE MUST NOT BE EDITED BY HAND - */ +// Code generated with github.com/stretchr/testify/_codegen; DO NOT EDIT. package assert @@ -30,9 +27,9 @@ func (a *Assertions) Conditionf(comp Comparison, msg string, args ...interface{} // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Contains("Hello World", "World") -// a.Contains(["Hello", "World"], "World") -// a.Contains({"Hello": "World"}, "Hello") +// a.Contains("Hello World", "World") +// a.Contains(["Hello", "World"], "World") +// a.Contains({"Hello": "World"}, "Hello") func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -43,9 +40,9 @@ func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs .. // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Containsf("Hello World", "World", "error message %s", "formatted") -// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") -// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") +// a.Containsf("Hello World", "World", "error message %s", "formatted") +// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") +// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") func (a *Assertions) Containsf(s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -98,7 +95,7 @@ func (a *Assertions) ElementsMatchf(listA interface{}, listB interface{}, msg st // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Empty(obj) +// a.Empty(obj) func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -109,7 +106,7 @@ func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) bool { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Emptyf(obj, "error message %s", "formatted") +// a.Emptyf(obj, "error message %s", "formatted") func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -119,7 +116,7 @@ func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) // Equal asserts that two objects are equal. // -// a.Equal(123, 123) +// a.Equal(123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -134,8 +131,8 @@ func (a *Assertions) Equal(expected interface{}, actual interface{}, msgAndArgs // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualError(err, expectedErrorString) +// actualObj, err := SomeFunction() +// a.EqualError(err, expectedErrorString) func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -146,8 +143,8 @@ func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ... // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") func (a *Assertions) EqualErrorf(theError error, errString string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -155,10 +152,44 @@ func (a *Assertions) EqualErrorf(theError error, errString string, msg string, a return EqualErrorf(a.t, theError, errString, msg, args...) } -// EqualValues asserts that two objects are equal or convertable to the same types -// and equal. +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. // -// a.EqualValues(uint32(123), int32(123)) +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValues(S{1, 2}, S{1, 3}) => true +// a.EqualExportedValues(S{1, 2}, S{2, 3}) => false +func (a *Assertions) EqualExportedValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EqualExportedValues(a.t, expected, actual, msgAndArgs...) +} + +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValuesf(S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// a.EqualExportedValuesf(S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EqualExportedValuesf(a.t, expected, actual, msg, args...) +} + +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. +// +// a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -166,10 +197,10 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn return EqualValues(a.t, expected, actual, msgAndArgs...) } -// EqualValuesf asserts that two objects are equal or convertable to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // -// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") +// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -179,7 +210,7 @@ func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg // Equalf asserts that two objects are equal. // -// a.Equalf(123, 123, "error message %s", "formatted") +// a.Equalf(123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -193,10 +224,10 @@ func (a *Assertions) Equalf(expected interface{}, actual interface{}, msg string // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Error(err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if a.Error(err) { +// assert.Equal(t, expectedError, err) +// } func (a *Assertions) Error(err error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -225,8 +256,8 @@ func (a *Assertions) ErrorAsf(err error, target interface{}, msg string, args .. // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContains(err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// a.ErrorContains(err, expectedErrorSubString) func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -237,8 +268,8 @@ func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs . // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") func (a *Assertions) ErrorContainsf(theError error, contains string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -266,10 +297,10 @@ func (a *Assertions) ErrorIsf(err error, target error, msg string, args ...inter // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Errorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if a.Errorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func (a *Assertions) Errorf(err error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -280,7 +311,7 @@ func (a *Assertions) Errorf(err error, msg string, args ...interface{}) bool { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) +// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -288,10 +319,60 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti return Eventually(a.t, condition, waitFor, tick, msgAndArgs...) } +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithT(func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithT(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EventuallyWithT(a.t, condition, waitFor, tick, msgAndArgs...) +} + +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithTf(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EventuallyWithTf(a.t, condition, waitFor, tick, msg, args...) +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -301,7 +382,7 @@ func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, t // Exactly asserts that two objects are equal in value and type. // -// a.Exactly(int32(123), int64(123)) +// a.Exactly(int32(123), int64(123)) func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -311,7 +392,7 @@ func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArg // Exactlyf asserts that two objects are equal in value and type. // -// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") +// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") func (a *Assertions) Exactlyf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -353,7 +434,7 @@ func (a *Assertions) Failf(failureMessage string, msg string, args ...interface{ // False asserts that the specified value is false. // -// a.False(myBool) +// a.False(myBool) func (a *Assertions) False(value bool, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -363,7 +444,7 @@ func (a *Assertions) False(value bool, msgAndArgs ...interface{}) bool { // Falsef asserts that the specified value is false. // -// a.Falsef(myBool, "error message %s", "formatted") +// a.Falsef(myBool, "error message %s", "formatted") func (a *Assertions) Falsef(value bool, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -391,9 +472,9 @@ func (a *Assertions) FileExistsf(path string, msg string, args ...interface{}) b // Greater asserts that the first element is greater than the second // -// a.Greater(2, 1) -// a.Greater(float64(2), float64(1)) -// a.Greater("b", "a") +// a.Greater(2, 1) +// a.Greater(float64(2), float64(1)) +// a.Greater("b", "a") func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -403,10 +484,10 @@ func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...inter // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqual(2, 1) -// a.GreaterOrEqual(2, 2) -// a.GreaterOrEqual("b", "a") -// a.GreaterOrEqual("b", "b") +// a.GreaterOrEqual(2, 1) +// a.GreaterOrEqual(2, 2) +// a.GreaterOrEqual("b", "a") +// a.GreaterOrEqual("b", "b") func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -416,10 +497,10 @@ func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs . // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") -// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") -// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") -// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") +// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") +// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") +// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") +// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -429,9 +510,9 @@ func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, // Greaterf asserts that the first element is greater than the second // -// a.Greaterf(2, 1, "error message %s", "formatted") -// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") -// a.Greaterf("b", "a", "error message %s", "formatted") +// a.Greaterf(2, 1, "error message %s", "formatted") +// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") +// a.Greaterf("b", "a", "error message %s", "formatted") func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -442,7 +523,7 @@ func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args . // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -455,7 +536,7 @@ func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, u // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -468,7 +549,7 @@ func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -481,7 +562,7 @@ func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -493,7 +574,7 @@ func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method strin // HTTPError asserts that a specified handler returns an error status code. // -// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -505,7 +586,7 @@ func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url stri // HTTPErrorf asserts that a specified handler returns an error status code. // -// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -517,7 +598,7 @@ func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url str // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -529,7 +610,7 @@ func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url s // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -541,7 +622,7 @@ func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) +// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) bool { @@ -553,7 +634,7 @@ func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) bool { @@ -565,7 +646,7 @@ func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, ur // HTTPSuccess asserts that a specified handler returns a success status code. // -// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) +// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -577,7 +658,7 @@ func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -589,7 +670,7 @@ func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url s // Implements asserts that an object is implemented by the specified interface. // -// a.Implements((*MyInterface)(nil), new(MyObject)) +// a.Implements((*MyInterface)(nil), new(MyObject)) func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -599,7 +680,7 @@ func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, // Implementsf asserts that an object is implemented by the specified interface. // -// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -609,7 +690,7 @@ func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{} // InDelta asserts that the two numerals are within delta of each other. // -// a.InDelta(math.Pi, 22/7.0, 0.01) +// a.InDelta(math.Pi, 22/7.0, 0.01) func (a *Assertions) InDelta(expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -651,7 +732,7 @@ func (a *Assertions) InDeltaSlicef(expected interface{}, actual interface{}, del // InDeltaf asserts that the two numerals are within delta of each other. // -// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func (a *Assertions) InDeltaf(expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -693,9 +774,9 @@ func (a *Assertions) InEpsilonf(expected interface{}, actual interface{}, epsilo // IsDecreasing asserts that the collection is decreasing // -// a.IsDecreasing([]int{2, 1, 0}) -// a.IsDecreasing([]float{2, 1}) -// a.IsDecreasing([]string{"b", "a"}) +// a.IsDecreasing([]int{2, 1, 0}) +// a.IsDecreasing([]float{2, 1}) +// a.IsDecreasing([]string{"b", "a"}) func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -705,9 +786,9 @@ func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) // IsDecreasingf asserts that the collection is decreasing // -// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") -// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") +// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -717,9 +798,9 @@ func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...inter // IsIncreasing asserts that the collection is increasing // -// a.IsIncreasing([]int{1, 2, 3}) -// a.IsIncreasing([]float{1, 2}) -// a.IsIncreasing([]string{"a", "b"}) +// a.IsIncreasing([]int{1, 2, 3}) +// a.IsIncreasing([]float{1, 2}) +// a.IsIncreasing([]string{"a", "b"}) func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -729,9 +810,9 @@ func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) // IsIncreasingf asserts that the collection is increasing // -// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") -// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") +// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -741,9 +822,9 @@ func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...inter // IsNonDecreasing asserts that the collection is not decreasing // -// a.IsNonDecreasing([]int{1, 1, 2}) -// a.IsNonDecreasing([]float{1, 2}) -// a.IsNonDecreasing([]string{"a", "b"}) +// a.IsNonDecreasing([]int{1, 1, 2}) +// a.IsNonDecreasing([]float{1, 2}) +// a.IsNonDecreasing([]string{"a", "b"}) func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -753,9 +834,9 @@ func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -765,9 +846,9 @@ func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...in // IsNonIncreasing asserts that the collection is not increasing // -// a.IsNonIncreasing([]int{2, 1, 1}) -// a.IsNonIncreasing([]float{2, 1}) -// a.IsNonIncreasing([]string{"b", "a"}) +// a.IsNonIncreasing([]int{2, 1, 1}) +// a.IsNonIncreasing([]float{2, 1}) +// a.IsNonIncreasing([]string{"b", "a"}) func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -777,9 +858,9 @@ func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface // IsNonIncreasingf asserts that the collection is not increasing // -// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsNonIncreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -805,7 +886,7 @@ func (a *Assertions) IsTypef(expectedType interface{}, object interface{}, msg s // JSONEq asserts that two JSON strings are equivalent. // -// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -815,7 +896,7 @@ func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interf // JSONEqf asserts that two JSON strings are equivalent. // -// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func (a *Assertions) JSONEqf(expected string, actual string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -826,7 +907,7 @@ func (a *Assertions) JSONEqf(expected string, actual string, msg string, args .. // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// a.Len(mySlice, 3) +// a.Len(mySlice, 3) func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -837,7 +918,7 @@ func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// a.Lenf(mySlice, 3, "error message %s", "formatted") +// a.Lenf(mySlice, 3, "error message %s", "formatted") func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -847,9 +928,9 @@ func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...in // Less asserts that the first element is less than the second // -// a.Less(1, 2) -// a.Less(float64(1), float64(2)) -// a.Less("a", "b") +// a.Less(1, 2) +// a.Less(float64(1), float64(2)) +// a.Less("a", "b") func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -859,10 +940,10 @@ func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interfac // LessOrEqual asserts that the first element is less than or equal to the second // -// a.LessOrEqual(1, 2) -// a.LessOrEqual(2, 2) -// a.LessOrEqual("a", "b") -// a.LessOrEqual("b", "b") +// a.LessOrEqual(1, 2) +// a.LessOrEqual(2, 2) +// a.LessOrEqual("a", "b") +// a.LessOrEqual("b", "b") func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -872,10 +953,10 @@ func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...i // LessOrEqualf asserts that the first element is less than or equal to the second // -// a.LessOrEqualf(1, 2, "error message %s", "formatted") -// a.LessOrEqualf(2, 2, "error message %s", "formatted") -// a.LessOrEqualf("a", "b", "error message %s", "formatted") -// a.LessOrEqualf("b", "b", "error message %s", "formatted") +// a.LessOrEqualf(1, 2, "error message %s", "formatted") +// a.LessOrEqualf(2, 2, "error message %s", "formatted") +// a.LessOrEqualf("a", "b", "error message %s", "formatted") +// a.LessOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -885,9 +966,9 @@ func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, ar // Lessf asserts that the first element is less than the second // -// a.Lessf(1, 2, "error message %s", "formatted") -// a.Lessf(float64(1), float64(2), "error message %s", "formatted") -// a.Lessf("a", "b", "error message %s", "formatted") +// a.Lessf(1, 2, "error message %s", "formatted") +// a.Lessf(float64(1), float64(2), "error message %s", "formatted") +// a.Lessf("a", "b", "error message %s", "formatted") func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -897,8 +978,8 @@ func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...i // Negative asserts that the specified element is negative // -// a.Negative(-1) -// a.Negative(-1.23) +// a.Negative(-1) +// a.Negative(-1.23) func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -908,8 +989,8 @@ func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) bool { // Negativef asserts that the specified element is negative // -// a.Negativef(-1, "error message %s", "formatted") -// a.Negativef(-1.23, "error message %s", "formatted") +// a.Negativef(-1, "error message %s", "formatted") +// a.Negativef(-1.23, "error message %s", "formatted") func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -920,7 +1001,7 @@ func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) b // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) +// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -931,7 +1012,7 @@ func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick ti // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -941,7 +1022,7 @@ func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick t // Nil asserts that the specified object is nil. // -// a.Nil(err) +// a.Nil(err) func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -951,7 +1032,7 @@ func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) bool { // Nilf asserts that the specified object is nil. // -// a.Nilf(err, "error message %s", "formatted") +// a.Nilf(err, "error message %s", "formatted") func (a *Assertions) Nilf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -979,10 +1060,10 @@ func (a *Assertions) NoDirExistsf(path string, msg string, args ...interface{}) // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoError(err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoError(err) { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -992,10 +1073,10 @@ func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) bool { // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoErrorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoErrorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoErrorf(err error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1024,9 +1105,9 @@ func (a *Assertions) NoFileExistsf(path string, msg string, args ...interface{}) // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContains("Hello World", "Earth") -// a.NotContains(["Hello", "World"], "Earth") -// a.NotContains({"Hello": "World"}, "Earth") +// a.NotContains("Hello World", "Earth") +// a.NotContains(["Hello", "World"], "Earth") +// a.NotContains({"Hello": "World"}, "Earth") func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1037,9 +1118,9 @@ func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") -// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") -// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") +// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") +// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") +// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1047,12 +1128,46 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin return NotContainsf(a.t, s, contains, msg, args...) } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 2, 3]) -> true +// +// a.NotElementsMatch([1, 2, 3], [1, 2, 4]) -> true +func (a *Assertions) NotElementsMatch(listA interface{}, listB interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotElementsMatch(a.t, listA, listB, msgAndArgs...) +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// a.NotElementsMatchf([1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func (a *Assertions) NotElementsMatchf(listA interface{}, listB interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotElementsMatchf(a.t, listA, listB, msg, args...) +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmpty(obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmpty(obj) { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1063,9 +1178,9 @@ func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) boo // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmptyf(obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmptyf(obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1075,7 +1190,7 @@ func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface // NotEqual asserts that the specified values are NOT equal. // -// a.NotEqual(obj1, obj2) +// a.NotEqual(obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1088,7 +1203,7 @@ func (a *Assertions) NotEqual(expected interface{}, actual interface{}, msgAndAr // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValues(obj1, obj2) +// a.NotEqualValues(obj1, obj2) func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1098,7 +1213,7 @@ func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, ms // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1108,7 +1223,7 @@ func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, m // NotEqualf asserts that the specified values are NOT equal. // -// a.NotEqualf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualf(obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1119,7 +1234,25 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str return NotEqualf(a.t, expected, actual, msg, args...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAs(err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorAs(a.t, err, target, msgAndArgs...) +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAsf(err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorAsf(a.t, err, target, msg, args...) +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { @@ -1128,7 +1261,7 @@ func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface return NotErrorIs(a.t, err, target, msgAndArgs...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { @@ -1137,9 +1270,29 @@ func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...in return NotErrorIsf(a.t, err, target, msg, args...) } +// NotImplements asserts that an object does not implement the specified interface. +// +// a.NotImplements((*MyInterface)(nil), new(MyObject)) +func (a *Assertions) NotImplements(interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotImplements(a.t, interfaceObject, object, msgAndArgs...) +} + +// NotImplementsf asserts that an object does not implement the specified interface. +// +// a.NotImplementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +func (a *Assertions) NotImplementsf(interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotImplementsf(a.t, interfaceObject, object, msg, args...) +} + // NotNil asserts that the specified object is not nil. // -// a.NotNil(err) +// a.NotNil(err) func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1149,7 +1302,7 @@ func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) bool // NotNilf asserts that the specified object is not nil. // -// a.NotNilf(err, "error message %s", "formatted") +// a.NotNilf(err, "error message %s", "formatted") func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1159,7 +1312,7 @@ func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{} // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanics(func(){ RemainCalm() }) +// a.NotPanics(func(){ RemainCalm() }) func (a *Assertions) NotPanics(f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1169,7 +1322,7 @@ func (a *Assertions) NotPanics(f PanicTestFunc, msgAndArgs ...interface{}) bool // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") +// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") func (a *Assertions) NotPanicsf(f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1179,8 +1332,8 @@ func (a *Assertions) NotPanicsf(f PanicTestFunc, msg string, args ...interface{} // NotRegexp asserts that a specified regexp does not match a string. // -// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") -// a.NotRegexp("^start", "it's not starting") +// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") +// a.NotRegexp("^start", "it's not starting") func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1190,8 +1343,8 @@ func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...in // NotRegexpf asserts that a specified regexp does not match a string. // -// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") +// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1201,7 +1354,7 @@ func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, arg // NotSame asserts that two pointers do not reference the same object. // -// a.NotSame(ptr1, ptr2) +// a.NotSame(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1214,7 +1367,7 @@ func (a *Assertions) NotSame(expected interface{}, actual interface{}, msgAndArg // NotSamef asserts that two pointers do not reference the same object. // -// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") +// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1225,10 +1378,12 @@ func (a *Assertions) NotSamef(expected interface{}, actual interface{}, msg stri return NotSamef(a.t, expected, actual, msg, args...) } -// NotSubset asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubset asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// a.NotSubset([1, 3, 4], [1, 2]) +// a.NotSubset({"x": 1, "y": 2}, {"z": 3}) func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1236,10 +1391,12 @@ func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs return NotSubset(a.t, list, subset, msgAndArgs...) } -// NotSubsetf asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubsetf asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// a.NotSubsetf([1, 3, 4], [1, 2], "error message %s", "formatted") +// a.NotSubsetf({"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") func (a *Assertions) NotSubsetf(list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1265,7 +1422,7 @@ func (a *Assertions) NotZerof(i interface{}, msg string, args ...interface{}) bo // Panics asserts that the code inside the specified PanicTestFunc panics. // -// a.Panics(func(){ GoCrazy() }) +// a.Panics(func(){ GoCrazy() }) func (a *Assertions) Panics(f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1277,7 +1434,7 @@ func (a *Assertions) Panics(f PanicTestFunc, msgAndArgs ...interface{}) bool { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithError("crazy error", func(){ GoCrazy() }) +// a.PanicsWithError("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithError(errString string, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1289,7 +1446,7 @@ func (a *Assertions) PanicsWithError(errString string, f PanicTestFunc, msgAndAr // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithErrorf(errString string, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1300,7 +1457,7 @@ func (a *Assertions) PanicsWithErrorf(errString string, f PanicTestFunc, msg str // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) +// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithValue(expected interface{}, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1311,7 +1468,7 @@ func (a *Assertions) PanicsWithValue(expected interface{}, f PanicTestFunc, msgA // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithValuef(expected interface{}, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1321,7 +1478,7 @@ func (a *Assertions) PanicsWithValuef(expected interface{}, f PanicTestFunc, msg // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") +// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) Panicsf(f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1331,8 +1488,8 @@ func (a *Assertions) Panicsf(f PanicTestFunc, msg string, args ...interface{}) b // Positive asserts that the specified element is positive // -// a.Positive(1) -// a.Positive(1.23) +// a.Positive(1) +// a.Positive(1.23) func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1342,8 +1499,8 @@ func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) bool { // Positivef asserts that the specified element is positive // -// a.Positivef(1, "error message %s", "formatted") -// a.Positivef(1.23, "error message %s", "formatted") +// a.Positivef(1, "error message %s", "formatted") +// a.Positivef(1.23, "error message %s", "formatted") func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1353,8 +1510,8 @@ func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) b // Regexp asserts that a specified regexp matches a string. // -// a.Regexp(regexp.MustCompile("start"), "it's starting") -// a.Regexp("start...$", "it's not starting") +// a.Regexp(regexp.MustCompile("start"), "it's starting") +// a.Regexp("start...$", "it's not starting") func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1364,8 +1521,8 @@ func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...inter // Regexpf asserts that a specified regexp matches a string. // -// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") +// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1375,7 +1532,7 @@ func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args . // Same asserts that two pointers reference the same object. // -// a.Same(ptr1, ptr2) +// a.Same(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1388,7 +1545,7 @@ func (a *Assertions) Same(expected interface{}, actual interface{}, msgAndArgs . // Samef asserts that two pointers reference the same object. // -// a.Samef(ptr1, ptr2, "error message %s", "formatted") +// a.Samef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1399,10 +1556,11 @@ func (a *Assertions) Samef(expected interface{}, actual interface{}, msg string, return Samef(a.t, expected, actual, msg, args...) } -// Subset asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subset asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// a.Subset([1, 2, 3], [1, 2]) +// a.Subset({"x": 1, "y": 2}, {"x": 1}) func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1410,10 +1568,11 @@ func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ... return Subset(a.t, list, subset, msgAndArgs...) } -// Subsetf asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subsetf asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// a.Subsetf([1, 2, 3], [1, 2], "error message %s", "formatted") +// a.Subsetf({"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1423,7 +1582,7 @@ func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, a // True asserts that the specified value is true. // -// a.True(myBool) +// a.True(myBool) func (a *Assertions) True(value bool, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1433,7 +1592,7 @@ func (a *Assertions) True(value bool, msgAndArgs ...interface{}) bool { // Truef asserts that the specified value is true. // -// a.Truef(myBool, "error message %s", "formatted") +// a.Truef(myBool, "error message %s", "formatted") func (a *Assertions) Truef(value bool, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1443,7 +1602,7 @@ func (a *Assertions) Truef(value bool, msg string, args ...interface{}) bool { // WithinDuration asserts that the two times are within duration delta of each other. // -// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) +// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1453,7 +1612,7 @@ func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta // WithinDurationf asserts that the two times are within duration delta of each other. // -// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1463,7 +1622,7 @@ func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta // WithinRange asserts that a time is within a time range (inclusive). // -// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1473,7 +1632,7 @@ func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Tim // WithinRangef asserts that a time is within a time range (inclusive). // -// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func (a *Assertions) WithinRangef(actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_order.go b/vendor/github.com/stretchr/testify/assert/assertion_order.go index 75944878..1d2f7182 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_order.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_order.go @@ -6,7 +6,7 @@ import ( ) // isOrdered checks that collection contains orderable elements. -func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { +func isOrdered(t TestingT, object interface{}, allowedComparesResults []compareResult, failMessage string, msgAndArgs ...interface{}) bool { objKind := reflect.TypeOf(object).Kind() if objKind != reflect.Slice && objKind != reflect.Array { return false @@ -46,36 +46,36 @@ func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareT // IsIncreasing asserts that the collection is increasing // -// assert.IsIncreasing(t, []int{1, 2, 3}) -// assert.IsIncreasing(t, []float{1, 2}) -// assert.IsIncreasing(t, []string{"a", "b"}) +// assert.IsIncreasing(t, []int{1, 2, 3}) +// assert.IsIncreasing(t, []float{1, 2}) +// assert.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // IsNonIncreasing asserts that the collection is not increasing // -// assert.IsNonIncreasing(t, []int{2, 1, 1}) -// assert.IsNonIncreasing(t, []float{2, 1}) -// assert.IsNonIncreasing(t, []string{"b", "a"}) +// assert.IsNonIncreasing(t, []int{2, 1, 1}) +// assert.IsNonIncreasing(t, []float{2, 1}) +// assert.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // IsDecreasing asserts that the collection is decreasing // -// assert.IsDecreasing(t, []int{2, 1, 0}) -// assert.IsDecreasing(t, []float{2, 1}) -// assert.IsDecreasing(t, []string{"b", "a"}) +// assert.IsDecreasing(t, []int{2, 1, 0}) +// assert.IsDecreasing(t, []float{2, 1}) +// assert.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // IsNonDecreasing asserts that the collection is not decreasing // -// assert.IsNonDecreasing(t, []int{1, 1, 2}) -// assert.IsNonDecreasing(t, []float{1, 2}) -// assert.IsNonDecreasing(t, []string{"a", "b"}) +// assert.IsNonDecreasing(t, []int{1, 1, 2}) +// assert.IsNonDecreasing(t, []float{1, 2}) +// assert.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } diff --git a/vendor/github.com/stretchr/testify/assert/assertions.go b/vendor/github.com/stretchr/testify/assert/assertions.go index fa1245b1..4e91332b 100644 --- a/vendor/github.com/stretchr/testify/assert/assertions.go +++ b/vendor/github.com/stretchr/testify/assert/assertions.go @@ -8,7 +8,6 @@ import ( "fmt" "math" "os" - "path/filepath" "reflect" "regexp" "runtime" @@ -20,7 +19,9 @@ import ( "github.com/davecgh/go-spew/spew" "github.com/pmezard/go-difflib/difflib" - yaml "gopkg.in/yaml.v3" + + // Wrapper around gopkg.in/yaml.v3 + "github.com/stretchr/testify/assert/yaml" ) //go:generate sh -c "cd ../_codegen && go build && cd - && ../_codegen/_codegen -output-package=assert -template=assertion_format.go.tmpl" @@ -46,6 +47,10 @@ type BoolAssertionFunc func(TestingT, bool, ...interface{}) bool // for table driven tests. type ErrorAssertionFunc func(TestingT, error, ...interface{}) bool +// PanicAssertionFunc is a common function prototype when validating a panic value. Can be useful +// for table driven tests. +type PanicAssertionFunc = func(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool + // Comparison is a custom function that returns true on success and false on failure type Comparison func() (success bool) @@ -76,6 +81,84 @@ func ObjectsAreEqual(expected, actual interface{}) bool { return bytes.Equal(exp, act) } +// copyExportedFields iterates downward through nested data structures and creates a copy +// that only contains the exported struct fields. +func copyExportedFields(expected interface{}) interface{} { + if isNil(expected) { + return expected + } + + expectedType := reflect.TypeOf(expected) + expectedKind := expectedType.Kind() + expectedValue := reflect.ValueOf(expected) + + switch expectedKind { + case reflect.Struct: + result := reflect.New(expectedType).Elem() + for i := 0; i < expectedType.NumField(); i++ { + field := expectedType.Field(i) + isExported := field.IsExported() + if isExported { + fieldValue := expectedValue.Field(i) + if isNil(fieldValue) || isNil(fieldValue.Interface()) { + continue + } + newValue := copyExportedFields(fieldValue.Interface()) + result.Field(i).Set(reflect.ValueOf(newValue)) + } + } + return result.Interface() + + case reflect.Ptr: + result := reflect.New(expectedType.Elem()) + unexportedRemoved := copyExportedFields(expectedValue.Elem().Interface()) + result.Elem().Set(reflect.ValueOf(unexportedRemoved)) + return result.Interface() + + case reflect.Array, reflect.Slice: + var result reflect.Value + if expectedKind == reflect.Array { + result = reflect.New(reflect.ArrayOf(expectedValue.Len(), expectedType.Elem())).Elem() + } else { + result = reflect.MakeSlice(expectedType, expectedValue.Len(), expectedValue.Len()) + } + for i := 0; i < expectedValue.Len(); i++ { + index := expectedValue.Index(i) + if isNil(index) { + continue + } + unexportedRemoved := copyExportedFields(index.Interface()) + result.Index(i).Set(reflect.ValueOf(unexportedRemoved)) + } + return result.Interface() + + case reflect.Map: + result := reflect.MakeMap(expectedType) + for _, k := range expectedValue.MapKeys() { + index := expectedValue.MapIndex(k) + unexportedRemoved := copyExportedFields(index.Interface()) + result.SetMapIndex(k, reflect.ValueOf(unexportedRemoved)) + } + return result.Interface() + + default: + return expected + } +} + +// ObjectsExportedFieldsAreEqual determines if the exported (public) fields of two objects are +// considered equal. This comparison of only exported fields is applied recursively to nested data +// structures. +// +// This function does no assertion of any kind. +// +// Deprecated: Use [EqualExportedValues] instead. +func ObjectsExportedFieldsAreEqual(expected, actual interface{}) bool { + expectedCleaned := copyExportedFields(expected) + actualCleaned := copyExportedFields(actual) + return ObjectsAreEqualValues(expectedCleaned, actualCleaned) +} + // ObjectsAreEqualValues gets whether two objects are equal, or if their // values are equal. func ObjectsAreEqualValues(expected, actual interface{}) bool { @@ -83,17 +166,40 @@ func ObjectsAreEqualValues(expected, actual interface{}) bool { return true } - actualType := reflect.TypeOf(actual) - if actualType == nil { + expectedValue := reflect.ValueOf(expected) + actualValue := reflect.ValueOf(actual) + if !expectedValue.IsValid() || !actualValue.IsValid() { return false } - expectedValue := reflect.ValueOf(expected) - if expectedValue.IsValid() && expectedValue.Type().ConvertibleTo(actualType) { + + expectedType := expectedValue.Type() + actualType := actualValue.Type() + if !expectedType.ConvertibleTo(actualType) { + return false + } + + if !isNumericType(expectedType) || !isNumericType(actualType) { // Attempt comparison after type conversion - return reflect.DeepEqual(expectedValue.Convert(actualType).Interface(), actual) + return reflect.DeepEqual( + expectedValue.Convert(actualType).Interface(), actual, + ) } - return false + // If BOTH values are numeric, there are chances of false positives due + // to overflow or underflow. So, we need to make sure to always convert + // the smaller type to a larger type before comparing. + if expectedType.Size() >= actualType.Size() { + return actualValue.Convert(expectedType).Interface() == expected + } + + return expectedValue.Convert(actualType).Interface() == actual +} + +// isNumericType returns true if the type is one of: +// int, int8, int16, int32, int64, uint, uint8, uint16, uint32, uint64, +// float32, float64, complex64, complex128 +func isNumericType(t reflect.Type) bool { + return t.Kind() >= reflect.Int && t.Kind() <= reflect.Complex128 } /* CallerInfo is necessary because the assert functions use the testing object @@ -141,12 +247,11 @@ func CallerInfo() []string { } parts := strings.Split(file, "/") - file = parts[len(parts)-1] if len(parts) > 1 { + filename := parts[len(parts)-1] dir := parts[len(parts)-2] - if (dir != "assert" && dir != "mock" && dir != "require") || file == "mock_test.go" { - path, _ := filepath.Abs(file) - callers = append(callers, fmt.Sprintf("%s:%d", path, line)) + if (dir != "assert" && dir != "mock" && dir != "require") || filename == "mock_test.go" { + callers = append(callers, fmt.Sprintf("%s:%d", file, line)) } } @@ -197,7 +302,7 @@ func messageFromMsgAndArgs(msgAndArgs ...interface{}) string { // Aligns the provided message so that all lines after the first line start at the same location as the first line. // Assumes that the first line starts at the correct location (after carriage return, tab, label, spacer and tab). -// The longestLabelLen parameter specifies the length of the longest label in the output (required becaues this is the +// The longestLabelLen parameter specifies the length of the longest label in the output (required because this is the // basis on which the alignment occurs). func indentMessageLines(message string, longestLabelLen int) string { outBuf := new(bytes.Buffer) @@ -273,7 +378,7 @@ type labeledContent struct { // labeledOutput returns a string consisting of the provided labeledContent. Each labeled output is appended in the following manner: // -// \t{{label}}:{{align_spaces}}\t{{content}}\n +// \t{{label}}:{{align_spaces}}\t{{content}}\n // // The initial carriage return is required to undo/erase any padding added by testing.T.Errorf. The "\t{{label}}:" is for the label. // If a label is shorter than the longest label provided, padding spaces are added to make all the labels match in length. Once this @@ -296,7 +401,7 @@ func labeledOutput(content ...labeledContent) string { // Implements asserts that an object is implemented by the specified interface. // -// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) +// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) func Implements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -313,6 +418,25 @@ func Implements(t TestingT, interfaceObject interface{}, object interface{}, msg return true } +// NotImplements asserts that an object does not implement the specified interface. +// +// assert.NotImplements(t, (*MyInterface)(nil), new(MyObject)) +func NotImplements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + interfaceType := reflect.TypeOf(interfaceObject).Elem() + + if object == nil { + return Fail(t, fmt.Sprintf("Cannot check if nil does not implement %v", interfaceType), msgAndArgs...) + } + if reflect.TypeOf(object).Implements(interfaceType) { + return Fail(t, fmt.Sprintf("%T implements %v", object, interfaceType), msgAndArgs...) + } + + return true +} + // IsType asserts that the specified objects are of the same type. func IsType(t TestingT, expectedType interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -328,7 +452,7 @@ func IsType(t TestingT, expectedType interface{}, object interface{}, msgAndArgs // Equal asserts that two objects are equal. // -// assert.Equal(t, 123, 123) +// assert.Equal(t, 123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -369,7 +493,7 @@ func validateEqualArgs(expected, actual interface{}) error { // Same asserts that two pointers reference the same object. // -// assert.Same(t, ptr1, ptr2) +// assert.Same(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -378,7 +502,13 @@ func Same(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) b h.Helper() } - if !samePointers(expected, actual) { + same, ok := samePointers(expected, actual) + if !ok { + return Fail(t, "Both arguments must be pointers", msgAndArgs...) + } + + if !same { + // both are pointers but not the same type & pointing to the same address return Fail(t, fmt.Sprintf("Not same: \n"+ "expected: %p %#v\n"+ "actual : %p %#v", expected, expected, actual, actual), msgAndArgs...) @@ -389,7 +519,7 @@ func Same(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) b // NotSame asserts that two pointers do not reference the same object. // -// assert.NotSame(t, ptr1, ptr2) +// assert.NotSame(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -398,7 +528,13 @@ func NotSame(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} h.Helper() } - if samePointers(expected, actual) { + same, ok := samePointers(expected, actual) + if !ok { + //fails when the arguments are not pointers + return !(Fail(t, "Both arguments must be pointers", msgAndArgs...)) + } + + if same { return Fail(t, fmt.Sprintf( "Expected and actual point to the same object: %p %#v", expected, expected), msgAndArgs...) @@ -406,28 +542,30 @@ func NotSame(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} return true } -// samePointers compares two generic interface objects and returns whether -// they point to the same object -func samePointers(first, second interface{}) bool { +// samePointers checks if two generic interface objects are pointers of the same +// type pointing to the same object. It returns two values: same indicating if +// they are the same type and point to the same object, and ok indicating that +// both inputs are pointers. +func samePointers(first, second interface{}) (same bool, ok bool) { firstPtr, secondPtr := reflect.ValueOf(first), reflect.ValueOf(second) if firstPtr.Kind() != reflect.Ptr || secondPtr.Kind() != reflect.Ptr { - return false + return false, false //not both are pointers } firstType, secondType := reflect.TypeOf(first), reflect.TypeOf(second) if firstType != secondType { - return false + return false, true // both are pointers, but of different types } // compare pointer addresses - return first == second + return first == second, true } // formatUnequalValues takes two values of arbitrary types and returns string // representations appropriate to be presented to the user. // // If the values are not of like type, the returned strings will be prefixed -// with the type name, and the value will be enclosed in parenthesis similar +// with the type name, and the value will be enclosed in parentheses similar // to a type conversion in the Go grammar. func formatUnequalValues(expected, actual interface{}) (e string, a string) { if reflect.TypeOf(expected) != reflect.TypeOf(actual) { @@ -454,10 +592,10 @@ func truncatingFormat(data interface{}) string { return value } -// EqualValues asserts that two objects are equal or convertable to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // -// assert.EqualValues(t, uint32(123), int32(123)) +// assert.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -475,9 +613,45 @@ func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interfa } +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true +// assert.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false +func EqualExportedValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + + aType := reflect.TypeOf(expected) + bType := reflect.TypeOf(actual) + + if aType != bType { + return Fail(t, fmt.Sprintf("Types expected to match exactly\n\t%v != %v", aType, bType), msgAndArgs...) + } + + expected = copyExportedFields(expected) + actual = copyExportedFields(actual) + + if !ObjectsAreEqualValues(expected, actual) { + diff := diff(expected, actual) + expected, actual = formatUnequalValues(expected, actual) + return Fail(t, fmt.Sprintf("Not equal (comparing only exported fields): \n"+ + "expected: %s\n"+ + "actual : %s%s", expected, actual, diff), msgAndArgs...) + } + + return true +} + // Exactly asserts that two objects are equal in value and type. // -// assert.Exactly(t, int32(123), int64(123)) +// assert.Exactly(t, int32(123), int64(123)) func Exactly(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -496,7 +670,7 @@ func Exactly(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} // NotNil asserts that the specified object is not nil. // -// assert.NotNil(t, err) +// assert.NotNil(t, err) func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { if !isNil(object) { return true @@ -507,17 +681,6 @@ func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return Fail(t, "Expected value not to be nil.", msgAndArgs...) } -// containsKind checks if a specified kind in the slice of kinds. -func containsKind(kinds []reflect.Kind, kind reflect.Kind) bool { - for i := 0; i < len(kinds); i++ { - if kind == kinds[i] { - return true - } - } - - return false -} - // isNil checks if a specified object is nil or not, without Failing. func isNil(object interface{}) bool { if object == nil { @@ -525,16 +688,13 @@ func isNil(object interface{}) bool { } value := reflect.ValueOf(object) - kind := value.Kind() - isNilableKind := containsKind( - []reflect.Kind{ - reflect.Chan, reflect.Func, - reflect.Interface, reflect.Map, - reflect.Ptr, reflect.Slice}, - kind) - - if isNilableKind && value.IsNil() { - return true + switch value.Kind() { + case + reflect.Chan, reflect.Func, + reflect.Interface, reflect.Map, + reflect.Ptr, reflect.Slice, reflect.UnsafePointer: + + return value.IsNil() } return false @@ -542,7 +702,7 @@ func isNil(object interface{}) bool { // Nil asserts that the specified object is nil. // -// assert.Nil(t, err) +// assert.Nil(t, err) func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { if isNil(object) { return true @@ -585,7 +745,7 @@ func isEmpty(object interface{}) bool { // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Empty(t, obj) +// assert.Empty(t, obj) func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { pass := isEmpty(object) if !pass { @@ -602,9 +762,9 @@ func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmpty(t, obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmpty(t, obj) { +// assert.Equal(t, "two", obj[1]) +// } func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { pass := !isEmpty(object) if !pass { @@ -618,40 +778,38 @@ func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { } -// getLen try to get length of object. -// return (false, 0) if impossible. -func getLen(x interface{}) (ok bool, length int) { +// getLen tries to get the length of an object. +// It returns (0, false) if impossible. +func getLen(x interface{}) (length int, ok bool) { v := reflect.ValueOf(x) defer func() { - if e := recover(); e != nil { - ok = false - } + ok = recover() == nil }() - return true, v.Len() + return v.Len(), true } // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// assert.Len(t, mySlice, 3) +// assert.Len(t, mySlice, 3) func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } - ok, l := getLen(object) + l, ok := getLen(object) if !ok { - return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", object), msgAndArgs...) + return Fail(t, fmt.Sprintf("\"%v\" could not be applied builtin len()", object), msgAndArgs...) } if l != length { - return Fail(t, fmt.Sprintf("\"%s\" should have %d item(s), but has %d", object, length, l), msgAndArgs...) + return Fail(t, fmt.Sprintf("\"%v\" should have %d item(s), but has %d", object, length, l), msgAndArgs...) } return true } // True asserts that the specified value is true. // -// assert.True(t, myBool) +// assert.True(t, myBool) func True(t TestingT, value bool, msgAndArgs ...interface{}) bool { if !value { if h, ok := t.(tHelper); ok { @@ -666,7 +824,7 @@ func True(t TestingT, value bool, msgAndArgs ...interface{}) bool { // False asserts that the specified value is false. // -// assert.False(t, myBool) +// assert.False(t, myBool) func False(t TestingT, value bool, msgAndArgs ...interface{}) bool { if value { if h, ok := t.(tHelper); ok { @@ -681,7 +839,7 @@ func False(t TestingT, value bool, msgAndArgs ...interface{}) bool { // NotEqual asserts that the specified values are NOT equal. // -// assert.NotEqual(t, obj1, obj2) +// assert.NotEqual(t, obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -704,7 +862,7 @@ func NotEqual(t TestingT, expected, actual interface{}, msgAndArgs ...interface{ // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValues(t, obj1, obj2) +// assert.NotEqualValues(t, obj1, obj2) func NotEqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -763,9 +921,9 @@ func containsElement(list interface{}, element interface{}) (ok, found bool) { // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Contains(t, "Hello World", "World") -// assert.Contains(t, ["Hello", "World"], "World") -// assert.Contains(t, {"Hello": "World"}, "Hello") +// assert.Contains(t, "Hello World", "World") +// assert.Contains(t, ["Hello", "World"], "World") +// assert.Contains(t, {"Hello": "World"}, "Hello") func Contains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -786,9 +944,9 @@ func Contains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bo // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContains(t, "Hello World", "Earth") -// assert.NotContains(t, ["Hello", "World"], "Earth") -// assert.NotContains(t, {"Hello": "World"}, "Earth") +// assert.NotContains(t, "Hello World", "Earth") +// assert.NotContains(t, ["Hello", "World"], "Earth") +// assert.NotContains(t, {"Hello": "World"}, "Earth") func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -796,20 +954,21 @@ func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) ok, found := containsElement(s, contains) if !ok { - return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", s), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v could not be applied builtin len()", s), msgAndArgs...) } if found { - return Fail(t, fmt.Sprintf("\"%s\" should not contain \"%s\"", s, contains), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v should not contain %#v", s, contains), msgAndArgs...) } return true } -// Subset asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subset asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// assert.Subset(t, [1, 2, 3], [1, 2]) +// assert.Subset(t, {"x": 1, "y": 2}, {"x": 1}) func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok bool) { if h, ok := t.(tHelper); ok { h.Helper() @@ -818,59 +977,56 @@ func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok return true // we consider nil to be equal to the nil set } - defer func() { - if e := recover(); e != nil { - ok = false - } - }() - listKind := reflect.TypeOf(list).Kind() - subsetKind := reflect.TypeOf(subset).Kind() - if listKind != reflect.Array && listKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", list, listKind), msgAndArgs...) } + subsetKind := reflect.TypeOf(subset).Kind() if subsetKind != reflect.Array && subsetKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", subset, subsetKind), msgAndArgs...) } - subsetValue := reflect.ValueOf(subset) if subsetKind == reflect.Map && listKind == reflect.Map { - listValue := reflect.ValueOf(list) - subsetKeys := subsetValue.MapKeys() + subsetMap := reflect.ValueOf(subset) + actualMap := reflect.ValueOf(list) - for i := 0; i < len(subsetKeys); i++ { - subsetKey := subsetKeys[i] - subsetElement := subsetValue.MapIndex(subsetKey).Interface() - listElement := listValue.MapIndex(subsetKey).Interface() + for _, k := range subsetMap.MapKeys() { + ev := subsetMap.MapIndex(k) + av := actualMap.MapIndex(k) - if !ObjectsAreEqual(subsetElement, listElement) { - return Fail(t, fmt.Sprintf("\"%s\" does not contain \"%s\"", list, subsetElement), msgAndArgs...) + if !av.IsValid() { + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, subset), msgAndArgs...) + } + if !ObjectsAreEqual(ev.Interface(), av.Interface()) { + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, subset), msgAndArgs...) } } return true } - for i := 0; i < subsetValue.Len(); i++ { - element := subsetValue.Index(i).Interface() + subsetList := reflect.ValueOf(subset) + for i := 0; i < subsetList.Len(); i++ { + element := subsetList.Index(i).Interface() ok, found := containsElement(list, element) if !ok { - return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", list), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v could not be applied builtin len()", list), msgAndArgs...) } if !found { - return Fail(t, fmt.Sprintf("\"%s\" does not contain \"%s\"", list, element), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, element), msgAndArgs...) } } return true } -// NotSubset asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubset asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// assert.NotSubset(t, [1, 3, 4], [1, 2]) +// assert.NotSubset(t, {"x": 1, "y": 2}, {"z": 3}) func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok bool) { if h, ok := t.(tHelper); ok { h.Helper() @@ -879,34 +1035,28 @@ func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) return Fail(t, "nil is the empty set which is a subset of every set", msgAndArgs...) } - defer func() { - if e := recover(); e != nil { - ok = false - } - }() - listKind := reflect.TypeOf(list).Kind() - subsetKind := reflect.TypeOf(subset).Kind() - if listKind != reflect.Array && listKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", list, listKind), msgAndArgs...) } + subsetKind := reflect.TypeOf(subset).Kind() if subsetKind != reflect.Array && subsetKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", subset, subsetKind), msgAndArgs...) } - subsetValue := reflect.ValueOf(subset) if subsetKind == reflect.Map && listKind == reflect.Map { - listValue := reflect.ValueOf(list) - subsetKeys := subsetValue.MapKeys() + subsetMap := reflect.ValueOf(subset) + actualMap := reflect.ValueOf(list) - for i := 0; i < len(subsetKeys); i++ { - subsetKey := subsetKeys[i] - subsetElement := subsetValue.MapIndex(subsetKey).Interface() - listElement := listValue.MapIndex(subsetKey).Interface() + for _, k := range subsetMap.MapKeys() { + ev := subsetMap.MapIndex(k) + av := actualMap.MapIndex(k) - if !ObjectsAreEqual(subsetElement, listElement) { + if !av.IsValid() { + return true + } + if !ObjectsAreEqual(ev.Interface(), av.Interface()) { return true } } @@ -914,8 +1064,9 @@ func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) return Fail(t, fmt.Sprintf("%q is a subset of %q", subset, list), msgAndArgs...) } - for i := 0; i < subsetValue.Len(); i++ { - element := subsetValue.Index(i).Interface() + subsetList := reflect.ValueOf(subset) + for i := 0; i < subsetList.Len(); i++ { + element := subsetList.Index(i).Interface() ok, found := containsElement(list, element) if !ok { return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", list), msgAndArgs...) @@ -1024,6 +1175,39 @@ func formatListDiff(listA, listB interface{}, extraA, extraB []interface{}) stri return msg.String() } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// assert.NotElementsMatch(t, [1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// assert.NotElementsMatch(t, [1, 1, 2, 3], [1, 2, 3]) -> true +// +// assert.NotElementsMatch(t, [1, 2, 3], [1, 2, 4]) -> true +func NotElementsMatch(t TestingT, listA, listB interface{}, msgAndArgs ...interface{}) (ok bool) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if isEmpty(listA) && isEmpty(listB) { + return Fail(t, "listA and listB contain the same elements", msgAndArgs) + } + + if !isList(t, listA, msgAndArgs...) { + return Fail(t, "listA is not a list type", msgAndArgs...) + } + if !isList(t, listB, msgAndArgs...) { + return Fail(t, "listB is not a list type", msgAndArgs...) + } + + extraA, extraB := diffLists(listA, listB) + if len(extraA) == 0 && len(extraB) == 0 { + return Fail(t, "listA and listB contain the same elements", msgAndArgs) + } + + return true +} + // Condition uses a Comparison to assert a complex condition. func Condition(t TestingT, comp Comparison, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -1060,7 +1244,7 @@ func didPanic(f PanicTestFunc) (didPanic bool, message interface{}, stack string // Panics asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panics(t, func(){ GoCrazy() }) +// assert.Panics(t, func(){ GoCrazy() }) func Panics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1076,7 +1260,7 @@ func Panics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) func PanicsWithValue(t TestingT, expected interface{}, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1097,7 +1281,7 @@ func PanicsWithValue(t TestingT, expected interface{}, f PanicTestFunc, msgAndAr // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) func PanicsWithError(t TestingT, errString string, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1117,7 +1301,7 @@ func PanicsWithError(t TestingT, errString string, f PanicTestFunc, msgAndArgs . // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanics(t, func(){ RemainCalm() }) +// assert.NotPanics(t, func(){ RemainCalm() }) func NotPanics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1132,7 +1316,7 @@ func NotPanics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { // WithinDuration asserts that the two times are within duration delta of each other. // -// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) +// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) func WithinDuration(t TestingT, expected, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1148,7 +1332,7 @@ func WithinDuration(t TestingT, expected, actual time.Time, delta time.Duration, // WithinRange asserts that a time is within a time range (inclusive). // -// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func WithinRange(t TestingT, actual, start, end time.Time, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1207,7 +1391,7 @@ func toFloat(x interface{}) (float64, bool) { // InDelta asserts that the two numerals are within delta of each other. // -// assert.InDelta(t, math.Pi, 22/7.0, 0.01) +// assert.InDelta(t, math.Pi, 22/7.0, 0.01) func InDelta(t TestingT, expected, actual interface{}, delta float64, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1336,12 +1520,15 @@ func InEpsilon(t TestingT, expected, actual interface{}, epsilon float64, msgAnd h.Helper() } if math.IsNaN(epsilon) { - return Fail(t, "epsilon must not be NaN") + return Fail(t, "epsilon must not be NaN", msgAndArgs...) } actualEpsilon, err := calcRelativeError(expected, actual) if err != nil { return Fail(t, err.Error(), msgAndArgs...) } + if math.IsNaN(actualEpsilon) { + return Fail(t, "relative error is NaN", msgAndArgs...) + } if actualEpsilon > epsilon { return Fail(t, fmt.Sprintf("Relative error is too high: %#v (expected)\n"+ " < %#v (actual)", epsilon, actualEpsilon), msgAndArgs...) @@ -1355,19 +1542,26 @@ func InEpsilonSlice(t TestingT, expected, actual interface{}, epsilon float64, m if h, ok := t.(tHelper); ok { h.Helper() } - if expected == nil || actual == nil || - reflect.TypeOf(actual).Kind() != reflect.Slice || - reflect.TypeOf(expected).Kind() != reflect.Slice { + + if expected == nil || actual == nil { return Fail(t, "Parameters must be slice", msgAndArgs...) } - actualSlice := reflect.ValueOf(actual) expectedSlice := reflect.ValueOf(expected) + actualSlice := reflect.ValueOf(actual) - for i := 0; i < actualSlice.Len(); i++ { - result := InEpsilon(t, actualSlice.Index(i).Interface(), expectedSlice.Index(i).Interface(), epsilon) - if !result { - return result + if expectedSlice.Type().Kind() != reflect.Slice { + return Fail(t, "Expected value must be slice", msgAndArgs...) + } + + expectedLen := expectedSlice.Len() + if !IsType(t, expected, actual) || !Len(t, actual, expectedLen) { + return false + } + + for i := 0; i < expectedLen; i++ { + if !InEpsilon(t, expectedSlice.Index(i).Interface(), actualSlice.Index(i).Interface(), epsilon, "at index %d", i) { + return false } } @@ -1380,10 +1574,10 @@ func InEpsilonSlice(t TestingT, expected, actual interface{}, epsilon float64, m // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoError(t, err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoError(t, err) { +// assert.Equal(t, expectedObj, actualObj) +// } func NoError(t TestingT, err error, msgAndArgs ...interface{}) bool { if err != nil { if h, ok := t.(tHelper); ok { @@ -1397,10 +1591,10 @@ func NoError(t TestingT, err error, msgAndArgs ...interface{}) bool { // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Error(t, err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if assert.Error(t, err) { +// assert.Equal(t, expectedError, err) +// } func Error(t TestingT, err error, msgAndArgs ...interface{}) bool { if err == nil { if h, ok := t.(tHelper); ok { @@ -1415,8 +1609,8 @@ func Error(t TestingT, err error, msgAndArgs ...interface{}) bool { // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualError(t, err, expectedErrorString) +// actualObj, err := SomeFunction() +// assert.EqualError(t, err, expectedErrorString) func EqualError(t TestingT, theError error, errString string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1438,8 +1632,8 @@ func EqualError(t TestingT, theError error, errString string, msgAndArgs ...inte // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContains(t, err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// assert.ErrorContains(t, err, expectedErrorSubString) func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1458,7 +1652,6 @@ func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...in // matchRegexp return true if a specified regexp matches a string. func matchRegexp(rx interface{}, str interface{}) bool { - var r *regexp.Regexp if rr, ok := rx.(*regexp.Regexp); ok { r = rr @@ -1466,14 +1659,21 @@ func matchRegexp(rx interface{}, str interface{}) bool { r = regexp.MustCompile(fmt.Sprint(rx)) } - return (r.FindStringIndex(fmt.Sprint(str)) != nil) + switch v := str.(type) { + case []byte: + return r.Match(v) + case string: + return r.MatchString(v) + default: + return r.MatchString(fmt.Sprint(v)) + } } // Regexp asserts that a specified regexp matches a string. // -// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") -// assert.Regexp(t, "start...$", "it's not starting") +// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") +// assert.Regexp(t, "start...$", "it's not starting") func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1490,8 +1690,8 @@ func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface // NotRegexp asserts that a specified regexp does not match a string. // -// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") -// assert.NotRegexp(t, "^start", "it's not starting") +// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") +// assert.NotRegexp(t, "^start", "it's not starting") func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1603,7 +1803,7 @@ func NoDirExists(t TestingT, path string, msgAndArgs ...interface{}) bool { // JSONEq asserts that two JSON strings are equivalent. // -// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1719,14 +1919,14 @@ var spewConfigStringerEnabled = spew.ConfigState{ MaxDepth: 10, } -type tHelper interface { +type tHelper = interface { Helper() } // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) +// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1756,10 +1956,108 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t } } +// CollectT implements the TestingT interface and collects all errors. +type CollectT struct { + // A slice of errors. Non-nil slice denotes a failure. + // If it's non-nil but len(c.errors) == 0, this is also a failure + // obtained by direct c.FailNow() call. + errors []error +} + +// Errorf collects the error. +func (c *CollectT) Errorf(format string, args ...interface{}) { + c.errors = append(c.errors, fmt.Errorf(format, args...)) +} + +// FailNow stops execution by calling runtime.Goexit. +func (c *CollectT) FailNow() { + c.fail() + runtime.Goexit() +} + +// Deprecated: That was a method for internal usage that should not have been published. Now just panics. +func (*CollectT) Reset() { + panic("Reset() is deprecated") +} + +// Deprecated: That was a method for internal usage that should not have been published. Now just panics. +func (*CollectT) Copy(TestingT) { + panic("Copy() is deprecated") +} + +func (c *CollectT) fail() { + if !c.failed() { + c.errors = []error{} // Make it non-nil to mark a failure. + } +} + +func (c *CollectT) failed() bool { + return c.errors != nil +} + +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithT(t, func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithT(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + + var lastFinishedTickErrs []error + ch := make(chan *CollectT, 1) + + timer := time.NewTimer(waitFor) + defer timer.Stop() + + ticker := time.NewTicker(tick) + defer ticker.Stop() + + for tick := ticker.C; ; { + select { + case <-timer.C: + for _, err := range lastFinishedTickErrs { + t.Errorf("%v", err) + } + return Fail(t, "Condition never satisfied", msgAndArgs...) + case <-tick: + tick = nil + go func() { + collect := new(CollectT) + defer func() { + ch <- collect + }() + condition(collect) + }() + case collect := <-ch: + if !collect.failed() { + return true + } + // Keep the errors from the last ended condition, so that they can be copied to t if timeout is reached. + lastFinishedTickErrs = collect.errors + tick = ticker.C + } + } +} + // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) +// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1812,7 +2110,7 @@ func ErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { ), msgAndArgs...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -1853,6 +2151,24 @@ func ErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{ ), msgAndArgs...) } +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if !errors.As(err, target) { + return true + } + + chain := buildErrorChainString(err) + + return Fail(t, fmt.Sprintf("Target error should not be in err chain:\n"+ + "found: %q\n"+ + "in chain: %s", target, chain, + ), msgAndArgs...) +} + func buildErrorChainString(err error) string { if err == nil { return "" diff --git a/vendor/github.com/stretchr/testify/assert/doc.go b/vendor/github.com/stretchr/testify/assert/doc.go index c9dccc4d..4953981d 100644 --- a/vendor/github.com/stretchr/testify/assert/doc.go +++ b/vendor/github.com/stretchr/testify/assert/doc.go @@ -1,39 +1,40 @@ // Package assert provides a set of comprehensive testing tools for use with the normal Go testing system. // -// Example Usage +// # Example Usage // // The following is a complete example using assert in a standard test function: -// import ( -// "testing" -// "github.com/stretchr/testify/assert" -// ) // -// func TestSomething(t *testing.T) { +// import ( +// "testing" +// "github.com/stretchr/testify/assert" +// ) // -// var a string = "Hello" -// var b string = "Hello" +// func TestSomething(t *testing.T) { // -// assert.Equal(t, a, b, "The two words should be the same.") +// var a string = "Hello" +// var b string = "Hello" // -// } +// assert.Equal(t, a, b, "The two words should be the same.") +// +// } // // if you assert many times, use the format below: // -// import ( -// "testing" -// "github.com/stretchr/testify/assert" -// ) +// import ( +// "testing" +// "github.com/stretchr/testify/assert" +// ) // -// func TestSomething(t *testing.T) { -// assert := assert.New(t) +// func TestSomething(t *testing.T) { +// assert := assert.New(t) // -// var a string = "Hello" -// var b string = "Hello" +// var a string = "Hello" +// var b string = "Hello" // -// assert.Equal(a, b, "The two words should be the same.") -// } +// assert.Equal(a, b, "The two words should be the same.") +// } // -// Assertions +// # Assertions // // Assertions allow you to easily write test code, and are global funcs in the `assert` package. // All assertion functions take, as the first argument, the `*testing.T` object provided by the diff --git a/vendor/github.com/stretchr/testify/assert/http_assertions.go b/vendor/github.com/stretchr/testify/assert/http_assertions.go index 4ed341dd..861ed4b7 100644 --- a/vendor/github.com/stretchr/testify/assert/http_assertions.go +++ b/vendor/github.com/stretchr/testify/assert/http_assertions.go @@ -12,7 +12,7 @@ import ( // an error if building a new request fails. func httpCode(handler http.HandlerFunc, method, url string, values url.Values) (int, error) { w := httptest.NewRecorder() - req, err := http.NewRequest(method, url, nil) + req, err := http.NewRequest(method, url, http.NoBody) if err != nil { return -1, err } @@ -23,7 +23,7 @@ func httpCode(handler http.HandlerFunc, method, url string, values url.Values) ( // HTTPSuccess asserts that a specified handler returns a success status code. // -// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) +// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccess(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -32,12 +32,12 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method, url string, value } code, err := httpCode(handler, method, url, values) if err != nil { - Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err)) + Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err), msgAndArgs...) } isSuccessCode := code >= http.StatusOK && code <= http.StatusPartialContent if !isSuccessCode { - Fail(t, fmt.Sprintf("Expected HTTP success status code for %q but received %d", url+"?"+values.Encode(), code)) + Fail(t, fmt.Sprintf("Expected HTTP success status code for %q but received %d", url+"?"+values.Encode(), code), msgAndArgs...) } return isSuccessCode @@ -45,7 +45,7 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method, url string, value // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirect(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -54,12 +54,12 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method, url string, valu } code, err := httpCode(handler, method, url, values) if err != nil { - Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err)) + Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err), msgAndArgs...) } isRedirectCode := code >= http.StatusMultipleChoices && code <= http.StatusTemporaryRedirect if !isRedirectCode { - Fail(t, fmt.Sprintf("Expected HTTP redirect status code for %q but received %d", url+"?"+values.Encode(), code)) + Fail(t, fmt.Sprintf("Expected HTTP redirect status code for %q but received %d", url+"?"+values.Encode(), code), msgAndArgs...) } return isRedirectCode @@ -67,7 +67,7 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method, url string, valu // HTTPError asserts that a specified handler returns an error status code. // -// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPError(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -76,12 +76,12 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method, url string, values } code, err := httpCode(handler, method, url, values) if err != nil { - Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err)) + Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err), msgAndArgs...) } isErrorCode := code >= http.StatusBadRequest if !isErrorCode { - Fail(t, fmt.Sprintf("Expected HTTP error status code for %q but received %d", url+"?"+values.Encode(), code)) + Fail(t, fmt.Sprintf("Expected HTTP error status code for %q but received %d", url+"?"+values.Encode(), code), msgAndArgs...) } return isErrorCode @@ -89,7 +89,7 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method, url string, values // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) +// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) bool { @@ -98,12 +98,12 @@ func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method, url string, va } code, err := httpCode(handler, method, url, values) if err != nil { - Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err)) + Fail(t, fmt.Sprintf("Failed to build test request, got error: %s", err), msgAndArgs...) } successful := code == statuscode if !successful { - Fail(t, fmt.Sprintf("Expected HTTP status code %d for %q but received %d", statuscode, url+"?"+values.Encode(), code)) + Fail(t, fmt.Sprintf("Expected HTTP status code %d for %q but received %d", statuscode, url+"?"+values.Encode(), code), msgAndArgs...) } return successful @@ -113,7 +113,10 @@ func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method, url string, va // empty string if building a new request fails. func HTTPBody(handler http.HandlerFunc, method, url string, values url.Values) string { w := httptest.NewRecorder() - req, err := http.NewRequest(method, url+"?"+values.Encode(), nil) + if len(values) > 0 { + url += "?" + values.Encode() + } + req, err := http.NewRequest(method, url, http.NoBody) if err != nil { return "" } @@ -124,7 +127,7 @@ func HTTPBody(handler http.HandlerFunc, method, url string, values url.Values) s // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -135,7 +138,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method, url string, contains := strings.Contains(body, fmt.Sprint(str)) if !contains { - Fail(t, fmt.Sprintf("Expected response body for \"%s\" to contain \"%s\" but found \"%s\"", url+"?"+values.Encode(), str, body)) + Fail(t, fmt.Sprintf("Expected response body for \"%s\" to contain \"%s\" but found \"%s\"", url+"?"+values.Encode(), str, body), msgAndArgs...) } return contains @@ -144,7 +147,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method, url string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -155,7 +158,7 @@ func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method, url strin contains := strings.Contains(body, fmt.Sprint(str)) if contains { - Fail(t, fmt.Sprintf("Expected response body for \"%s\" to NOT contain \"%s\" but found \"%s\"", url+"?"+values.Encode(), str, body)) + Fail(t, fmt.Sprintf("Expected response body for \"%s\" to NOT contain \"%s\" but found \"%s\"", url+"?"+values.Encode(), str, body), msgAndArgs...) } return !contains diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go new file mode 100644 index 00000000..baa0cc7d --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go @@ -0,0 +1,25 @@ +//go:build testify_yaml_custom && !testify_yaml_fail && !testify_yaml_default +// +build testify_yaml_custom,!testify_yaml_fail,!testify_yaml_default + +// Package yaml is an implementation of YAML functions that calls a pluggable implementation. +// +// This implementation is selected with the testify_yaml_custom build tag. +// +// go test -tags testify_yaml_custom +// +// This implementation can be used at build time to replace the default implementation +// to avoid linking with [gopkg.in/yaml.v3]. +// +// In your test package: +// +// import assertYaml "github.com/stretchr/testify/assert/yaml" +// +// func init() { +// assertYaml.Unmarshal = func (in []byte, out interface{}) error { +// // ... +// return nil +// } +// } +package yaml + +var Unmarshal func(in []byte, out interface{}) error diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go new file mode 100644 index 00000000..b83c6cf6 --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go @@ -0,0 +1,37 @@ +//go:build !testify_yaml_fail && !testify_yaml_custom +// +build !testify_yaml_fail,!testify_yaml_custom + +// Package yaml is just an indirection to handle YAML deserialization. +// +// This package is just an indirection that allows the builder to override the +// indirection with an alternative implementation of this package that uses +// another implementation of YAML deserialization. This allows to not either not +// use YAML deserialization at all, or to use another implementation than +// [gopkg.in/yaml.v3] (for example for license compatibility reasons, see [PR #1120]). +// +// Alternative implementations are selected using build tags: +// +// - testify_yaml_fail: [Unmarshal] always fails with an error +// - testify_yaml_custom: [Unmarshal] is a variable. Caller must initialize it +// before calling any of [github.com/stretchr/testify/assert.YAMLEq] or +// [github.com/stretchr/testify/assert.YAMLEqf]. +// +// Usage: +// +// go test -tags testify_yaml_fail +// +// You can check with "go list" which implementation is linked: +// +// go list -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// go list -tags testify_yaml_fail -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// go list -tags testify_yaml_custom -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// +// [PR #1120]: https://github.com/stretchr/testify/pull/1120 +package yaml + +import goyaml "gopkg.in/yaml.v3" + +// Unmarshal is just a wrapper of [gopkg.in/yaml.v3.Unmarshal]. +func Unmarshal(in []byte, out interface{}) error { + return goyaml.Unmarshal(in, out) +} diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go new file mode 100644 index 00000000..e78f7dfe --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go @@ -0,0 +1,18 @@ +//go:build testify_yaml_fail && !testify_yaml_custom && !testify_yaml_default +// +build testify_yaml_fail,!testify_yaml_custom,!testify_yaml_default + +// Package yaml is an implementation of YAML functions that always fail. +// +// This implementation can be used at build time to replace the default implementation +// to avoid linking with [gopkg.in/yaml.v3]: +// +// go test -tags testify_yaml_fail +package yaml + +import "errors" + +var errNotImplemented = errors.New("YAML functions are not available (see https://pkg.go.dev/github.com/stretchr/testify/assert/yaml)") + +func Unmarshal([]byte, interface{}) error { + return errNotImplemented +} diff --git a/vendor/github.com/stretchr/testify/require/doc.go b/vendor/github.com/stretchr/testify/require/doc.go index 169de392..96843472 100644 --- a/vendor/github.com/stretchr/testify/require/doc.go +++ b/vendor/github.com/stretchr/testify/require/doc.go @@ -1,24 +1,25 @@ // Package require implements the same assertions as the `assert` package but // stops test execution when a test fails. // -// Example Usage +// # Example Usage // // The following is a complete example using require in a standard test function: -// import ( -// "testing" -// "github.com/stretchr/testify/require" -// ) // -// func TestSomething(t *testing.T) { +// import ( +// "testing" +// "github.com/stretchr/testify/require" +// ) // -// var a string = "Hello" -// var b string = "Hello" +// func TestSomething(t *testing.T) { // -// require.Equal(t, a, b, "The two words should be the same.") +// var a string = "Hello" +// var b string = "Hello" // -// } +// require.Equal(t, a, b, "The two words should be the same.") // -// Assertions +// } +// +// # Assertions // // The `require` package have same global functions as in the `assert` package, // but instead of returning a boolean result they call `t.FailNow()`. diff --git a/vendor/github.com/stretchr/testify/require/require.go b/vendor/github.com/stretchr/testify/require/require.go index 880853f5..d8921950 100644 --- a/vendor/github.com/stretchr/testify/require/require.go +++ b/vendor/github.com/stretchr/testify/require/require.go @@ -1,7 +1,4 @@ -/* -* CODE GENERATED AUTOMATICALLY WITH github.com/stretchr/testify/_codegen -* THIS FILE MUST NOT BE EDITED BY HAND - */ +// Code generated with github.com/stretchr/testify/_codegen; DO NOT EDIT. package require @@ -37,9 +34,9 @@ func Conditionf(t TestingT, comp assert.Comparison, msg string, args ...interfac // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Contains(t, "Hello World", "World") -// assert.Contains(t, ["Hello", "World"], "World") -// assert.Contains(t, {"Hello": "World"}, "Hello") +// require.Contains(t, "Hello World", "World") +// require.Contains(t, ["Hello", "World"], "World") +// require.Contains(t, {"Hello": "World"}, "Hello") func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -53,9 +50,9 @@ func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...int // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") -// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") -// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") +// require.Containsf(t, "Hello World", "World", "error message %s", "formatted") +// require.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") +// require.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") func Containsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -94,7 +91,7 @@ func DirExistsf(t TestingT, path string, msg string, args ...interface{}) { // listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, // the number of appearances of each of them in both lists should match. // -// assert.ElementsMatch(t, [1, 3, 2, 3], [1, 3, 3, 2]) +// require.ElementsMatch(t, [1, 3, 2, 3], [1, 3, 3, 2]) func ElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -109,7 +106,7 @@ func ElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs // listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, // the number of appearances of each of them in both lists should match. // -// assert.ElementsMatchf(t, [1, 3, 2, 3], [1, 3, 3, 2], "error message %s", "formatted") +// require.ElementsMatchf(t, [1, 3, 2, 3], [1, 3, 3, 2], "error message %s", "formatted") func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -123,7 +120,7 @@ func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Empty(t, obj) +// require.Empty(t, obj) func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -137,7 +134,7 @@ func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Emptyf(t, obj, "error message %s", "formatted") +// require.Emptyf(t, obj, "error message %s", "formatted") func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -150,7 +147,7 @@ func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { // Equal asserts that two objects are equal. // -// assert.Equal(t, 123, 123) +// require.Equal(t, 123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -168,8 +165,8 @@ func Equal(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...i // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualError(t, err, expectedErrorString) +// actualObj, err := SomeFunction() +// require.EqualError(t, err, expectedErrorString) func EqualError(t TestingT, theError error, errString string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -183,8 +180,8 @@ func EqualError(t TestingT, theError error, errString string, msgAndArgs ...inte // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// require.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") func EqualErrorf(t TestingT, theError error, errString string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -195,10 +192,50 @@ func EqualErrorf(t TestingT, theError error, errString string, msg string, args t.FailNow() } -// EqualValues asserts that two objects are equal or convertable to the same types -// and equal. +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. // -// assert.EqualValues(t, uint32(123), int32(123)) +// type S struct { +// Exported int +// notExported int +// } +// require.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true +// require.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false +func EqualExportedValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EqualExportedValues(t, expected, actual, msgAndArgs...) { + return + } + t.FailNow() +} + +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// require.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// require.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EqualExportedValuesf(t, expected, actual, msg, args...) { + return + } + t.FailNow() +} + +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. +// +// require.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -209,10 +246,10 @@ func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArg t.FailNow() } -// EqualValuesf asserts that two objects are equal or convertable to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // -// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") +// require.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -225,7 +262,7 @@ func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg stri // Equalf asserts that two objects are equal. // -// assert.Equalf(t, 123, 123, "error message %s", "formatted") +// require.Equalf(t, 123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -242,10 +279,10 @@ func Equalf(t TestingT, expected interface{}, actual interface{}, msg string, ar // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Error(t, err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if require.Error(t, err) { +// require.Equal(t, expectedError, err) +// } func Error(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -283,8 +320,8 @@ func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...int // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContains(t, err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// require.ErrorContains(t, err, expectedErrorSubString) func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -298,8 +335,8 @@ func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...in // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// require.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") func ErrorContainsf(t TestingT, theError error, contains string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -336,10 +373,10 @@ func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Errorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if require.Errorf(t, err, "error message %s", "formatted") { +// require.Equal(t, expectedErrorf, err) +// } func Errorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -353,7 +390,7 @@ func Errorf(t TestingT, err error, msg string, args ...interface{}) { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) +// require.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -364,10 +401,66 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t t.FailNow() } +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// require.EventuallyWithT(t, func(c *require.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// require.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithT(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EventuallyWithT(t, condition, waitFor, tick, msgAndArgs...) { + return + } + t.FailNow() +} + +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// require.EventuallyWithTf(t, func(c *require.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// require.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithTf(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EventuallyWithTf(t, condition, waitFor, tick, msg, args...) { + return + } + t.FailNow() +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// require.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -380,7 +473,7 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick // Exactly asserts that two objects are equal in value and type. // -// assert.Exactly(t, int32(123), int64(123)) +// require.Exactly(t, int32(123), int64(123)) func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -393,7 +486,7 @@ func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // Exactlyf asserts that two objects are equal in value and type. // -// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") +// require.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") func Exactlyf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -450,7 +543,7 @@ func Failf(t TestingT, failureMessage string, msg string, args ...interface{}) { // False asserts that the specified value is false. // -// assert.False(t, myBool) +// require.False(t, myBool) func False(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -463,7 +556,7 @@ func False(t TestingT, value bool, msgAndArgs ...interface{}) { // Falsef asserts that the specified value is false. // -// assert.Falsef(t, myBool, "error message %s", "formatted") +// require.Falsef(t, myBool, "error message %s", "formatted") func Falsef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -500,9 +593,9 @@ func FileExistsf(t TestingT, path string, msg string, args ...interface{}) { // Greater asserts that the first element is greater than the second // -// assert.Greater(t, 2, 1) -// assert.Greater(t, float64(2), float64(1)) -// assert.Greater(t, "b", "a") +// require.Greater(t, 2, 1) +// require.Greater(t, float64(2), float64(1)) +// require.Greater(t, "b", "a") func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -515,10 +608,10 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqual(t, 2, 1) -// assert.GreaterOrEqual(t, 2, 2) -// assert.GreaterOrEqual(t, "b", "a") -// assert.GreaterOrEqual(t, "b", "b") +// require.GreaterOrEqual(t, 2, 1) +// require.GreaterOrEqual(t, 2, 2) +// require.GreaterOrEqual(t, "b", "a") +// require.GreaterOrEqual(t, "b", "b") func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -531,10 +624,10 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") +// require.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") +// require.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") +// require.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") +// require.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -547,9 +640,9 @@ func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, arg // Greaterf asserts that the first element is greater than the second // -// assert.Greaterf(t, 2, 1, "error message %s", "formatted") -// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") -// assert.Greaterf(t, "b", "a", "error message %s", "formatted") +// require.Greaterf(t, 2, 1, "error message %s", "formatted") +// require.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") +// require.Greaterf(t, "b", "a", "error message %s", "formatted") func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -563,7 +656,7 @@ func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...in // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// require.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -579,7 +672,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url s // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// require.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -595,7 +688,7 @@ func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// require.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -611,7 +704,7 @@ func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, ur // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// require.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -626,7 +719,7 @@ func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, u // HTTPError asserts that a specified handler returns an error status code. // -// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -641,7 +734,7 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPErrorf asserts that a specified handler returns an error status code. // -// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -656,7 +749,7 @@ func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -671,7 +764,7 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url strin // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -686,7 +779,7 @@ func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url stri // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) +// require.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) { @@ -701,7 +794,7 @@ func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url str // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// require.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) { @@ -716,7 +809,7 @@ func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url st // HTTPSuccess asserts that a specified handler returns a success status code. // -// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) +// require.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -731,7 +824,7 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string // HTTPSuccessf asserts that a specified handler returns a success status code. // -// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// require.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -746,7 +839,7 @@ func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url strin // Implements asserts that an object is implemented by the specified interface. // -// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) +// require.Implements(t, (*MyInterface)(nil), new(MyObject)) func Implements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -759,7 +852,7 @@ func Implements(t TestingT, interfaceObject interface{}, object interface{}, msg // Implementsf asserts that an object is implemented by the specified interface. // -// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// require.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -772,7 +865,7 @@ func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, ms // InDelta asserts that the two numerals are within delta of each other. // -// assert.InDelta(t, math.Pi, 22/7.0, 0.01) +// require.InDelta(t, math.Pi, 22/7.0, 0.01) func InDelta(t TestingT, expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -829,7 +922,7 @@ func InDeltaSlicef(t TestingT, expected interface{}, actual interface{}, delta f // InDeltaf asserts that the two numerals are within delta of each other. // -// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// require.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func InDeltaf(t TestingT, expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -886,9 +979,9 @@ func InEpsilonf(t TestingT, expected interface{}, actual interface{}, epsilon fl // IsDecreasing asserts that the collection is decreasing // -// assert.IsDecreasing(t, []int{2, 1, 0}) -// assert.IsDecreasing(t, []float{2, 1}) -// assert.IsDecreasing(t, []string{"b", "a"}) +// require.IsDecreasing(t, []int{2, 1, 0}) +// require.IsDecreasing(t, []float{2, 1}) +// require.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -901,9 +994,9 @@ func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsDecreasingf asserts that the collection is decreasing // -// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// require.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// require.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// require.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -916,9 +1009,9 @@ func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface // IsIncreasing asserts that the collection is increasing // -// assert.IsIncreasing(t, []int{1, 2, 3}) -// assert.IsIncreasing(t, []float{1, 2}) -// assert.IsIncreasing(t, []string{"a", "b"}) +// require.IsIncreasing(t, []int{1, 2, 3}) +// require.IsIncreasing(t, []float{1, 2}) +// require.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -931,9 +1024,9 @@ func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsIncreasingf asserts that the collection is increasing // -// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// require.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// require.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// require.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -946,9 +1039,9 @@ func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface // IsNonDecreasing asserts that the collection is not decreasing // -// assert.IsNonDecreasing(t, []int{1, 1, 2}) -// assert.IsNonDecreasing(t, []float{1, 2}) -// assert.IsNonDecreasing(t, []string{"a", "b"}) +// require.IsNonDecreasing(t, []int{1, 1, 2}) +// require.IsNonDecreasing(t, []float{1, 2}) +// require.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -961,9 +1054,9 @@ func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonDecreasingf asserts that the collection is not decreasing // -// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -976,9 +1069,9 @@ func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interf // IsNonIncreasing asserts that the collection is not increasing // -// assert.IsNonIncreasing(t, []int{2, 1, 1}) -// assert.IsNonIncreasing(t, []float{2, 1}) -// assert.IsNonIncreasing(t, []string{"b", "a"}) +// require.IsNonIncreasing(t, []int{2, 1, 1}) +// require.IsNonIncreasing(t, []float{2, 1}) +// require.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -991,9 +1084,9 @@ func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonIncreasingf asserts that the collection is not increasing // -// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1028,7 +1121,7 @@ func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg strin // JSONEq asserts that two JSON strings are equivalent. // -// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// require.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1041,7 +1134,7 @@ func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{ // JSONEqf asserts that two JSON strings are equivalent. // -// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// require.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func JSONEqf(t TestingT, expected string, actual string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1055,7 +1148,7 @@ func JSONEqf(t TestingT, expected string, actual string, msg string, args ...int // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// assert.Len(t, mySlice, 3) +// require.Len(t, mySlice, 3) func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1069,7 +1162,7 @@ func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") +// require.Lenf(t, mySlice, 3, "error message %s", "formatted") func Lenf(t TestingT, object interface{}, length int, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1082,9 +1175,9 @@ func Lenf(t TestingT, object interface{}, length int, msg string, args ...interf // Less asserts that the first element is less than the second // -// assert.Less(t, 1, 2) -// assert.Less(t, float64(1), float64(2)) -// assert.Less(t, "a", "b") +// require.Less(t, 1, 2) +// require.Less(t, float64(1), float64(2)) +// require.Less(t, "a", "b") func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1097,10 +1190,10 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) // LessOrEqual asserts that the first element is less than or equal to the second // -// assert.LessOrEqual(t, 1, 2) -// assert.LessOrEqual(t, 2, 2) -// assert.LessOrEqual(t, "a", "b") -// assert.LessOrEqual(t, "b", "b") +// require.LessOrEqual(t, 1, 2) +// require.LessOrEqual(t, 2, 2) +// require.LessOrEqual(t, "a", "b") +// require.LessOrEqual(t, "b", "b") func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1113,10 +1206,10 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter // LessOrEqualf asserts that the first element is less than or equal to the second // -// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") -// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") +// require.LessOrEqualf(t, 1, 2, "error message %s", "formatted") +// require.LessOrEqualf(t, 2, 2, "error message %s", "formatted") +// require.LessOrEqualf(t, "a", "b", "error message %s", "formatted") +// require.LessOrEqualf(t, "b", "b", "error message %s", "formatted") func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1129,9 +1222,9 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . // Lessf asserts that the first element is less than the second // -// assert.Lessf(t, 1, 2, "error message %s", "formatted") -// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") -// assert.Lessf(t, "a", "b", "error message %s", "formatted") +// require.Lessf(t, 1, 2, "error message %s", "formatted") +// require.Lessf(t, float64(1), float64(2), "error message %s", "formatted") +// require.Lessf(t, "a", "b", "error message %s", "formatted") func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1144,8 +1237,8 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter // Negative asserts that the specified element is negative // -// assert.Negative(t, -1) -// assert.Negative(t, -1.23) +// require.Negative(t, -1) +// require.Negative(t, -1.23) func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1158,8 +1251,8 @@ func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Negativef asserts that the specified element is negative // -// assert.Negativef(t, -1, "error message %s", "formatted") -// assert.Negativef(t, -1.23, "error message %s", "formatted") +// require.Negativef(t, -1, "error message %s", "formatted") +// require.Negativef(t, -1.23, "error message %s", "formatted") func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1173,7 +1266,7 @@ func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) +// require.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1187,7 +1280,7 @@ func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.D // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// require.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1200,7 +1293,7 @@ func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time. // Nil asserts that the specified object is nil. // -// assert.Nil(t, err) +// require.Nil(t, err) func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1213,7 +1306,7 @@ func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Nilf asserts that the specified object is nil. // -// assert.Nilf(t, err, "error message %s", "formatted") +// require.Nilf(t, err, "error message %s", "formatted") func Nilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1250,10 +1343,10 @@ func NoDirExistsf(t TestingT, path string, msg string, args ...interface{}) { // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoError(t, err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if require.NoError(t, err) { +// require.Equal(t, expectedObj, actualObj) +// } func NoError(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1266,10 +1359,10 @@ func NoError(t TestingT, err error, msgAndArgs ...interface{}) { // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoErrorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if require.NoErrorf(t, err, "error message %s", "formatted") { +// require.Equal(t, expectedObj, actualObj) +// } func NoErrorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1307,9 +1400,9 @@ func NoFileExistsf(t TestingT, path string, msg string, args ...interface{}) { // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContains(t, "Hello World", "Earth") -// assert.NotContains(t, ["Hello", "World"], "Earth") -// assert.NotContains(t, {"Hello": "World"}, "Earth") +// require.NotContains(t, "Hello World", "Earth") +// require.NotContains(t, ["Hello", "World"], "Earth") +// require.NotContains(t, {"Hello": "World"}, "Earth") func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1323,9 +1416,9 @@ func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ... // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") +// require.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") +// require.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") +// require.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1336,12 +1429,52 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a t.FailNow() } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// require.NotElementsMatch(t, [1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// require.NotElementsMatch(t, [1, 1, 2, 3], [1, 2, 3]) -> true +// +// require.NotElementsMatch(t, [1, 2, 3], [1, 2, 4]) -> true +func NotElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotElementsMatch(t, listA, listB, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// require.NotElementsMatchf(t, [1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// require.NotElementsMatchf(t, [1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// require.NotElementsMatchf(t, [1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func NotElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotElementsMatchf(t, listA, listB, msg, args...) { + return + } + t.FailNow() +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmpty(t, obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if require.NotEmpty(t, obj) { +// require.Equal(t, "two", obj[1]) +// } func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1355,9 +1488,9 @@ func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if require.NotEmptyf(t, obj, "error message %s", "formatted") { +// require.Equal(t, "two", obj[1]) +// } func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1370,7 +1503,7 @@ func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) // NotEqual asserts that the specified values are NOT equal. // -// assert.NotEqual(t, obj1, obj2) +// require.NotEqual(t, obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1386,7 +1519,7 @@ func NotEqual(t TestingT, expected interface{}, actual interface{}, msgAndArgs . // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValues(t, obj1, obj2) +// require.NotEqualValues(t, obj1, obj2) func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1399,7 +1532,7 @@ func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAnd // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") +// require.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1412,7 +1545,7 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s // NotEqualf asserts that the specified values are NOT equal. // -// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") +// require.NotEqualf(t, obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1426,7 +1559,31 @@ func NotEqualf(t TestingT, expected interface{}, actual interface{}, msg string, t.FailNow() } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorAs(t, err, target, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorAsf(t, err, target, msg, args...) { + return + } + t.FailNow() +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1438,7 +1595,7 @@ func NotErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) t.FailNow() } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1450,9 +1607,35 @@ func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interf t.FailNow() } +// NotImplements asserts that an object does not implement the specified interface. +// +// require.NotImplements(t, (*MyInterface)(nil), new(MyObject)) +func NotImplements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotImplements(t, interfaceObject, object, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotImplementsf asserts that an object does not implement the specified interface. +// +// require.NotImplementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +func NotImplementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotImplementsf(t, interfaceObject, object, msg, args...) { + return + } + t.FailNow() +} + // NotNil asserts that the specified object is not nil. // -// assert.NotNil(t, err) +// require.NotNil(t, err) func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1465,7 +1648,7 @@ func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotNilf asserts that the specified object is not nil. // -// assert.NotNilf(t, err, "error message %s", "formatted") +// require.NotNilf(t, err, "error message %s", "formatted") func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1478,7 +1661,7 @@ func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanics(t, func(){ RemainCalm() }) +// require.NotPanics(t, func(){ RemainCalm() }) func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1491,7 +1674,7 @@ func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") +// require.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1504,8 +1687,8 @@ func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interfac // NotRegexp asserts that a specified regexp does not match a string. // -// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") -// assert.NotRegexp(t, "^start", "it's not starting") +// require.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") +// require.NotRegexp(t, "^start", "it's not starting") func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1518,8 +1701,8 @@ func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interf // NotRegexpf asserts that a specified regexp does not match a string. // -// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") +// require.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// require.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1532,7 +1715,7 @@ func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args .. // NotSame asserts that two pointers do not reference the same object. // -// assert.NotSame(t, ptr1, ptr2) +// require.NotSame(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1548,7 +1731,7 @@ func NotSame(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // NotSamef asserts that two pointers do not reference the same object. // -// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") +// require.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1562,10 +1745,12 @@ func NotSamef(t TestingT, expected interface{}, actual interface{}, msg string, t.FailNow() } -// NotSubset asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubset asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// require.NotSubset(t, [1, 3, 4], [1, 2]) +// require.NotSubset(t, {"x": 1, "y": 2}, {"z": 3}) func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1576,10 +1761,12 @@ func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...i t.FailNow() } -// NotSubsetf asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubsetf asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// require.NotSubsetf(t, [1, 3, 4], [1, 2], "error message %s", "formatted") +// require.NotSubsetf(t, {"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") func NotSubsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1614,7 +1801,7 @@ func NotZerof(t TestingT, i interface{}, msg string, args ...interface{}) { // Panics asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panics(t, func(){ GoCrazy() }) +// require.Panics(t, func(){ GoCrazy() }) func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1629,7 +1816,7 @@ func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) +// require.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1644,7 +1831,7 @@ func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAn // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// require.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1658,7 +1845,7 @@ func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) +// require.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1672,7 +1859,7 @@ func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, m // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// require.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1685,7 +1872,7 @@ func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") +// require.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1698,8 +1885,8 @@ func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{} // Positive asserts that the specified element is positive // -// assert.Positive(t, 1) -// assert.Positive(t, 1.23) +// require.Positive(t, 1) +// require.Positive(t, 1.23) func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1712,8 +1899,8 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Positivef asserts that the specified element is positive // -// assert.Positivef(t, 1, "error message %s", "formatted") -// assert.Positivef(t, 1.23, "error message %s", "formatted") +// require.Positivef(t, 1, "error message %s", "formatted") +// require.Positivef(t, 1.23, "error message %s", "formatted") func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1726,8 +1913,8 @@ func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { // Regexp asserts that a specified regexp matches a string. // -// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") -// assert.Regexp(t, "start...$", "it's not starting") +// require.Regexp(t, regexp.MustCompile("start"), "it's starting") +// require.Regexp(t, "start...$", "it's not starting") func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1740,8 +1927,8 @@ func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface // Regexpf asserts that a specified regexp matches a string. // -// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") +// require.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// require.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1754,7 +1941,7 @@ func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...in // Same asserts that two pointers reference the same object. // -// assert.Same(t, ptr1, ptr2) +// require.Same(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1770,7 +1957,7 @@ func Same(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...in // Samef asserts that two pointers reference the same object. // -// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") +// require.Samef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1784,10 +1971,11 @@ func Samef(t TestingT, expected interface{}, actual interface{}, msg string, arg t.FailNow() } -// Subset asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subset asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// require.Subset(t, [1, 2, 3], [1, 2]) +// require.Subset(t, {"x": 1, "y": 2}, {"x": 1}) func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1798,10 +1986,11 @@ func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...inte t.FailNow() } -// Subsetf asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subsetf asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// require.Subsetf(t, [1, 2, 3], [1, 2], "error message %s", "formatted") +// require.Subsetf(t, {"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1814,7 +2003,7 @@ func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args // True asserts that the specified value is true. // -// assert.True(t, myBool) +// require.True(t, myBool) func True(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1827,7 +2016,7 @@ func True(t TestingT, value bool, msgAndArgs ...interface{}) { // Truef asserts that the specified value is true. // -// assert.Truef(t, myBool, "error message %s", "formatted") +// require.Truef(t, myBool, "error message %s", "formatted") func Truef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1840,7 +2029,7 @@ func Truef(t TestingT, value bool, msg string, args ...interface{}) { // WithinDuration asserts that the two times are within duration delta of each other. // -// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) +// require.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1853,7 +2042,7 @@ func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time // WithinDurationf asserts that the two times are within duration delta of each other. // -// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// require.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1866,7 +2055,7 @@ func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta tim // WithinRange asserts that a time is within a time range (inclusive). // -// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// require.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1879,7 +2068,7 @@ func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, m // WithinRangef asserts that a time is within a time range (inclusive). // -// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// require.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func WithinRangef(t TestingT, actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/require/require.go.tmpl b/vendor/github.com/stretchr/testify/require/require.go.tmpl index 55e42dde..8b328368 100644 --- a/vendor/github.com/stretchr/testify/require/require.go.tmpl +++ b/vendor/github.com/stretchr/testify/require/require.go.tmpl @@ -1,4 +1,4 @@ -{{.Comment}} +{{ replace .Comment "assert." "require."}} func {{.DocInfo.Name}}(t TestingT, {{.Params}}) { if h, ok := t.(tHelper); ok { h.Helper() } if assert.{{.DocInfo.Name}}(t, {{.ForwardedParams}}) { return } diff --git a/vendor/github.com/stretchr/testify/require/require_forward.go b/vendor/github.com/stretchr/testify/require/require_forward.go index 960bf6f2..1bd87304 100644 --- a/vendor/github.com/stretchr/testify/require/require_forward.go +++ b/vendor/github.com/stretchr/testify/require/require_forward.go @@ -1,7 +1,4 @@ -/* -* CODE GENERATED AUTOMATICALLY WITH github.com/stretchr/testify/_codegen -* THIS FILE MUST NOT BE EDITED BY HAND - */ +// Code generated with github.com/stretchr/testify/_codegen; DO NOT EDIT. package require @@ -31,9 +28,9 @@ func (a *Assertions) Conditionf(comp assert.Comparison, msg string, args ...inte // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Contains("Hello World", "World") -// a.Contains(["Hello", "World"], "World") -// a.Contains({"Hello": "World"}, "Hello") +// a.Contains("Hello World", "World") +// a.Contains(["Hello", "World"], "World") +// a.Contains({"Hello": "World"}, "Hello") func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -44,9 +41,9 @@ func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs .. // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Containsf("Hello World", "World", "error message %s", "formatted") -// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") -// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") +// a.Containsf("Hello World", "World", "error message %s", "formatted") +// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") +// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") func (a *Assertions) Containsf(s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -99,7 +96,7 @@ func (a *Assertions) ElementsMatchf(listA interface{}, listB interface{}, msg st // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Empty(obj) +// a.Empty(obj) func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -110,7 +107,7 @@ func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Emptyf(obj, "error message %s", "formatted") +// a.Emptyf(obj, "error message %s", "formatted") func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -120,7 +117,7 @@ func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) // Equal asserts that two objects are equal. // -// a.Equal(123, 123) +// a.Equal(123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -135,8 +132,8 @@ func (a *Assertions) Equal(expected interface{}, actual interface{}, msgAndArgs // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualError(err, expectedErrorString) +// actualObj, err := SomeFunction() +// a.EqualError(err, expectedErrorString) func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -147,8 +144,8 @@ func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ... // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") func (a *Assertions) EqualErrorf(theError error, errString string, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -156,10 +153,44 @@ func (a *Assertions) EqualErrorf(theError error, errString string, msg string, a EqualErrorf(a.t, theError, errString, msg, args...) } -// EqualValues asserts that two objects are equal or convertable to the same types -// and equal. +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. // -// a.EqualValues(uint32(123), int32(123)) +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValues(S{1, 2}, S{1, 3}) => true +// a.EqualExportedValues(S{1, 2}, S{2, 3}) => false +func (a *Assertions) EqualExportedValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EqualExportedValues(a.t, expected, actual, msgAndArgs...) +} + +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValuesf(S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// a.EqualExportedValuesf(S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EqualExportedValuesf(a.t, expected, actual, msg, args...) +} + +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. +// +// a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -167,10 +198,10 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn EqualValues(a.t, expected, actual, msgAndArgs...) } -// EqualValuesf asserts that two objects are equal or convertable to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // -// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") +// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -180,7 +211,7 @@ func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg // Equalf asserts that two objects are equal. // -// a.Equalf(123, 123, "error message %s", "formatted") +// a.Equalf(123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -194,10 +225,10 @@ func (a *Assertions) Equalf(expected interface{}, actual interface{}, msg string // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Error(err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if a.Error(err) { +// assert.Equal(t, expectedError, err) +// } func (a *Assertions) Error(err error, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -226,8 +257,8 @@ func (a *Assertions) ErrorAsf(err error, target interface{}, msg string, args .. // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContains(err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// a.ErrorContains(err, expectedErrorSubString) func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -238,8 +269,8 @@ func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs . // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") func (a *Assertions) ErrorContainsf(theError error, contains string, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -267,10 +298,10 @@ func (a *Assertions) ErrorIsf(err error, target error, msg string, args ...inter // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Errorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if a.Errorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func (a *Assertions) Errorf(err error, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -281,7 +312,7 @@ func (a *Assertions) Errorf(err error, msg string, args ...interface{}) { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) +// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -289,10 +320,60 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti Eventually(a.t, condition, waitFor, tick, msgAndArgs...) } +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithT(func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithT(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EventuallyWithT(a.t, condition, waitFor, tick, msgAndArgs...) +} + +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithTf(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EventuallyWithTf(a.t, condition, waitFor, tick, msg, args...) +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -302,7 +383,7 @@ func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, t // Exactly asserts that two objects are equal in value and type. // -// a.Exactly(int32(123), int64(123)) +// a.Exactly(int32(123), int64(123)) func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -312,7 +393,7 @@ func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArg // Exactlyf asserts that two objects are equal in value and type. // -// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") +// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") func (a *Assertions) Exactlyf(expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -354,7 +435,7 @@ func (a *Assertions) Failf(failureMessage string, msg string, args ...interface{ // False asserts that the specified value is false. // -// a.False(myBool) +// a.False(myBool) func (a *Assertions) False(value bool, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -364,7 +445,7 @@ func (a *Assertions) False(value bool, msgAndArgs ...interface{}) { // Falsef asserts that the specified value is false. // -// a.Falsef(myBool, "error message %s", "formatted") +// a.Falsef(myBool, "error message %s", "formatted") func (a *Assertions) Falsef(value bool, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -392,9 +473,9 @@ func (a *Assertions) FileExistsf(path string, msg string, args ...interface{}) { // Greater asserts that the first element is greater than the second // -// a.Greater(2, 1) -// a.Greater(float64(2), float64(1)) -// a.Greater("b", "a") +// a.Greater(2, 1) +// a.Greater(float64(2), float64(1)) +// a.Greater("b", "a") func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -404,10 +485,10 @@ func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...inter // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqual(2, 1) -// a.GreaterOrEqual(2, 2) -// a.GreaterOrEqual("b", "a") -// a.GreaterOrEqual("b", "b") +// a.GreaterOrEqual(2, 1) +// a.GreaterOrEqual(2, 2) +// a.GreaterOrEqual("b", "a") +// a.GreaterOrEqual("b", "b") func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -417,10 +498,10 @@ func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs . // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") -// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") -// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") -// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") +// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") +// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") +// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") +// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -430,9 +511,9 @@ func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, // Greaterf asserts that the first element is greater than the second // -// a.Greaterf(2, 1, "error message %s", "formatted") -// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") -// a.Greaterf("b", "a", "error message %s", "formatted") +// a.Greaterf(2, 1, "error message %s", "formatted") +// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") +// a.Greaterf("b", "a", "error message %s", "formatted") func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -443,7 +524,7 @@ func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args . // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -456,7 +537,7 @@ func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, u // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -469,7 +550,7 @@ func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -482,7 +563,7 @@ func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -494,7 +575,7 @@ func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method strin // HTTPError asserts that a specified handler returns an error status code. // -// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -506,7 +587,7 @@ func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url stri // HTTPErrorf asserts that a specified handler returns an error status code. // -// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -518,7 +599,7 @@ func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url str // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -530,7 +611,7 @@ func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url s // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -542,7 +623,7 @@ func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) +// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) { @@ -554,7 +635,7 @@ func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) { @@ -566,7 +647,7 @@ func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, ur // HTTPSuccess asserts that a specified handler returns a success status code. // -// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) +// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -578,7 +659,7 @@ func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -590,7 +671,7 @@ func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url s // Implements asserts that an object is implemented by the specified interface. // -// a.Implements((*MyInterface)(nil), new(MyObject)) +// a.Implements((*MyInterface)(nil), new(MyObject)) func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -600,7 +681,7 @@ func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, // Implementsf asserts that an object is implemented by the specified interface. // -// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -610,7 +691,7 @@ func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{} // InDelta asserts that the two numerals are within delta of each other. // -// a.InDelta(math.Pi, 22/7.0, 0.01) +// a.InDelta(math.Pi, 22/7.0, 0.01) func (a *Assertions) InDelta(expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -652,7 +733,7 @@ func (a *Assertions) InDeltaSlicef(expected interface{}, actual interface{}, del // InDeltaf asserts that the two numerals are within delta of each other. // -// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func (a *Assertions) InDeltaf(expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -694,9 +775,9 @@ func (a *Assertions) InEpsilonf(expected interface{}, actual interface{}, epsilo // IsDecreasing asserts that the collection is decreasing // -// a.IsDecreasing([]int{2, 1, 0}) -// a.IsDecreasing([]float{2, 1}) -// a.IsDecreasing([]string{"b", "a"}) +// a.IsDecreasing([]int{2, 1, 0}) +// a.IsDecreasing([]float{2, 1}) +// a.IsDecreasing([]string{"b", "a"}) func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -706,9 +787,9 @@ func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) // IsDecreasingf asserts that the collection is decreasing // -// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") -// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") +// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -718,9 +799,9 @@ func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...inter // IsIncreasing asserts that the collection is increasing // -// a.IsIncreasing([]int{1, 2, 3}) -// a.IsIncreasing([]float{1, 2}) -// a.IsIncreasing([]string{"a", "b"}) +// a.IsIncreasing([]int{1, 2, 3}) +// a.IsIncreasing([]float{1, 2}) +// a.IsIncreasing([]string{"a", "b"}) func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -730,9 +811,9 @@ func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) // IsIncreasingf asserts that the collection is increasing // -// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") -// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") +// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -742,9 +823,9 @@ func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...inter // IsNonDecreasing asserts that the collection is not decreasing // -// a.IsNonDecreasing([]int{1, 1, 2}) -// a.IsNonDecreasing([]float{1, 2}) -// a.IsNonDecreasing([]string{"a", "b"}) +// a.IsNonDecreasing([]int{1, 1, 2}) +// a.IsNonDecreasing([]float{1, 2}) +// a.IsNonDecreasing([]string{"a", "b"}) func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -754,9 +835,9 @@ func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -766,9 +847,9 @@ func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...in // IsNonIncreasing asserts that the collection is not increasing // -// a.IsNonIncreasing([]int{2, 1, 1}) -// a.IsNonIncreasing([]float{2, 1}) -// a.IsNonIncreasing([]string{"b", "a"}) +// a.IsNonIncreasing([]int{2, 1, 1}) +// a.IsNonIncreasing([]float{2, 1}) +// a.IsNonIncreasing([]string{"b", "a"}) func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -778,9 +859,9 @@ func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface // IsNonIncreasingf asserts that the collection is not increasing // -// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsNonIncreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -806,7 +887,7 @@ func (a *Assertions) IsTypef(expectedType interface{}, object interface{}, msg s // JSONEq asserts that two JSON strings are equivalent. // -// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -816,7 +897,7 @@ func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interf // JSONEqf asserts that two JSON strings are equivalent. // -// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func (a *Assertions) JSONEqf(expected string, actual string, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -827,7 +908,7 @@ func (a *Assertions) JSONEqf(expected string, actual string, msg string, args .. // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// a.Len(mySlice, 3) +// a.Len(mySlice, 3) func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -838,7 +919,7 @@ func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// a.Lenf(mySlice, 3, "error message %s", "formatted") +// a.Lenf(mySlice, 3, "error message %s", "formatted") func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -848,9 +929,9 @@ func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...in // Less asserts that the first element is less than the second // -// a.Less(1, 2) -// a.Less(float64(1), float64(2)) -// a.Less("a", "b") +// a.Less(1, 2) +// a.Less(float64(1), float64(2)) +// a.Less("a", "b") func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -860,10 +941,10 @@ func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interfac // LessOrEqual asserts that the first element is less than or equal to the second // -// a.LessOrEqual(1, 2) -// a.LessOrEqual(2, 2) -// a.LessOrEqual("a", "b") -// a.LessOrEqual("b", "b") +// a.LessOrEqual(1, 2) +// a.LessOrEqual(2, 2) +// a.LessOrEqual("a", "b") +// a.LessOrEqual("b", "b") func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -873,10 +954,10 @@ func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...i // LessOrEqualf asserts that the first element is less than or equal to the second // -// a.LessOrEqualf(1, 2, "error message %s", "formatted") -// a.LessOrEqualf(2, 2, "error message %s", "formatted") -// a.LessOrEqualf("a", "b", "error message %s", "formatted") -// a.LessOrEqualf("b", "b", "error message %s", "formatted") +// a.LessOrEqualf(1, 2, "error message %s", "formatted") +// a.LessOrEqualf(2, 2, "error message %s", "formatted") +// a.LessOrEqualf("a", "b", "error message %s", "formatted") +// a.LessOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -886,9 +967,9 @@ func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, ar // Lessf asserts that the first element is less than the second // -// a.Lessf(1, 2, "error message %s", "formatted") -// a.Lessf(float64(1), float64(2), "error message %s", "formatted") -// a.Lessf("a", "b", "error message %s", "formatted") +// a.Lessf(1, 2, "error message %s", "formatted") +// a.Lessf(float64(1), float64(2), "error message %s", "formatted") +// a.Lessf("a", "b", "error message %s", "formatted") func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -898,8 +979,8 @@ func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...i // Negative asserts that the specified element is negative // -// a.Negative(-1) -// a.Negative(-1.23) +// a.Negative(-1) +// a.Negative(-1.23) func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -909,8 +990,8 @@ func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) { // Negativef asserts that the specified element is negative // -// a.Negativef(-1, "error message %s", "formatted") -// a.Negativef(-1.23, "error message %s", "formatted") +// a.Negativef(-1, "error message %s", "formatted") +// a.Negativef(-1.23, "error message %s", "formatted") func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -921,7 +1002,7 @@ func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) { // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) +// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -932,7 +1013,7 @@ func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick ti // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -942,7 +1023,7 @@ func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick t // Nil asserts that the specified object is nil. // -// a.Nil(err) +// a.Nil(err) func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -952,7 +1033,7 @@ func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) { // Nilf asserts that the specified object is nil. // -// a.Nilf(err, "error message %s", "formatted") +// a.Nilf(err, "error message %s", "formatted") func (a *Assertions) Nilf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -980,10 +1061,10 @@ func (a *Assertions) NoDirExistsf(path string, msg string, args ...interface{}) // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoError(err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoError(err) { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -993,10 +1074,10 @@ func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) { // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoErrorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoErrorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoErrorf(err error, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1025,9 +1106,9 @@ func (a *Assertions) NoFileExistsf(path string, msg string, args ...interface{}) // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContains("Hello World", "Earth") -// a.NotContains(["Hello", "World"], "Earth") -// a.NotContains({"Hello": "World"}, "Earth") +// a.NotContains("Hello World", "Earth") +// a.NotContains(["Hello", "World"], "Earth") +// a.NotContains({"Hello": "World"}, "Earth") func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1038,9 +1119,9 @@ func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") -// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") -// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") +// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") +// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") +// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1048,12 +1129,46 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin NotContainsf(a.t, s, contains, msg, args...) } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 2, 3]) -> true +// +// a.NotElementsMatch([1, 2, 3], [1, 2, 4]) -> true +func (a *Assertions) NotElementsMatch(listA interface{}, listB interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotElementsMatch(a.t, listA, listB, msgAndArgs...) +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// a.NotElementsMatchf([1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func (a *Assertions) NotElementsMatchf(listA interface{}, listB interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotElementsMatchf(a.t, listA, listB, msg, args...) +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmpty(obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmpty(obj) { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1064,9 +1179,9 @@ func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) { // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmptyf(obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmptyf(obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1076,7 +1191,7 @@ func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface // NotEqual asserts that the specified values are NOT equal. // -// a.NotEqual(obj1, obj2) +// a.NotEqual(obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1089,7 +1204,7 @@ func (a *Assertions) NotEqual(expected interface{}, actual interface{}, msgAndAr // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValues(obj1, obj2) +// a.NotEqualValues(obj1, obj2) func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1099,7 +1214,7 @@ func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, ms // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1109,7 +1224,7 @@ func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, m // NotEqualf asserts that the specified values are NOT equal. // -// a.NotEqualf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualf(obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1120,7 +1235,25 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str NotEqualf(a.t, expected, actual, msg, args...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAs(err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorAs(a.t, err, target, msgAndArgs...) +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAsf(err error, target interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorAsf(a.t, err, target, msg, args...) +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { @@ -1129,7 +1262,7 @@ func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface NotErrorIs(a.t, err, target, msgAndArgs...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { @@ -1138,9 +1271,29 @@ func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...in NotErrorIsf(a.t, err, target, msg, args...) } +// NotImplements asserts that an object does not implement the specified interface. +// +// a.NotImplements((*MyInterface)(nil), new(MyObject)) +func (a *Assertions) NotImplements(interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotImplements(a.t, interfaceObject, object, msgAndArgs...) +} + +// NotImplementsf asserts that an object does not implement the specified interface. +// +// a.NotImplementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +func (a *Assertions) NotImplementsf(interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotImplementsf(a.t, interfaceObject, object, msg, args...) +} + // NotNil asserts that the specified object is not nil. // -// a.NotNil(err) +// a.NotNil(err) func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1150,7 +1303,7 @@ func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) { // NotNilf asserts that the specified object is not nil. // -// a.NotNilf(err, "error message %s", "formatted") +// a.NotNilf(err, "error message %s", "formatted") func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1160,7 +1313,7 @@ func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{} // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanics(func(){ RemainCalm() }) +// a.NotPanics(func(){ RemainCalm() }) func (a *Assertions) NotPanics(f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1170,7 +1323,7 @@ func (a *Assertions) NotPanics(f assert.PanicTestFunc, msgAndArgs ...interface{} // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") +// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") func (a *Assertions) NotPanicsf(f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1180,8 +1333,8 @@ func (a *Assertions) NotPanicsf(f assert.PanicTestFunc, msg string, args ...inte // NotRegexp asserts that a specified regexp does not match a string. // -// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") -// a.NotRegexp("^start", "it's not starting") +// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") +// a.NotRegexp("^start", "it's not starting") func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1191,8 +1344,8 @@ func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...in // NotRegexpf asserts that a specified regexp does not match a string. // -// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") +// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1202,7 +1355,7 @@ func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, arg // NotSame asserts that two pointers do not reference the same object. // -// a.NotSame(ptr1, ptr2) +// a.NotSame(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1215,7 +1368,7 @@ func (a *Assertions) NotSame(expected interface{}, actual interface{}, msgAndArg // NotSamef asserts that two pointers do not reference the same object. // -// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") +// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1226,10 +1379,12 @@ func (a *Assertions) NotSamef(expected interface{}, actual interface{}, msg stri NotSamef(a.t, expected, actual, msg, args...) } -// NotSubset asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubset asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// a.NotSubset([1, 3, 4], [1, 2]) +// a.NotSubset({"x": 1, "y": 2}, {"z": 3}) func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1237,10 +1392,12 @@ func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs NotSubset(a.t, list, subset, msgAndArgs...) } -// NotSubsetf asserts that the specified list(array, slice...) contains not all -// elements given in the specified subset(array, slice...). +// NotSubsetf asserts that the specified list(array, slice...) or map does NOT +// contain all elements given in the specified subset list(array, slice...) or +// map. // -// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// a.NotSubsetf([1, 3, 4], [1, 2], "error message %s", "formatted") +// a.NotSubsetf({"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") func (a *Assertions) NotSubsetf(list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1266,7 +1423,7 @@ func (a *Assertions) NotZerof(i interface{}, msg string, args ...interface{}) { // Panics asserts that the code inside the specified PanicTestFunc panics. // -// a.Panics(func(){ GoCrazy() }) +// a.Panics(func(){ GoCrazy() }) func (a *Assertions) Panics(f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1278,7 +1435,7 @@ func (a *Assertions) Panics(f assert.PanicTestFunc, msgAndArgs ...interface{}) { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithError("crazy error", func(){ GoCrazy() }) +// a.PanicsWithError("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithError(errString string, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1290,7 +1447,7 @@ func (a *Assertions) PanicsWithError(errString string, f assert.PanicTestFunc, m // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithErrorf(errString string, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1301,7 +1458,7 @@ func (a *Assertions) PanicsWithErrorf(errString string, f assert.PanicTestFunc, // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) +// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithValue(expected interface{}, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1312,7 +1469,7 @@ func (a *Assertions) PanicsWithValue(expected interface{}, f assert.PanicTestFun // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithValuef(expected interface{}, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1322,7 +1479,7 @@ func (a *Assertions) PanicsWithValuef(expected interface{}, f assert.PanicTestFu // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") +// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) Panicsf(f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1332,8 +1489,8 @@ func (a *Assertions) Panicsf(f assert.PanicTestFunc, msg string, args ...interfa // Positive asserts that the specified element is positive // -// a.Positive(1) -// a.Positive(1.23) +// a.Positive(1) +// a.Positive(1.23) func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1343,8 +1500,8 @@ func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) { // Positivef asserts that the specified element is positive // -// a.Positivef(1, "error message %s", "formatted") -// a.Positivef(1.23, "error message %s", "formatted") +// a.Positivef(1, "error message %s", "formatted") +// a.Positivef(1.23, "error message %s", "formatted") func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1354,8 +1511,8 @@ func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) { // Regexp asserts that a specified regexp matches a string. // -// a.Regexp(regexp.MustCompile("start"), "it's starting") -// a.Regexp("start...$", "it's not starting") +// a.Regexp(regexp.MustCompile("start"), "it's starting") +// a.Regexp("start...$", "it's not starting") func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1365,8 +1522,8 @@ func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...inter // Regexpf asserts that a specified regexp matches a string. // -// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") +// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1376,7 +1533,7 @@ func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args . // Same asserts that two pointers reference the same object. // -// a.Same(ptr1, ptr2) +// a.Same(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1389,7 +1546,7 @@ func (a *Assertions) Same(expected interface{}, actual interface{}, msgAndArgs . // Samef asserts that two pointers reference the same object. // -// a.Samef(ptr1, ptr2, "error message %s", "formatted") +// a.Samef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1400,10 +1557,11 @@ func (a *Assertions) Samef(expected interface{}, actual interface{}, msg string, Samef(a.t, expected, actual, msg, args...) } -// Subset asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subset asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// a.Subset([1, 2, 3], [1, 2]) +// a.Subset({"x": 1, "y": 2}, {"x": 1}) func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1411,10 +1569,11 @@ func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ... Subset(a.t, list, subset, msgAndArgs...) } -// Subsetf asserts that the specified list(array, slice...) contains all -// elements given in the specified subset(array, slice...). +// Subsetf asserts that the specified list(array, slice...) or map contains all +// elements given in the specified subset list(array, slice...) or map. // -// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// a.Subsetf([1, 2, 3], [1, 2], "error message %s", "formatted") +// a.Subsetf({"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1424,7 +1583,7 @@ func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, a // True asserts that the specified value is true. // -// a.True(myBool) +// a.True(myBool) func (a *Assertions) True(value bool, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1434,7 +1593,7 @@ func (a *Assertions) True(value bool, msgAndArgs ...interface{}) { // Truef asserts that the specified value is true. // -// a.Truef(myBool, "error message %s", "formatted") +// a.Truef(myBool, "error message %s", "formatted") func (a *Assertions) Truef(value bool, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1444,7 +1603,7 @@ func (a *Assertions) Truef(value bool, msg string, args ...interface{}) { // WithinDuration asserts that the two times are within duration delta of each other. // -// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) +// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1454,7 +1613,7 @@ func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta // WithinDurationf asserts that the two times are within duration delta of each other. // -// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1464,7 +1623,7 @@ func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta // WithinRange asserts that a time is within a time range (inclusive). // -// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1474,7 +1633,7 @@ func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Tim // WithinRangef asserts that a time is within a time range (inclusive). // -// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func (a *Assertions) WithinRangef(actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/require/requirements.go b/vendor/github.com/stretchr/testify/require/requirements.go index 91772dfe..6b7ce929 100644 --- a/vendor/github.com/stretchr/testify/require/requirements.go +++ b/vendor/github.com/stretchr/testify/require/requirements.go @@ -6,7 +6,7 @@ type TestingT interface { FailNow() } -type tHelper interface { +type tHelper = interface { Helper() } diff --git a/vendor/github.com/stretchr/testify/suite/doc.go b/vendor/github.com/stretchr/testify/suite/doc.go index f91a245d..05a562f7 100644 --- a/vendor/github.com/stretchr/testify/suite/doc.go +++ b/vendor/github.com/stretchr/testify/suite/doc.go @@ -5,6 +5,8 @@ // or individual tests (depending on which interface(s) you // implement). // +// The suite package does not support parallel tests. See [issue 934]. +// // A testing suite is usually built by first extending the built-in // suite functionality from suite.Suite in testify. Alternatively, // you could reproduce that logic on your own if you wanted (you @@ -29,37 +31,40 @@ // Suite object has assertion methods. // // A crude example: -// // Basic imports -// import ( -// "testing" -// "github.com/stretchr/testify/assert" -// "github.com/stretchr/testify/suite" -// ) // -// // Define the suite, and absorb the built-in basic suite -// // functionality from testify - including a T() method which -// // returns the current testing context -// type ExampleTestSuite struct { -// suite.Suite -// VariableThatShouldStartAtFive int -// } +// // Basic imports +// import ( +// "testing" +// "github.com/stretchr/testify/assert" +// "github.com/stretchr/testify/suite" +// ) +// +// // Define the suite, and absorb the built-in basic suite +// // functionality from testify - including a T() method which +// // returns the current testing context +// type ExampleTestSuite struct { +// suite.Suite +// VariableThatShouldStartAtFive int +// } +// +// // Make sure that VariableThatShouldStartAtFive is set to five +// // before each test +// func (suite *ExampleTestSuite) SetupTest() { +// suite.VariableThatShouldStartAtFive = 5 +// } // -// // Make sure that VariableThatShouldStartAtFive is set to five -// // before each test -// func (suite *ExampleTestSuite) SetupTest() { -// suite.VariableThatShouldStartAtFive = 5 -// } +// // All methods that begin with "Test" are run as tests within a +// // suite. +// func (suite *ExampleTestSuite) TestExample() { +// assert.Equal(suite.T(), 5, suite.VariableThatShouldStartAtFive) +// suite.Equal(5, suite.VariableThatShouldStartAtFive) +// } // -// // All methods that begin with "Test" are run as tests within a -// // suite. -// func (suite *ExampleTestSuite) TestExample() { -// assert.Equal(suite.T(), 5, suite.VariableThatShouldStartAtFive) -// suite.Equal(5, suite.VariableThatShouldStartAtFive) -// } +// // In order for 'go test' to run this suite, we need to create +// // a normal test function and pass our suite to suite.Run +// func TestExampleTestSuite(t *testing.T) { +// suite.Run(t, new(ExampleTestSuite)) +// } // -// // In order for 'go test' to run this suite, we need to create -// // a normal test function and pass our suite to suite.Run -// func TestExampleTestSuite(t *testing.T) { -// suite.Run(t, new(ExampleTestSuite)) -// } +// [issue 934]: https://github.com/stretchr/testify/issues/934 package suite diff --git a/vendor/github.com/stretchr/testify/suite/interfaces.go b/vendor/github.com/stretchr/testify/suite/interfaces.go index 8b98a8af..fed037d7 100644 --- a/vendor/github.com/stretchr/testify/suite/interfaces.go +++ b/vendor/github.com/stretchr/testify/suite/interfaces.go @@ -7,6 +7,7 @@ import "testing" type TestingSuite interface { T() *testing.T SetT(*testing.T) + SetS(suite TestingSuite) } // SetupAllSuite has a SetupSuite method, which will run before the @@ -51,3 +52,15 @@ type AfterTest interface { type WithStats interface { HandleStats(suiteName string, stats *SuiteInformation) } + +// SetupSubTest has a SetupSubTest method, which will run before each +// subtest in the suite. +type SetupSubTest interface { + SetupSubTest() +} + +// TearDownSubTest has a TearDownSubTest method, which will run after +// each subtest in the suite have been run. +type TearDownSubTest interface { + TearDownSubTest() +} diff --git a/vendor/github.com/stretchr/testify/suite/suite.go b/vendor/github.com/stretchr/testify/suite/suite.go index 89559187..18443a91 100644 --- a/vendor/github.com/stretchr/testify/suite/suite.go +++ b/vendor/github.com/stretchr/testify/suite/suite.go @@ -22,9 +22,13 @@ var matchMethod = flag.String("testify.m", "", "regular expression to select tes // retrieving the current *testing.T context. type Suite struct { *assert.Assertions + mu sync.RWMutex require *require.Assertions t *testing.T + + // Parent suite to have access to the implemented methods of parent struct + s TestingSuite } // T retrieves the current *testing.T context. @@ -43,12 +47,18 @@ func (suite *Suite) SetT(t *testing.T) { suite.require = require.New(t) } +// SetS needs to set the current test suite as parent +// to get access to the parent methods +func (suite *Suite) SetS(s TestingSuite) { + suite.s = s +} + // Require returns a require context for suite. func (suite *Suite) Require() *require.Assertions { suite.mu.Lock() defer suite.mu.Unlock() if suite.require == nil { - suite.require = require.New(suite.T()) + panic("'Require' must not be called before 'Run' or 'SetT'") } return suite.require } @@ -62,17 +72,19 @@ func (suite *Suite) Assert() *assert.Assertions { suite.mu.Lock() defer suite.mu.Unlock() if suite.Assertions == nil { - suite.Assertions = assert.New(suite.T()) + panic("'Assert' must not be called before 'Run' or 'SetT'") } return suite.Assertions } func recoverAndFailOnPanic(t *testing.T) { + t.Helper() r := recover() failOnPanic(t, r) } func failOnPanic(t *testing.T, r interface{}) { + t.Helper() if r != nil { t.Errorf("test panicked: %v\n%s", r, debug.Stack()) t.FailNow() @@ -85,9 +97,21 @@ func failOnPanic(t *testing.T, r interface{}) { // Provides compatibility with go test pkg -run TestSuite/TestName/SubTestName. func (suite *Suite) Run(name string, subtest func()) bool { oldT := suite.T() - defer suite.SetT(oldT) + return oldT.Run(name, func(t *testing.T) { suite.SetT(t) + defer suite.SetT(oldT) + + defer recoverAndFailOnPanic(t) + + if setupSubTest, ok := suite.s.(SetupSubTest); ok { + setupSubTest.SetupSubTest() + } + + if tearDownSubTest, ok := suite.s.(TearDownSubTest); ok { + defer tearDownSubTest.TearDownSubTest() + } + subtest() }) } @@ -98,6 +122,7 @@ func Run(t *testing.T, suite TestingSuite) { defer recoverAndFailOnPanic(t) suite.SetT(t) + suite.SetS(suite) var suiteSetupDone bool @@ -142,6 +167,8 @@ func Run(t *testing.T, suite TestingSuite) { suite.SetT(t) defer recoverAndFailOnPanic(t) defer func() { + t.Helper() + r := recover() if stats != nil { diff --git a/vendor/github.com/twitchyliquid64/golang-asm/LICENSE b/vendor/github.com/twitchyliquid64/golang-asm/LICENSE new file mode 100644 index 00000000..6a66aea5 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arch.go b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arch.go new file mode 100644 index 00000000..b8ddbc99 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arch.go @@ -0,0 +1,716 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package arch defines architecture-specific information and support functions. +package arch + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/obj/arm" + "github.com/twitchyliquid64/golang-asm/obj/arm64" + "github.com/twitchyliquid64/golang-asm/obj/mips" + "github.com/twitchyliquid64/golang-asm/obj/ppc64" + "github.com/twitchyliquid64/golang-asm/obj/riscv" + "github.com/twitchyliquid64/golang-asm/obj/s390x" + "github.com/twitchyliquid64/golang-asm/obj/wasm" + "github.com/twitchyliquid64/golang-asm/obj/x86" + "fmt" + "strings" +) + +// Pseudo-registers whose names are the constant name without the leading R. +const ( + RFP = -(iota + 1) + RSB + RSP + RPC +) + +// Arch wraps the link architecture object with more architecture-specific information. +type Arch struct { + *obj.LinkArch + // Map of instruction names to enumeration. + Instructions map[string]obj.As + // Map of register names to enumeration. + Register map[string]int16 + // Table of register prefix names. These are things like R for R(0) and SPR for SPR(268). + RegisterPrefix map[string]bool + // RegisterNumber converts R(10) into arm.REG_R10. + RegisterNumber func(string, int16) (int16, bool) + // Instruction is a jump. + IsJump func(word string) bool +} + +// nilRegisterNumber is the register number function for architectures +// that do not accept the R(N) notation. It always returns failure. +func nilRegisterNumber(name string, n int16) (int16, bool) { + return 0, false +} + +// Set configures the architecture specified by GOARCH and returns its representation. +// It returns nil if GOARCH is not recognized. +func Set(GOARCH string) *Arch { + switch GOARCH { + case "386": + return archX86(&x86.Link386) + case "amd64": + return archX86(&x86.Linkamd64) + case "arm": + return archArm() + case "arm64": + return archArm64() + case "mips": + return archMips(&mips.Linkmips) + case "mipsle": + return archMips(&mips.Linkmipsle) + case "mips64": + return archMips64(&mips.Linkmips64) + case "mips64le": + return archMips64(&mips.Linkmips64le) + case "ppc64": + return archPPC64(&ppc64.Linkppc64) + case "ppc64le": + return archPPC64(&ppc64.Linkppc64le) + case "riscv64": + return archRISCV64() + case "s390x": + return archS390x() + case "wasm": + return archWasm() + } + return nil +} + +func jumpX86(word string) bool { + return word[0] == 'J' || word == "CALL" || strings.HasPrefix(word, "LOOP") || word == "XBEGIN" +} + +func jumpRISCV(word string) bool { + switch word { + case "BEQ", "BEQZ", "BGE", "BGEU", "BGEZ", "BGT", "BGTU", "BGTZ", "BLE", "BLEU", "BLEZ", + "BLT", "BLTU", "BLTZ", "BNE", "BNEZ", "CALL", "JAL", "JALR", "JMP": + return true + } + return false +} + +func jumpWasm(word string) bool { + return word == "JMP" || word == "CALL" || word == "Call" || word == "Br" || word == "BrIf" +} + +func archX86(linkArch *obj.LinkArch) *Arch { + register := make(map[string]int16) + // Create maps for easy lookup of instruction names etc. + for i, s := range x86.Register { + register[s] = int16(i + x86.REG_AL) + } + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + // Register prefix not used on this architecture. + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range x86.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseAMD64 + } + } + // Annoying aliases. + instructions["JA"] = x86.AJHI /* alternate */ + instructions["JAE"] = x86.AJCC /* alternate */ + instructions["JB"] = x86.AJCS /* alternate */ + instructions["JBE"] = x86.AJLS /* alternate */ + instructions["JC"] = x86.AJCS /* alternate */ + instructions["JCC"] = x86.AJCC /* carry clear (CF = 0) */ + instructions["JCS"] = x86.AJCS /* carry set (CF = 1) */ + instructions["JE"] = x86.AJEQ /* alternate */ + instructions["JEQ"] = x86.AJEQ /* equal (ZF = 1) */ + instructions["JG"] = x86.AJGT /* alternate */ + instructions["JGE"] = x86.AJGE /* greater than or equal (signed) (SF = OF) */ + instructions["JGT"] = x86.AJGT /* greater than (signed) (ZF = 0 && SF = OF) */ + instructions["JHI"] = x86.AJHI /* higher (unsigned) (CF = 0 && ZF = 0) */ + instructions["JHS"] = x86.AJCC /* alternate */ + instructions["JL"] = x86.AJLT /* alternate */ + instructions["JLE"] = x86.AJLE /* less than or equal (signed) (ZF = 1 || SF != OF) */ + instructions["JLO"] = x86.AJCS /* alternate */ + instructions["JLS"] = x86.AJLS /* lower or same (unsigned) (CF = 1 || ZF = 1) */ + instructions["JLT"] = x86.AJLT /* less than (signed) (SF != OF) */ + instructions["JMI"] = x86.AJMI /* negative (minus) (SF = 1) */ + instructions["JNA"] = x86.AJLS /* alternate */ + instructions["JNAE"] = x86.AJCS /* alternate */ + instructions["JNB"] = x86.AJCC /* alternate */ + instructions["JNBE"] = x86.AJHI /* alternate */ + instructions["JNC"] = x86.AJCC /* alternate */ + instructions["JNE"] = x86.AJNE /* not equal (ZF = 0) */ + instructions["JNG"] = x86.AJLE /* alternate */ + instructions["JNGE"] = x86.AJLT /* alternate */ + instructions["JNL"] = x86.AJGE /* alternate */ + instructions["JNLE"] = x86.AJGT /* alternate */ + instructions["JNO"] = x86.AJOC /* alternate */ + instructions["JNP"] = x86.AJPC /* alternate */ + instructions["JNS"] = x86.AJPL /* alternate */ + instructions["JNZ"] = x86.AJNE /* alternate */ + instructions["JO"] = x86.AJOS /* alternate */ + instructions["JOC"] = x86.AJOC /* overflow clear (OF = 0) */ + instructions["JOS"] = x86.AJOS /* overflow set (OF = 1) */ + instructions["JP"] = x86.AJPS /* alternate */ + instructions["JPC"] = x86.AJPC /* parity clear (PF = 0) */ + instructions["JPE"] = x86.AJPS /* alternate */ + instructions["JPL"] = x86.AJPL /* non-negative (plus) (SF = 0) */ + instructions["JPO"] = x86.AJPC /* alternate */ + instructions["JPS"] = x86.AJPS /* parity set (PF = 1) */ + instructions["JS"] = x86.AJMI /* alternate */ + instructions["JZ"] = x86.AJEQ /* alternate */ + instructions["MASKMOVDQU"] = x86.AMASKMOVOU + instructions["MOVD"] = x86.AMOVQ + instructions["MOVDQ2Q"] = x86.AMOVQ + instructions["MOVNTDQ"] = x86.AMOVNTO + instructions["MOVOA"] = x86.AMOVO + instructions["PSLLDQ"] = x86.APSLLO + instructions["PSRLDQ"] = x86.APSRLO + instructions["PADDD"] = x86.APADDL + + return &Arch{ + LinkArch: linkArch, + Instructions: instructions, + Register: register, + RegisterPrefix: nil, + RegisterNumber: nilRegisterNumber, + IsJump: jumpX86, + } +} + +func archArm() *Arch { + register := make(map[string]int16) + // Create maps for easy lookup of instruction names etc. + // Note that there is no list of names as there is for x86. + for i := arm.REG_R0; i < arm.REG_SPSR; i++ { + register[obj.Rconv(i)] = int16(i) + } + // Avoid unintentionally clobbering g using R10. + delete(register, "R10") + register["g"] = arm.REG_R10 + for i := 0; i < 16; i++ { + register[fmt.Sprintf("C%d", i)] = int16(i) + } + + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + register["SP"] = RSP + registerPrefix := map[string]bool{ + "F": true, + "R": true, + } + + // special operands for DMB/DSB instructions + register["MB_SY"] = arm.REG_MB_SY + register["MB_ST"] = arm.REG_MB_ST + register["MB_ISH"] = arm.REG_MB_ISH + register["MB_ISHST"] = arm.REG_MB_ISHST + register["MB_NSH"] = arm.REG_MB_NSH + register["MB_NSHST"] = arm.REG_MB_NSHST + register["MB_OSH"] = arm.REG_MB_OSH + register["MB_OSHST"] = arm.REG_MB_OSHST + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range arm.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseARM + } + } + // Annoying aliases. + instructions["B"] = obj.AJMP + instructions["BL"] = obj.ACALL + // MCR differs from MRC by the way fields of the word are encoded. + // (Details in arm.go). Here we add the instruction so parse will find + // it, but give it an opcode number known only to us. + instructions["MCR"] = aMCR + + return &Arch{ + LinkArch: &arm.Linkarm, + Instructions: instructions, + Register: register, + RegisterPrefix: registerPrefix, + RegisterNumber: armRegisterNumber, + IsJump: jumpArm, + } +} + +func archArm64() *Arch { + register := make(map[string]int16) + // Create maps for easy lookup of instruction names etc. + // Note that there is no list of names as there is for 386 and amd64. + register[obj.Rconv(arm64.REGSP)] = int16(arm64.REGSP) + for i := arm64.REG_R0; i <= arm64.REG_R31; i++ { + register[obj.Rconv(i)] = int16(i) + } + // Rename R18 to R18_PLATFORM to avoid accidental use. + register["R18_PLATFORM"] = register["R18"] + delete(register, "R18") + for i := arm64.REG_F0; i <= arm64.REG_F31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := arm64.REG_V0; i <= arm64.REG_V31; i++ { + register[obj.Rconv(i)] = int16(i) + } + + // System registers. + for i := 0; i < len(arm64.SystemReg); i++ { + register[arm64.SystemReg[i].Name] = arm64.SystemReg[i].Reg + } + + register["LR"] = arm64.REGLINK + register["DAIFSet"] = arm64.REG_DAIFSet + register["DAIFClr"] = arm64.REG_DAIFClr + register["PLDL1KEEP"] = arm64.REG_PLDL1KEEP + register["PLDL1STRM"] = arm64.REG_PLDL1STRM + register["PLDL2KEEP"] = arm64.REG_PLDL2KEEP + register["PLDL2STRM"] = arm64.REG_PLDL2STRM + register["PLDL3KEEP"] = arm64.REG_PLDL3KEEP + register["PLDL3STRM"] = arm64.REG_PLDL3STRM + register["PLIL1KEEP"] = arm64.REG_PLIL1KEEP + register["PLIL1STRM"] = arm64.REG_PLIL1STRM + register["PLIL2KEEP"] = arm64.REG_PLIL2KEEP + register["PLIL2STRM"] = arm64.REG_PLIL2STRM + register["PLIL3KEEP"] = arm64.REG_PLIL3KEEP + register["PLIL3STRM"] = arm64.REG_PLIL3STRM + register["PSTL1KEEP"] = arm64.REG_PSTL1KEEP + register["PSTL1STRM"] = arm64.REG_PSTL1STRM + register["PSTL2KEEP"] = arm64.REG_PSTL2KEEP + register["PSTL2STRM"] = arm64.REG_PSTL2STRM + register["PSTL3KEEP"] = arm64.REG_PSTL3KEEP + register["PSTL3STRM"] = arm64.REG_PSTL3STRM + + // Conditional operators, like EQ, NE, etc. + register["EQ"] = arm64.COND_EQ + register["NE"] = arm64.COND_NE + register["HS"] = arm64.COND_HS + register["CS"] = arm64.COND_HS + register["LO"] = arm64.COND_LO + register["CC"] = arm64.COND_LO + register["MI"] = arm64.COND_MI + register["PL"] = arm64.COND_PL + register["VS"] = arm64.COND_VS + register["VC"] = arm64.COND_VC + register["HI"] = arm64.COND_HI + register["LS"] = arm64.COND_LS + register["GE"] = arm64.COND_GE + register["LT"] = arm64.COND_LT + register["GT"] = arm64.COND_GT + register["LE"] = arm64.COND_LE + register["AL"] = arm64.COND_AL + register["NV"] = arm64.COND_NV + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + register["SP"] = RSP + // Avoid unintentionally clobbering g using R28. + delete(register, "R28") + register["g"] = arm64.REG_R28 + registerPrefix := map[string]bool{ + "F": true, + "R": true, + "V": true, + } + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range arm64.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseARM64 + } + } + // Annoying aliases. + instructions["B"] = arm64.AB + instructions["BL"] = arm64.ABL + + return &Arch{ + LinkArch: &arm64.Linkarm64, + Instructions: instructions, + Register: register, + RegisterPrefix: registerPrefix, + RegisterNumber: arm64RegisterNumber, + IsJump: jumpArm64, + } + +} + +func archPPC64(linkArch *obj.LinkArch) *Arch { + register := make(map[string]int16) + // Create maps for easy lookup of instruction names etc. + // Note that there is no list of names as there is for x86. + for i := ppc64.REG_R0; i <= ppc64.REG_R31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := ppc64.REG_F0; i <= ppc64.REG_F31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := ppc64.REG_V0; i <= ppc64.REG_V31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := ppc64.REG_VS0; i <= ppc64.REG_VS63; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := ppc64.REG_CR0; i <= ppc64.REG_CR7; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := ppc64.REG_MSR; i <= ppc64.REG_CR; i++ { + register[obj.Rconv(i)] = int16(i) + } + register["CR"] = ppc64.REG_CR + register["XER"] = ppc64.REG_XER + register["LR"] = ppc64.REG_LR + register["CTR"] = ppc64.REG_CTR + register["FPSCR"] = ppc64.REG_FPSCR + register["MSR"] = ppc64.REG_MSR + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + // Avoid unintentionally clobbering g using R30. + delete(register, "R30") + register["g"] = ppc64.REG_R30 + registerPrefix := map[string]bool{ + "CR": true, + "F": true, + "R": true, + "SPR": true, + } + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range ppc64.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABasePPC64 + } + } + // Annoying aliases. + instructions["BR"] = ppc64.ABR + instructions["BL"] = ppc64.ABL + + return &Arch{ + LinkArch: linkArch, + Instructions: instructions, + Register: register, + RegisterPrefix: registerPrefix, + RegisterNumber: ppc64RegisterNumber, + IsJump: jumpPPC64, + } +} + +func archMips(linkArch *obj.LinkArch) *Arch { + register := make(map[string]int16) + // Create maps for easy lookup of instruction names etc. + // Note that there is no list of names as there is for x86. + for i := mips.REG_R0; i <= mips.REG_R31; i++ { + register[obj.Rconv(i)] = int16(i) + } + + for i := mips.REG_F0; i <= mips.REG_F31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := mips.REG_M0; i <= mips.REG_M31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := mips.REG_FCR0; i <= mips.REG_FCR31; i++ { + register[obj.Rconv(i)] = int16(i) + } + register["HI"] = mips.REG_HI + register["LO"] = mips.REG_LO + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + // Avoid unintentionally clobbering g using R30. + delete(register, "R30") + register["g"] = mips.REG_R30 + + registerPrefix := map[string]bool{ + "F": true, + "FCR": true, + "M": true, + "R": true, + } + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range mips.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseMIPS + } + } + // Annoying alias. + instructions["JAL"] = mips.AJAL + + return &Arch{ + LinkArch: linkArch, + Instructions: instructions, + Register: register, + RegisterPrefix: registerPrefix, + RegisterNumber: mipsRegisterNumber, + IsJump: jumpMIPS, + } +} + +func archMips64(linkArch *obj.LinkArch) *Arch { + register := make(map[string]int16) + // Create maps for easy lookup of instruction names etc. + // Note that there is no list of names as there is for x86. + for i := mips.REG_R0; i <= mips.REG_R31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := mips.REG_F0; i <= mips.REG_F31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := mips.REG_M0; i <= mips.REG_M31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := mips.REG_FCR0; i <= mips.REG_FCR31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := mips.REG_W0; i <= mips.REG_W31; i++ { + register[obj.Rconv(i)] = int16(i) + } + register["HI"] = mips.REG_HI + register["LO"] = mips.REG_LO + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + // Avoid unintentionally clobbering g using R30. + delete(register, "R30") + register["g"] = mips.REG_R30 + // Avoid unintentionally clobbering RSB using R28. + delete(register, "R28") + register["RSB"] = mips.REG_R28 + registerPrefix := map[string]bool{ + "F": true, + "FCR": true, + "M": true, + "R": true, + "W": true, + } + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range mips.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseMIPS + } + } + // Annoying alias. + instructions["JAL"] = mips.AJAL + + return &Arch{ + LinkArch: linkArch, + Instructions: instructions, + Register: register, + RegisterPrefix: registerPrefix, + RegisterNumber: mipsRegisterNumber, + IsJump: jumpMIPS, + } +} + +func archRISCV64() *Arch { + register := make(map[string]int16) + + // Standard register names. + for i := riscv.REG_X0; i <= riscv.REG_X31; i++ { + name := fmt.Sprintf("X%d", i-riscv.REG_X0) + register[name] = int16(i) + } + for i := riscv.REG_F0; i <= riscv.REG_F31; i++ { + name := fmt.Sprintf("F%d", i-riscv.REG_F0) + register[name] = int16(i) + } + + // General registers with ABI names. + register["ZERO"] = riscv.REG_ZERO + register["RA"] = riscv.REG_RA + register["SP"] = riscv.REG_SP + register["GP"] = riscv.REG_GP + register["TP"] = riscv.REG_TP + register["T0"] = riscv.REG_T0 + register["T1"] = riscv.REG_T1 + register["T2"] = riscv.REG_T2 + register["S0"] = riscv.REG_S0 + register["S1"] = riscv.REG_S1 + register["A0"] = riscv.REG_A0 + register["A1"] = riscv.REG_A1 + register["A2"] = riscv.REG_A2 + register["A3"] = riscv.REG_A3 + register["A4"] = riscv.REG_A4 + register["A5"] = riscv.REG_A5 + register["A6"] = riscv.REG_A6 + register["A7"] = riscv.REG_A7 + register["S2"] = riscv.REG_S2 + register["S3"] = riscv.REG_S3 + register["S4"] = riscv.REG_S4 + register["S5"] = riscv.REG_S5 + register["S6"] = riscv.REG_S6 + register["S7"] = riscv.REG_S7 + register["S8"] = riscv.REG_S8 + register["S9"] = riscv.REG_S9 + register["S10"] = riscv.REG_S10 + register["S11"] = riscv.REG_S11 + register["T3"] = riscv.REG_T3 + register["T4"] = riscv.REG_T4 + register["T5"] = riscv.REG_T5 + register["T6"] = riscv.REG_T6 + + // Go runtime register names. + register["g"] = riscv.REG_G + register["CTXT"] = riscv.REG_CTXT + register["TMP"] = riscv.REG_TMP + + // ABI names for floating point register. + register["FT0"] = riscv.REG_FT0 + register["FT1"] = riscv.REG_FT1 + register["FT2"] = riscv.REG_FT2 + register["FT3"] = riscv.REG_FT3 + register["FT4"] = riscv.REG_FT4 + register["FT5"] = riscv.REG_FT5 + register["FT6"] = riscv.REG_FT6 + register["FT7"] = riscv.REG_FT7 + register["FS0"] = riscv.REG_FS0 + register["FS1"] = riscv.REG_FS1 + register["FA0"] = riscv.REG_FA0 + register["FA1"] = riscv.REG_FA1 + register["FA2"] = riscv.REG_FA2 + register["FA3"] = riscv.REG_FA3 + register["FA4"] = riscv.REG_FA4 + register["FA5"] = riscv.REG_FA5 + register["FA6"] = riscv.REG_FA6 + register["FA7"] = riscv.REG_FA7 + register["FS2"] = riscv.REG_FS2 + register["FS3"] = riscv.REG_FS3 + register["FS4"] = riscv.REG_FS4 + register["FS5"] = riscv.REG_FS5 + register["FS6"] = riscv.REG_FS6 + register["FS7"] = riscv.REG_FS7 + register["FS8"] = riscv.REG_FS8 + register["FS9"] = riscv.REG_FS9 + register["FS10"] = riscv.REG_FS10 + register["FS11"] = riscv.REG_FS11 + register["FT8"] = riscv.REG_FT8 + register["FT9"] = riscv.REG_FT9 + register["FT10"] = riscv.REG_FT10 + register["FT11"] = riscv.REG_FT11 + + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range riscv.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseRISCV + } + } + + return &Arch{ + LinkArch: &riscv.LinkRISCV64, + Instructions: instructions, + Register: register, + RegisterPrefix: nil, + RegisterNumber: nilRegisterNumber, + IsJump: jumpRISCV, + } +} + +func archS390x() *Arch { + register := make(map[string]int16) + // Create maps for easy lookup of instruction names etc. + // Note that there is no list of names as there is for x86. + for i := s390x.REG_R0; i <= s390x.REG_R15; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := s390x.REG_F0; i <= s390x.REG_F15; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := s390x.REG_V0; i <= s390x.REG_V31; i++ { + register[obj.Rconv(i)] = int16(i) + } + for i := s390x.REG_AR0; i <= s390x.REG_AR15; i++ { + register[obj.Rconv(i)] = int16(i) + } + register["LR"] = s390x.REG_LR + // Pseudo-registers. + register["SB"] = RSB + register["FP"] = RFP + register["PC"] = RPC + // Avoid unintentionally clobbering g using R13. + delete(register, "R13") + register["g"] = s390x.REG_R13 + registerPrefix := map[string]bool{ + "AR": true, + "F": true, + "R": true, + } + + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range s390x.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseS390X + } + } + // Annoying aliases. + instructions["BR"] = s390x.ABR + instructions["BL"] = s390x.ABL + + return &Arch{ + LinkArch: &s390x.Links390x, + Instructions: instructions, + Register: register, + RegisterPrefix: registerPrefix, + RegisterNumber: s390xRegisterNumber, + IsJump: jumpS390x, + } +} + +func archWasm() *Arch { + instructions := make(map[string]obj.As) + for i, s := range obj.Anames { + instructions[s] = obj.As(i) + } + for i, s := range wasm.Anames { + if obj.As(i) >= obj.A_ARCHSPECIFIC { + instructions[s] = obj.As(i) + obj.ABaseWasm + } + } + + return &Arch{ + LinkArch: &wasm.Linkwasm, + Instructions: instructions, + Register: wasm.Register, + RegisterPrefix: nil, + RegisterNumber: nilRegisterNumber, + IsJump: jumpWasm, + } +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arm.go b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arm.go new file mode 100644 index 00000000..645e98a5 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arm.go @@ -0,0 +1,257 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This file encapsulates some of the odd characteristics of the ARM +// instruction set, to minimize its interaction with the core of the +// assembler. + +package arch + +import ( + "strings" + + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/obj/arm" +) + +var armLS = map[string]uint8{ + "U": arm.C_UBIT, + "S": arm.C_SBIT, + "W": arm.C_WBIT, + "P": arm.C_PBIT, + "PW": arm.C_WBIT | arm.C_PBIT, + "WP": arm.C_WBIT | arm.C_PBIT, +} + +var armSCOND = map[string]uint8{ + "EQ": arm.C_SCOND_EQ, + "NE": arm.C_SCOND_NE, + "CS": arm.C_SCOND_HS, + "HS": arm.C_SCOND_HS, + "CC": arm.C_SCOND_LO, + "LO": arm.C_SCOND_LO, + "MI": arm.C_SCOND_MI, + "PL": arm.C_SCOND_PL, + "VS": arm.C_SCOND_VS, + "VC": arm.C_SCOND_VC, + "HI": arm.C_SCOND_HI, + "LS": arm.C_SCOND_LS, + "GE": arm.C_SCOND_GE, + "LT": arm.C_SCOND_LT, + "GT": arm.C_SCOND_GT, + "LE": arm.C_SCOND_LE, + "AL": arm.C_SCOND_NONE, + "U": arm.C_UBIT, + "S": arm.C_SBIT, + "W": arm.C_WBIT, + "P": arm.C_PBIT, + "PW": arm.C_WBIT | arm.C_PBIT, + "WP": arm.C_WBIT | arm.C_PBIT, + "F": arm.C_FBIT, + "IBW": arm.C_WBIT | arm.C_PBIT | arm.C_UBIT, + "IAW": arm.C_WBIT | arm.C_UBIT, + "DBW": arm.C_WBIT | arm.C_PBIT, + "DAW": arm.C_WBIT, + "IB": arm.C_PBIT | arm.C_UBIT, + "IA": arm.C_UBIT, + "DB": arm.C_PBIT, + "DA": 0, +} + +var armJump = map[string]bool{ + "B": true, + "BL": true, + "BX": true, + "BEQ": true, + "BNE": true, + "BCS": true, + "BHS": true, + "BCC": true, + "BLO": true, + "BMI": true, + "BPL": true, + "BVS": true, + "BVC": true, + "BHI": true, + "BLS": true, + "BGE": true, + "BLT": true, + "BGT": true, + "BLE": true, + "CALL": true, + "JMP": true, +} + +func jumpArm(word string) bool { + return armJump[word] +} + +// IsARMCMP reports whether the op (as defined by an arm.A* constant) is +// one of the comparison instructions that require special handling. +func IsARMCMP(op obj.As) bool { + switch op { + case arm.ACMN, arm.ACMP, arm.ATEQ, arm.ATST: + return true + } + return false +} + +// IsARMSTREX reports whether the op (as defined by an arm.A* constant) is +// one of the STREX-like instructions that require special handling. +func IsARMSTREX(op obj.As) bool { + switch op { + case arm.ASTREX, arm.ASTREXD, arm.ASWPW, arm.ASWPBU: + return true + } + return false +} + +// MCR is not defined by the obj/arm; instead we define it privately here. +// It is encoded as an MRC with a bit inside the instruction word, +// passed to arch.ARMMRCOffset. +const aMCR = arm.ALAST + 1 + +// IsARMMRC reports whether the op (as defined by an arm.A* constant) is +// MRC or MCR +func IsARMMRC(op obj.As) bool { + switch op { + case arm.AMRC, aMCR: // Note: aMCR is defined in this package. + return true + } + return false +} + +// IsARMBFX reports whether the op (as defined by an arm.A* constant) is one the +// BFX-like instructions which are in the form of "op $width, $LSB, (Reg,) Reg". +func IsARMBFX(op obj.As) bool { + switch op { + case arm.ABFX, arm.ABFXU, arm.ABFC, arm.ABFI: + return true + } + return false +} + +// IsARMFloatCmp reports whether the op is a floating comparison instruction. +func IsARMFloatCmp(op obj.As) bool { + switch op { + case arm.ACMPF, arm.ACMPD: + return true + } + return false +} + +// ARMMRCOffset implements the peculiar encoding of the MRC and MCR instructions. +// The difference between MRC and MCR is represented by a bit high in the word, not +// in the usual way by the opcode itself. Asm must use AMRC for both instructions, so +// we return the opcode for MRC so that asm doesn't need to import obj/arm. +func ARMMRCOffset(op obj.As, cond string, x0, x1, x2, x3, x4, x5 int64) (offset int64, op0 obj.As, ok bool) { + op1 := int64(0) + if op == arm.AMRC { + op1 = 1 + } + bits, ok := ParseARMCondition(cond) + if !ok { + return + } + offset = (0xe << 24) | // opcode + (op1 << 20) | // MCR/MRC + ((int64(bits) ^ arm.C_SCOND_XOR) << 28) | // scond + ((x0 & 15) << 8) | //coprocessor number + ((x1 & 7) << 21) | // coprocessor operation + ((x2 & 15) << 12) | // ARM register + ((x3 & 15) << 16) | // Crn + ((x4 & 15) << 0) | // Crm + ((x5 & 7) << 5) | // coprocessor information + (1 << 4) /* must be set */ + return offset, arm.AMRC, true +} + +// IsARMMULA reports whether the op (as defined by an arm.A* constant) is +// MULA, MULS, MMULA, MMULS, MULABB, MULAWB or MULAWT, the 4-operand instructions. +func IsARMMULA(op obj.As) bool { + switch op { + case arm.AMULA, arm.AMULS, arm.AMMULA, arm.AMMULS, arm.AMULABB, arm.AMULAWB, arm.AMULAWT: + return true + } + return false +} + +var bcode = []obj.As{ + arm.ABEQ, + arm.ABNE, + arm.ABCS, + arm.ABCC, + arm.ABMI, + arm.ABPL, + arm.ABVS, + arm.ABVC, + arm.ABHI, + arm.ABLS, + arm.ABGE, + arm.ABLT, + arm.ABGT, + arm.ABLE, + arm.AB, + obj.ANOP, +} + +// ARMConditionCodes handles the special condition code situation for the ARM. +// It returns a boolean to indicate success; failure means cond was unrecognized. +func ARMConditionCodes(prog *obj.Prog, cond string) bool { + if cond == "" { + return true + } + bits, ok := ParseARMCondition(cond) + if !ok { + return false + } + /* hack to make B.NE etc. work: turn it into the corresponding conditional */ + if prog.As == arm.AB { + prog.As = bcode[(bits^arm.C_SCOND_XOR)&0xf] + bits = (bits &^ 0xf) | arm.C_SCOND_NONE + } + prog.Scond = bits + return true +} + +// ParseARMCondition parses the conditions attached to an ARM instruction. +// The input is a single string consisting of period-separated condition +// codes, such as ".P.W". An initial period is ignored. +func ParseARMCondition(cond string) (uint8, bool) { + return parseARMCondition(cond, armLS, armSCOND) +} + +func parseARMCondition(cond string, ls, scond map[string]uint8) (uint8, bool) { + cond = strings.TrimPrefix(cond, ".") + if cond == "" { + return arm.C_SCOND_NONE, true + } + names := strings.Split(cond, ".") + bits := uint8(0) + for _, name := range names { + if b, present := ls[name]; present { + bits |= b + continue + } + if b, present := scond[name]; present { + bits = (bits &^ arm.C_SCOND) | b + continue + } + return 0, false + } + return bits, true +} + +func armRegisterNumber(name string, n int16) (int16, bool) { + if n < 0 || 15 < n { + return 0, false + } + switch name { + case "R": + return arm.REG_R0 + n, true + case "F": + return arm.REG_F0 + n, true + } + return 0, false +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arm64.go b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arm64.go new file mode 100644 index 00000000..b0606beb --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/arm64.go @@ -0,0 +1,350 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This file encapsulates some of the odd characteristics of the ARM64 +// instruction set, to minimize its interaction with the core of the +// assembler. + +package arch + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/obj/arm64" + "errors" +) + +var arm64LS = map[string]uint8{ + "P": arm64.C_XPOST, + "W": arm64.C_XPRE, +} + +var arm64Jump = map[string]bool{ + "B": true, + "BL": true, + "BEQ": true, + "BNE": true, + "BCS": true, + "BHS": true, + "BCC": true, + "BLO": true, + "BMI": true, + "BPL": true, + "BVS": true, + "BVC": true, + "BHI": true, + "BLS": true, + "BGE": true, + "BLT": true, + "BGT": true, + "BLE": true, + "CALL": true, + "CBZ": true, + "CBZW": true, + "CBNZ": true, + "CBNZW": true, + "JMP": true, + "TBNZ": true, + "TBZ": true, +} + +func jumpArm64(word string) bool { + return arm64Jump[word] +} + +// IsARM64CMP reports whether the op (as defined by an arm.A* constant) is +// one of the comparison instructions that require special handling. +func IsARM64CMP(op obj.As) bool { + switch op { + case arm64.ACMN, arm64.ACMP, arm64.ATST, + arm64.ACMNW, arm64.ACMPW, arm64.ATSTW, + arm64.AFCMPS, arm64.AFCMPD, + arm64.AFCMPES, arm64.AFCMPED: + return true + } + return false +} + +// IsARM64STLXR reports whether the op (as defined by an arm64.A* +// constant) is one of the STLXR-like instructions that require special +// handling. +func IsARM64STLXR(op obj.As) bool { + switch op { + case arm64.ASTLXRB, arm64.ASTLXRH, arm64.ASTLXRW, arm64.ASTLXR, + arm64.ASTXRB, arm64.ASTXRH, arm64.ASTXRW, arm64.ASTXR, + arm64.ASTXP, arm64.ASTXPW, arm64.ASTLXP, arm64.ASTLXPW: + return true + } + // atomic instructions + if arm64.IsAtomicInstruction(op) { + return true + } + return false +} + +// ARM64Suffix handles the special suffix for the ARM64. +// It returns a boolean to indicate success; failure means +// cond was unrecognized. +func ARM64Suffix(prog *obj.Prog, cond string) bool { + if cond == "" { + return true + } + bits, ok := parseARM64Suffix(cond) + if !ok { + return false + } + prog.Scond = bits + return true +} + +// parseARM64Suffix parses the suffix attached to an ARM64 instruction. +// The input is a single string consisting of period-separated condition +// codes, such as ".P.W". An initial period is ignored. +func parseARM64Suffix(cond string) (uint8, bool) { + if cond == "" { + return 0, true + } + return parseARMCondition(cond, arm64LS, nil) +} + +func arm64RegisterNumber(name string, n int16) (int16, bool) { + switch name { + case "F": + if 0 <= n && n <= 31 { + return arm64.REG_F0 + n, true + } + case "R": + if 0 <= n && n <= 30 { // not 31 + return arm64.REG_R0 + n, true + } + case "V": + if 0 <= n && n <= 31 { + return arm64.REG_V0 + n, true + } + } + return 0, false +} + +// IsARM64TBL reports whether the op (as defined by an arm64.A* +// constant) is one of the table lookup instructions that require special +// handling. +func IsARM64TBL(op obj.As) bool { + return op == arm64.AVTBL +} + +// ARM64RegisterExtension parses an ARM64 register with extension or arrangement. +func ARM64RegisterExtension(a *obj.Addr, ext string, reg, num int16, isAmount, isIndex bool) error { + Rnum := (reg & 31) + int16(num<<5) + if isAmount { + if num < 0 || num > 7 { + return errors.New("index shift amount is out of range") + } + } + switch ext { + case "UXTB": + if !isAmount { + return errors.New("invalid register extension") + } + if a.Type == obj.TYPE_MEM { + return errors.New("invalid shift for the register offset addressing mode") + } + a.Reg = arm64.REG_UXTB + Rnum + case "UXTH": + if !isAmount { + return errors.New("invalid register extension") + } + if a.Type == obj.TYPE_MEM { + return errors.New("invalid shift for the register offset addressing mode") + } + a.Reg = arm64.REG_UXTH + Rnum + case "UXTW": + if !isAmount { + return errors.New("invalid register extension") + } + // effective address of memory is a base register value and an offset register value. + if a.Type == obj.TYPE_MEM { + a.Index = arm64.REG_UXTW + Rnum + } else { + a.Reg = arm64.REG_UXTW + Rnum + } + case "UXTX": + if !isAmount { + return errors.New("invalid register extension") + } + if a.Type == obj.TYPE_MEM { + return errors.New("invalid shift for the register offset addressing mode") + } + a.Reg = arm64.REG_UXTX + Rnum + case "SXTB": + if !isAmount { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_SXTB + Rnum + case "SXTH": + if !isAmount { + return errors.New("invalid register extension") + } + if a.Type == obj.TYPE_MEM { + return errors.New("invalid shift for the register offset addressing mode") + } + a.Reg = arm64.REG_SXTH + Rnum + case "SXTW": + if !isAmount { + return errors.New("invalid register extension") + } + if a.Type == obj.TYPE_MEM { + a.Index = arm64.REG_SXTW + Rnum + } else { + a.Reg = arm64.REG_SXTW + Rnum + } + case "SXTX": + if !isAmount { + return errors.New("invalid register extension") + } + if a.Type == obj.TYPE_MEM { + a.Index = arm64.REG_SXTX + Rnum + } else { + a.Reg = arm64.REG_SXTX + Rnum + } + case "LSL": + if !isAmount { + return errors.New("invalid register extension") + } + a.Index = arm64.REG_LSL + Rnum + case "B8": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_8B & 15) << 5) + case "B16": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_16B & 15) << 5) + case "H4": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_4H & 15) << 5) + case "H8": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_8H & 15) << 5) + case "S2": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_2S & 15) << 5) + case "S4": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_4S & 15) << 5) + case "D1": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_1D & 15) << 5) + case "D2": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_2D & 15) << 5) + case "Q1": + if isIndex { + return errors.New("invalid register extension") + } + a.Reg = arm64.REG_ARNG + (reg & 31) + ((arm64.ARNG_1Q & 15) << 5) + case "B": + if !isIndex { + return nil + } + a.Reg = arm64.REG_ELEM + (reg & 31) + ((arm64.ARNG_B & 15) << 5) + a.Index = num + case "H": + if !isIndex { + return nil + } + a.Reg = arm64.REG_ELEM + (reg & 31) + ((arm64.ARNG_H & 15) << 5) + a.Index = num + case "S": + if !isIndex { + return nil + } + a.Reg = arm64.REG_ELEM + (reg & 31) + ((arm64.ARNG_S & 15) << 5) + a.Index = num + case "D": + if !isIndex { + return nil + } + a.Reg = arm64.REG_ELEM + (reg & 31) + ((arm64.ARNG_D & 15) << 5) + a.Index = num + default: + return errors.New("unsupported register extension type: " + ext) + } + + return nil +} + +// ARM64RegisterArrangement parses an ARM64 vector register arrangement. +func ARM64RegisterArrangement(reg int16, name, arng string) (int64, error) { + var curQ, curSize uint16 + if name[0] != 'V' { + return 0, errors.New("expect V0 through V31; found: " + name) + } + if reg < 0 { + return 0, errors.New("invalid register number: " + name) + } + switch arng { + case "B8": + curSize = 0 + curQ = 0 + case "B16": + curSize = 0 + curQ = 1 + case "H4": + curSize = 1 + curQ = 0 + case "H8": + curSize = 1 + curQ = 1 + case "S2": + curSize = 2 + curQ = 0 + case "S4": + curSize = 2 + curQ = 1 + case "D1": + curSize = 3 + curQ = 0 + case "D2": + curSize = 3 + curQ = 1 + default: + return 0, errors.New("invalid arrangement in ARM64 register list") + } + return (int64(curQ) & 1 << 30) | (int64(curSize&3) << 10), nil +} + +// ARM64RegisterListOffset generates offset encoding according to AArch64 specification. +func ARM64RegisterListOffset(firstReg, regCnt int, arrangement int64) (int64, error) { + offset := int64(firstReg) + switch regCnt { + case 1: + offset |= 0x7 << 12 + case 2: + offset |= 0xa << 12 + case 3: + offset |= 0x6 << 12 + case 4: + offset |= 0x2 << 12 + default: + return 0, errors.New("invalid register numbers in ARM64 register list") + } + offset |= arrangement + // arm64 uses the 60th bit to differentiate from other archs + // For more details, refer to: obj/arm64/list7.go + offset |= 1 << 60 + return offset, nil +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/mips.go b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/mips.go new file mode 100644 index 00000000..7af9dbb2 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/mips.go @@ -0,0 +1,72 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This file encapsulates some of the odd characteristics of the +// MIPS (MIPS64) instruction set, to minimize its interaction +// with the core of the assembler. + +package arch + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/obj/mips" +) + +func jumpMIPS(word string) bool { + switch word { + case "BEQ", "BFPF", "BFPT", "BGEZ", "BGEZAL", "BGTZ", "BLEZ", "BLTZ", "BLTZAL", "BNE", "JMP", "JAL", "CALL": + return true + } + return false +} + +// IsMIPSCMP reports whether the op (as defined by an mips.A* constant) is +// one of the CMP instructions that require special handling. +func IsMIPSCMP(op obj.As) bool { + switch op { + case mips.ACMPEQF, mips.ACMPEQD, mips.ACMPGEF, mips.ACMPGED, + mips.ACMPGTF, mips.ACMPGTD: + return true + } + return false +} + +// IsMIPSMUL reports whether the op (as defined by an mips.A* constant) is +// one of the MUL/DIV/REM/MADD/MSUB instructions that require special handling. +func IsMIPSMUL(op obj.As) bool { + switch op { + case mips.AMUL, mips.AMULU, mips.AMULV, mips.AMULVU, + mips.ADIV, mips.ADIVU, mips.ADIVV, mips.ADIVVU, + mips.AREM, mips.AREMU, mips.AREMV, mips.AREMVU, + mips.AMADD, mips.AMSUB: + return true + } + return false +} + +func mipsRegisterNumber(name string, n int16) (int16, bool) { + switch name { + case "F": + if 0 <= n && n <= 31 { + return mips.REG_F0 + n, true + } + case "FCR": + if 0 <= n && n <= 31 { + return mips.REG_FCR0 + n, true + } + case "M": + if 0 <= n && n <= 31 { + return mips.REG_M0 + n, true + } + case "R": + if 0 <= n && n <= 31 { + return mips.REG_R0 + n, true + } + case "W": + if 0 <= n && n <= 31 { + return mips.REG_W0 + n, true + } + } + return 0, false +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/ppc64.go b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/ppc64.go new file mode 100644 index 00000000..8b2f097d --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/ppc64.go @@ -0,0 +1,102 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This file encapsulates some of the odd characteristics of the +// 64-bit PowerPC (PPC64) instruction set, to minimize its interaction +// with the core of the assembler. + +package arch + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/obj/ppc64" +) + +func jumpPPC64(word string) bool { + switch word { + case "BC", "BCL", "BEQ", "BGE", "BGT", "BL", "BLE", "BLT", "BNE", "BR", "BVC", "BVS", "CALL", "JMP": + return true + } + return false +} + +// IsPPC64RLD reports whether the op (as defined by an ppc64.A* constant) is +// one of the RLD-like instructions that require special handling. +// The FMADD-like instructions behave similarly. +func IsPPC64RLD(op obj.As) bool { + switch op { + case ppc64.ARLDC, ppc64.ARLDCCC, ppc64.ARLDCL, ppc64.ARLDCLCC, + ppc64.ARLDCR, ppc64.ARLDCRCC, ppc64.ARLDMI, ppc64.ARLDMICC, + ppc64.ARLWMI, ppc64.ARLWMICC, ppc64.ARLWNM, ppc64.ARLWNMCC: + return true + case ppc64.AFMADD, ppc64.AFMADDCC, ppc64.AFMADDS, ppc64.AFMADDSCC, + ppc64.AFMSUB, ppc64.AFMSUBCC, ppc64.AFMSUBS, ppc64.AFMSUBSCC, + ppc64.AFNMADD, ppc64.AFNMADDCC, ppc64.AFNMADDS, ppc64.AFNMADDSCC, + ppc64.AFNMSUB, ppc64.AFNMSUBCC, ppc64.AFNMSUBS, ppc64.AFNMSUBSCC: + return true + } + return false +} + +func IsPPC64ISEL(op obj.As) bool { + return op == ppc64.AISEL +} + +// IsPPC64CMP reports whether the op (as defined by an ppc64.A* constant) is +// one of the CMP instructions that require special handling. +func IsPPC64CMP(op obj.As) bool { + switch op { + case ppc64.ACMP, ppc64.ACMPU, ppc64.ACMPW, ppc64.ACMPWU, ppc64.AFCMPU: + return true + } + return false +} + +// IsPPC64NEG reports whether the op (as defined by an ppc64.A* constant) is +// one of the NEG-like instructions that require special handling. +func IsPPC64NEG(op obj.As) bool { + switch op { + case ppc64.AADDMECC, ppc64.AADDMEVCC, ppc64.AADDMEV, ppc64.AADDME, + ppc64.AADDZECC, ppc64.AADDZEVCC, ppc64.AADDZEV, ppc64.AADDZE, + ppc64.ACNTLZDCC, ppc64.ACNTLZD, ppc64.ACNTLZWCC, ppc64.ACNTLZW, + ppc64.AEXTSBCC, ppc64.AEXTSB, ppc64.AEXTSHCC, ppc64.AEXTSH, + ppc64.AEXTSWCC, ppc64.AEXTSW, ppc64.ANEGCC, ppc64.ANEGVCC, + ppc64.ANEGV, ppc64.ANEG, ppc64.ASLBMFEE, ppc64.ASLBMFEV, + ppc64.ASLBMTE, ppc64.ASUBMECC, ppc64.ASUBMEVCC, ppc64.ASUBMEV, + ppc64.ASUBME, ppc64.ASUBZECC, ppc64.ASUBZEVCC, ppc64.ASUBZEV, + ppc64.ASUBZE: + return true + } + return false +} + +func ppc64RegisterNumber(name string, n int16) (int16, bool) { + switch name { + case "CR": + if 0 <= n && n <= 7 { + return ppc64.REG_CR0 + n, true + } + case "VS": + if 0 <= n && n <= 63 { + return ppc64.REG_VS0 + n, true + } + case "V": + if 0 <= n && n <= 31 { + return ppc64.REG_V0 + n, true + } + case "F": + if 0 <= n && n <= 31 { + return ppc64.REG_F0 + n, true + } + case "R": + if 0 <= n && n <= 31 { + return ppc64.REG_R0 + n, true + } + case "SPR": + if 0 <= n && n <= 1024 { + return ppc64.REG_SPR0 + n, true + } + } + return 0, false +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/riscv64.go b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/riscv64.go new file mode 100644 index 00000000..e4f17536 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/riscv64.go @@ -0,0 +1,28 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This file encapsulates some of the odd characteristics of the RISCV64 +// instruction set, to minimize its interaction with the core of the +// assembler. + +package arch + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/obj/riscv" +) + +// IsRISCV64AMO reports whether the op (as defined by a riscv.A* +// constant) is one of the AMO instructions that requires special +// handling. +func IsRISCV64AMO(op obj.As) bool { + switch op { + case riscv.ASCW, riscv.ASCD, riscv.AAMOSWAPW, riscv.AAMOSWAPD, riscv.AAMOADDW, riscv.AAMOADDD, + riscv.AAMOANDW, riscv.AAMOANDD, riscv.AAMOORW, riscv.AAMOORD, riscv.AAMOXORW, riscv.AAMOXORD, + riscv.AAMOMINW, riscv.AAMOMIND, riscv.AAMOMINUW, riscv.AAMOMINUD, + riscv.AAMOMAXW, riscv.AAMOMAXD, riscv.AAMOMAXUW, riscv.AAMOMAXUD: + return true + } + return false +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/s390x.go b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/s390x.go new file mode 100644 index 00000000..1e33f1e3 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/asm/arch/s390x.go @@ -0,0 +1,81 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This file encapsulates some of the odd characteristics of the +// s390x instruction set, to minimize its interaction +// with the core of the assembler. + +package arch + +import ( + "github.com/twitchyliquid64/golang-asm/obj/s390x" +) + +func jumpS390x(word string) bool { + switch word { + case "BRC", + "BC", + "BCL", + "BEQ", + "BGE", + "BGT", + "BL", + "BLE", + "BLEU", + "BLT", + "BLTU", + "BNE", + "BR", + "BVC", + "BVS", + "BRCT", + "BRCTG", + "CMPBEQ", + "CMPBGE", + "CMPBGT", + "CMPBLE", + "CMPBLT", + "CMPBNE", + "CMPUBEQ", + "CMPUBGE", + "CMPUBGT", + "CMPUBLE", + "CMPUBLT", + "CMPUBNE", + "CRJ", + "CGRJ", + "CLRJ", + "CLGRJ", + "CIJ", + "CGIJ", + "CLIJ", + "CLGIJ", + "CALL", + "JMP": + return true + } + return false +} + +func s390xRegisterNumber(name string, n int16) (int16, bool) { + switch name { + case "AR": + if 0 <= n && n <= 15 { + return s390x.REG_AR0 + n, true + } + case "F": + if 0 <= n && n <= 15 { + return s390x.REG_F0 + n, true + } + case "R": + if 0 <= n && n <= 15 { + return s390x.REG_R0 + n, true + } + case "V": + if 0 <= n && n <= 31 { + return s390x.REG_V0 + n, true + } + } + return 0, false +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/bio/buf.go b/vendor/github.com/twitchyliquid64/golang-asm/bio/buf.go new file mode 100644 index 00000000..c4c25149 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/bio/buf.go @@ -0,0 +1,148 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package bio implements common I/O abstractions used within the Go toolchain. +package bio + +import ( + "bufio" + "io" + "log" + "os" +) + +// Reader implements a seekable buffered io.Reader. +type Reader struct { + f *os.File + *bufio.Reader +} + +// Writer implements a seekable buffered io.Writer. +type Writer struct { + f *os.File + *bufio.Writer +} + +// Create creates the file named name and returns a Writer +// for that file. +func Create(name string) (*Writer, error) { + f, err := os.Create(name) + if err != nil { + return nil, err + } + return &Writer{f: f, Writer: bufio.NewWriter(f)}, nil +} + +// Open returns a Reader for the file named name. +func Open(name string) (*Reader, error) { + f, err := os.Open(name) + if err != nil { + return nil, err + } + return NewReader(f), nil +} + +// NewReader returns a Reader from an open file. +func NewReader(f *os.File) *Reader { + return &Reader{f: f, Reader: bufio.NewReader(f)} +} + +func (r *Reader) MustSeek(offset int64, whence int) int64 { + if whence == 1 { + offset -= int64(r.Buffered()) + } + off, err := r.f.Seek(offset, whence) + if err != nil { + log.Fatalf("seeking in output: %v", err) + } + r.Reset(r.f) + return off +} + +func (w *Writer) MustSeek(offset int64, whence int) int64 { + if err := w.Flush(); err != nil { + log.Fatalf("writing output: %v", err) + } + off, err := w.f.Seek(offset, whence) + if err != nil { + log.Fatalf("seeking in output: %v", err) + } + return off +} + +func (r *Reader) Offset() int64 { + off, err := r.f.Seek(0, 1) + if err != nil { + log.Fatalf("seeking in output [0, 1]: %v", err) + } + off -= int64(r.Buffered()) + return off +} + +func (w *Writer) Offset() int64 { + if err := w.Flush(); err != nil { + log.Fatalf("writing output: %v", err) + } + off, err := w.f.Seek(0, 1) + if err != nil { + log.Fatalf("seeking in output [0, 1]: %v", err) + } + return off +} + +func (r *Reader) Close() error { + return r.f.Close() +} + +func (w *Writer) Close() error { + err := w.Flush() + err1 := w.f.Close() + if err == nil { + err = err1 + } + return err +} + +func (r *Reader) File() *os.File { + return r.f +} + +func (w *Writer) File() *os.File { + return w.f +} + +// Slice reads the next length bytes of r into a slice. +// +// This slice may be backed by mmap'ed memory. Currently, this memory +// will never be unmapped. The second result reports whether the +// backing memory is read-only. +func (r *Reader) Slice(length uint64) ([]byte, bool, error) { + if length == 0 { + return []byte{}, false, nil + } + + data, ok := r.sliceOS(length) + if ok { + return data, true, nil + } + + data = make([]byte, length) + _, err := io.ReadFull(r, data) + if err != nil { + return nil, false, err + } + return data, false, nil +} + +// SliceRO returns a slice containing the next length bytes of r +// backed by a read-only mmap'd data. If the mmap cannot be +// established (limit exceeded, region too small, etc) a nil slice +// will be returned. If mmap succeeds, it will never be unmapped. +func (r *Reader) SliceRO(length uint64) []byte { + data, ok := r.sliceOS(length) + if ok { + return data + } + return nil +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/bio/buf_mmap.go b/vendor/github.com/twitchyliquid64/golang-asm/bio/buf_mmap.go new file mode 100644 index 00000000..4b43d74f --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/bio/buf_mmap.go @@ -0,0 +1,62 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build darwin dragonfly freebsd linux netbsd openbsd + +package bio + +import ( + "runtime" + "sync/atomic" + "syscall" +) + +// mmapLimit is the maximum number of mmaped regions to create before +// falling back to reading into a heap-allocated slice. This exists +// because some operating systems place a limit on the number of +// distinct mapped regions per process. As of this writing: +// +// Darwin unlimited +// DragonFly 1000000 (vm.max_proc_mmap) +// FreeBSD unlimited +// Linux 65530 (vm.max_map_count) // TODO: query /proc/sys/vm/max_map_count? +// NetBSD unlimited +// OpenBSD unlimited +var mmapLimit int32 = 1<<31 - 1 + +func init() { + // Linux is the only practically concerning OS. + if runtime.GOOS == "linux" { + mmapLimit = 30000 + } +} + +func (r *Reader) sliceOS(length uint64) ([]byte, bool) { + // For small slices, don't bother with the overhead of a + // mapping, especially since we have no way to unmap it. + const threshold = 16 << 10 + if length < threshold { + return nil, false + } + + // Have we reached the mmap limit? + if atomic.AddInt32(&mmapLimit, -1) < 0 { + atomic.AddInt32(&mmapLimit, 1) + return nil, false + } + + // Page-align the offset. + off := r.Offset() + align := syscall.Getpagesize() + aoff := off &^ int64(align-1) + + data, err := syscall.Mmap(int(r.f.Fd()), aoff, int(length+uint64(off-aoff)), syscall.PROT_READ, syscall.MAP_SHARED|syscall.MAP_FILE) + if err != nil { + return nil, false + } + + data = data[off-aoff:] + r.MustSeek(int64(length), 1) + return data, true +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/bio/buf_nommap.go b/vendor/github.com/twitchyliquid64/golang-asm/bio/buf_nommap.go new file mode 100644 index 00000000..f43c67ac --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/bio/buf_nommap.go @@ -0,0 +1,11 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd + +package bio + +func (r *Reader) sliceOS(length uint64) ([]byte, bool) { + return nil, false +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/bio/must.go b/vendor/github.com/twitchyliquid64/golang-asm/bio/must.go new file mode 100644 index 00000000..3604b291 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/bio/must.go @@ -0,0 +1,43 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bio + +import ( + "io" + "log" +) + +// MustClose closes Closer c and calls log.Fatal if it returns a non-nil error. +func MustClose(c io.Closer) { + if err := c.Close(); err != nil { + log.Fatal(err) + } +} + +// MustWriter returns a Writer that wraps the provided Writer, +// except that it calls log.Fatal instead of returning a non-nil error. +func MustWriter(w io.Writer) io.Writer { + return mustWriter{w} +} + +type mustWriter struct { + w io.Writer +} + +func (w mustWriter) Write(b []byte) (int, error) { + n, err := w.w.Write(b) + if err != nil { + log.Fatal(err) + } + return n, nil +} + +func (w mustWriter) WriteString(s string) (int, error) { + n, err := io.WriteString(w.w, s) + if err != nil { + log.Fatal(err) + } + return n, nil +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/dwarf/dwarf.go b/vendor/github.com/twitchyliquid64/golang-asm/dwarf/dwarf.go new file mode 100644 index 00000000..2fee79d3 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/dwarf/dwarf.go @@ -0,0 +1,1650 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package dwarf generates DWARF debugging information. +// DWARF generation is split between the compiler and the linker, +// this package contains the shared code. +package dwarf + +import ( + "bytes" + "github.com/twitchyliquid64/golang-asm/objabi" + "errors" + "fmt" + "os/exec" + "sort" + "strconv" + "strings" +) + +// InfoPrefix is the prefix for all the symbols containing DWARF info entries. +const InfoPrefix = "go.info." + +// ConstInfoPrefix is the prefix for all symbols containing DWARF info +// entries that contain constants. +const ConstInfoPrefix = "go.constinfo." + +// CUInfoPrefix is the prefix for symbols containing information to +// populate the DWARF compilation unit info entries. +const CUInfoPrefix = "go.cuinfo." + +// Used to form the symbol name assigned to the DWARF 'abstract subprogram" +// info entry for a function +const AbstractFuncSuffix = "$abstract" + +// Controls logging/debugging for selected aspects of DWARF subprogram +// generation (functions, scopes). +var logDwarf bool + +// Sym represents a symbol. +type Sym interface { + Length(dwarfContext interface{}) int64 +} + +// A Var represents a local variable or a function parameter. +type Var struct { + Name string + Abbrev int // Either DW_ABRV_AUTO[_LOCLIST] or DW_ABRV_PARAM[_LOCLIST] + IsReturnValue bool + IsInlFormal bool + StackOffset int32 + // This package can't use the ssa package, so it can't mention ssa.FuncDebug, + // so indirect through a closure. + PutLocationList func(listSym, startPC Sym) + Scope int32 + Type Sym + DeclFile string + DeclLine uint + DeclCol uint + InlIndex int32 // subtract 1 to form real index into InlTree + ChildIndex int32 // child DIE index in abstract function + IsInAbstract bool // variable exists in abstract function +} + +// A Scope represents a lexical scope. All variables declared within a +// scope will only be visible to instructions covered by the scope. +// Lexical scopes are contiguous in source files but can end up being +// compiled to discontiguous blocks of instructions in the executable. +// The Ranges field lists all the blocks of instructions that belong +// in this scope. +type Scope struct { + Parent int32 + Ranges []Range + Vars []*Var +} + +// A Range represents a half-open interval [Start, End). +type Range struct { + Start, End int64 +} + +// This container is used by the PutFunc* variants below when +// creating the DWARF subprogram DIE(s) for a function. +type FnState struct { + Name string + Importpath string + Info Sym + Filesym Sym + Loc Sym + Ranges Sym + Absfn Sym + StartPC Sym + Size int64 + External bool + Scopes []Scope + InlCalls InlCalls + UseBASEntries bool +} + +func EnableLogging(doit bool) { + logDwarf = doit +} + +// UnifyRanges merges the list of ranges of c into the list of ranges of s +func (s *Scope) UnifyRanges(c *Scope) { + out := make([]Range, 0, len(s.Ranges)+len(c.Ranges)) + + i, j := 0, 0 + for { + var cur Range + if i < len(s.Ranges) && j < len(c.Ranges) { + if s.Ranges[i].Start < c.Ranges[j].Start { + cur = s.Ranges[i] + i++ + } else { + cur = c.Ranges[j] + j++ + } + } else if i < len(s.Ranges) { + cur = s.Ranges[i] + i++ + } else if j < len(c.Ranges) { + cur = c.Ranges[j] + j++ + } else { + break + } + + if n := len(out); n > 0 && cur.Start <= out[n-1].End { + out[n-1].End = cur.End + } else { + out = append(out, cur) + } + } + + s.Ranges = out +} + +// AppendRange adds r to s, if r is non-empty. +// If possible, it extends the last Range in s.Ranges; if not, it creates a new one. +func (s *Scope) AppendRange(r Range) { + if r.End <= r.Start { + return + } + i := len(s.Ranges) + if i > 0 && s.Ranges[i-1].End == r.Start { + s.Ranges[i-1].End = r.End + return + } + s.Ranges = append(s.Ranges, r) +} + +type InlCalls struct { + Calls []InlCall +} + +type InlCall struct { + // index into ctx.InlTree describing the call inlined here + InlIndex int + + // Symbol of file containing inlined call site (really *obj.LSym). + CallFile Sym + + // Line number of inlined call site. + CallLine uint32 + + // Dwarf abstract subroutine symbol (really *obj.LSym). + AbsFunSym Sym + + // Indices of child inlines within Calls array above. + Children []int + + // entries in this list are PAUTO's created by the inliner to + // capture the promoted formals and locals of the inlined callee. + InlVars []*Var + + // PC ranges for this inlined call. + Ranges []Range + + // Root call (not a child of some other call). + Root bool +} + +// A Context specifies how to add data to a Sym. +type Context interface { + PtrSize() int + AddInt(s Sym, size int, i int64) + AddBytes(s Sym, b []byte) + AddAddress(s Sym, t interface{}, ofs int64) + AddCURelativeAddress(s Sym, t interface{}, ofs int64) + AddSectionOffset(s Sym, size int, t interface{}, ofs int64) + AddDWARFAddrSectionOffset(s Sym, t interface{}, ofs int64) + CurrentOffset(s Sym) int64 + RecordDclReference(from Sym, to Sym, dclIdx int, inlIndex int) + RecordChildDieOffsets(s Sym, vars []*Var, offsets []int32) + AddString(s Sym, v string) + AddFileRef(s Sym, f interface{}) + Logf(format string, args ...interface{}) +} + +// AppendUleb128 appends v to b using DWARF's unsigned LEB128 encoding. +func AppendUleb128(b []byte, v uint64) []byte { + for { + c := uint8(v & 0x7f) + v >>= 7 + if v != 0 { + c |= 0x80 + } + b = append(b, c) + if c&0x80 == 0 { + break + } + } + return b +} + +// AppendSleb128 appends v to b using DWARF's signed LEB128 encoding. +func AppendSleb128(b []byte, v int64) []byte { + for { + c := uint8(v & 0x7f) + s := uint8(v & 0x40) + v >>= 7 + if (v != -1 || s == 0) && (v != 0 || s != 0) { + c |= 0x80 + } + b = append(b, c) + if c&0x80 == 0 { + break + } + } + return b +} + +// sevenbits contains all unsigned seven bit numbers, indexed by their value. +var sevenbits = [...]byte{ + 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, 0x0f, + 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, 0x1f, + 0x20, 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x27, 0x28, 0x29, 0x2a, 0x2b, 0x2c, 0x2d, 0x2e, 0x2f, + 0x30, 0x31, 0x32, 0x33, 0x34, 0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x3c, 0x3d, 0x3e, 0x3f, + 0x40, 0x41, 0x42, 0x43, 0x44, 0x45, 0x46, 0x47, 0x48, 0x49, 0x4a, 0x4b, 0x4c, 0x4d, 0x4e, 0x4f, + 0x50, 0x51, 0x52, 0x53, 0x54, 0x55, 0x56, 0x57, 0x58, 0x59, 0x5a, 0x5b, 0x5c, 0x5d, 0x5e, 0x5f, + 0x60, 0x61, 0x62, 0x63, 0x64, 0x65, 0x66, 0x67, 0x68, 0x69, 0x6a, 0x6b, 0x6c, 0x6d, 0x6e, 0x6f, + 0x70, 0x71, 0x72, 0x73, 0x74, 0x75, 0x76, 0x77, 0x78, 0x79, 0x7a, 0x7b, 0x7c, 0x7d, 0x7e, 0x7f, +} + +// sevenBitU returns the unsigned LEB128 encoding of v if v is seven bits and nil otherwise. +// The contents of the returned slice must not be modified. +func sevenBitU(v int64) []byte { + if uint64(v) < uint64(len(sevenbits)) { + return sevenbits[v : v+1] + } + return nil +} + +// sevenBitS returns the signed LEB128 encoding of v if v is seven bits and nil otherwise. +// The contents of the returned slice must not be modified. +func sevenBitS(v int64) []byte { + if uint64(v) <= 63 { + return sevenbits[v : v+1] + } + if uint64(-v) <= 64 { + return sevenbits[128+v : 128+v+1] + } + return nil +} + +// Uleb128put appends v to s using DWARF's unsigned LEB128 encoding. +func Uleb128put(ctxt Context, s Sym, v int64) { + b := sevenBitU(v) + if b == nil { + var encbuf [20]byte + b = AppendUleb128(encbuf[:0], uint64(v)) + } + ctxt.AddBytes(s, b) +} + +// Sleb128put appends v to s using DWARF's signed LEB128 encoding. +func Sleb128put(ctxt Context, s Sym, v int64) { + b := sevenBitS(v) + if b == nil { + var encbuf [20]byte + b = AppendSleb128(encbuf[:0], v) + } + ctxt.AddBytes(s, b) +} + +/* + * Defining Abbrevs. This is hardcoded on a per-platform basis (that is, + * each platform will see a fixed abbrev table for all objects); the number + * of abbrev entries is fairly small (compared to C++ objects). The DWARF + * spec places no restriction on the ordering of attributes in the + * Abbrevs and DIEs, and we will always write them out in the order + * of declaration in the abbrev. + */ +type dwAttrForm struct { + attr uint16 + form uint8 +} + +// Go-specific type attributes. +const ( + DW_AT_go_kind = 0x2900 + DW_AT_go_key = 0x2901 + DW_AT_go_elem = 0x2902 + // Attribute for DW_TAG_member of a struct type. + // Nonzero value indicates the struct field is an embedded field. + DW_AT_go_embedded_field = 0x2903 + DW_AT_go_runtime_type = 0x2904 + + DW_AT_go_package_name = 0x2905 // Attribute for DW_TAG_compile_unit + + DW_AT_internal_location = 253 // params and locals; not emitted +) + +// Index into the abbrevs table below. +// Keep in sync with ispubname() and ispubtype() in ld/dwarf.go. +// ispubtype considers >= NULLTYPE public +const ( + DW_ABRV_NULL = iota + DW_ABRV_COMPUNIT + DW_ABRV_COMPUNIT_TEXTLESS + DW_ABRV_FUNCTION + DW_ABRV_FUNCTION_ABSTRACT + DW_ABRV_FUNCTION_CONCRETE + DW_ABRV_INLINED_SUBROUTINE + DW_ABRV_INLINED_SUBROUTINE_RANGES + DW_ABRV_VARIABLE + DW_ABRV_INT_CONSTANT + DW_ABRV_AUTO + DW_ABRV_AUTO_LOCLIST + DW_ABRV_AUTO_ABSTRACT + DW_ABRV_AUTO_CONCRETE + DW_ABRV_AUTO_CONCRETE_LOCLIST + DW_ABRV_PARAM + DW_ABRV_PARAM_LOCLIST + DW_ABRV_PARAM_ABSTRACT + DW_ABRV_PARAM_CONCRETE + DW_ABRV_PARAM_CONCRETE_LOCLIST + DW_ABRV_LEXICAL_BLOCK_RANGES + DW_ABRV_LEXICAL_BLOCK_SIMPLE + DW_ABRV_STRUCTFIELD + DW_ABRV_FUNCTYPEPARAM + DW_ABRV_DOTDOTDOT + DW_ABRV_ARRAYRANGE + DW_ABRV_NULLTYPE + DW_ABRV_BASETYPE + DW_ABRV_ARRAYTYPE + DW_ABRV_CHANTYPE + DW_ABRV_FUNCTYPE + DW_ABRV_IFACETYPE + DW_ABRV_MAPTYPE + DW_ABRV_PTRTYPE + DW_ABRV_BARE_PTRTYPE // only for void*, no DW_AT_type attr to please gdb 6. + DW_ABRV_SLICETYPE + DW_ABRV_STRINGTYPE + DW_ABRV_STRUCTTYPE + DW_ABRV_TYPEDECL + DW_NABRV +) + +type dwAbbrev struct { + tag uint8 + children uint8 + attr []dwAttrForm +} + +var abbrevsFinalized bool + +// expandPseudoForm takes an input DW_FORM_xxx value and translates it +// into a platform-appropriate concrete form. Existing concrete/real +// DW_FORM values are left untouched. For the moment the only +// pseudo-form is DW_FORM_udata_pseudo, which gets expanded to +// DW_FORM_data4 on Darwin and DW_FORM_udata everywhere else. See +// issue #31459 for more context. +func expandPseudoForm(form uint8) uint8 { + // Is this a pseudo-form? + if form != DW_FORM_udata_pseudo { + return form + } + expandedForm := DW_FORM_udata + if objabi.GOOS == "darwin" { + expandedForm = DW_FORM_data4 + } + return uint8(expandedForm) +} + +// Abbrevs() returns the finalized abbrev array for the platform, +// expanding any DW_FORM pseudo-ops to real values. +func Abbrevs() []dwAbbrev { + if abbrevsFinalized { + return abbrevs[:] + } + for i := 1; i < DW_NABRV; i++ { + for j := 0; j < len(abbrevs[i].attr); j++ { + abbrevs[i].attr[j].form = expandPseudoForm(abbrevs[i].attr[j].form) + } + } + abbrevsFinalized = true + return abbrevs[:] +} + +// abbrevs is a raw table of abbrev entries; it needs to be post-processed +// by the Abbrevs() function above prior to being consumed, to expand +// the 'pseudo-form' entries below to real DWARF form values. + +var abbrevs = [DW_NABRV]dwAbbrev{ + /* The mandatory DW_ABRV_NULL entry. */ + {0, 0, []dwAttrForm{}}, + + /* COMPUNIT */ + { + DW_TAG_compile_unit, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_language, DW_FORM_data1}, + {DW_AT_stmt_list, DW_FORM_sec_offset}, + {DW_AT_low_pc, DW_FORM_addr}, + {DW_AT_ranges, DW_FORM_sec_offset}, + {DW_AT_comp_dir, DW_FORM_string}, + {DW_AT_producer, DW_FORM_string}, + {DW_AT_go_package_name, DW_FORM_string}, + }, + }, + + /* COMPUNIT_TEXTLESS */ + { + DW_TAG_compile_unit, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_language, DW_FORM_data1}, + {DW_AT_comp_dir, DW_FORM_string}, + {DW_AT_producer, DW_FORM_string}, + {DW_AT_go_package_name, DW_FORM_string}, + }, + }, + + /* FUNCTION */ + { + DW_TAG_subprogram, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_low_pc, DW_FORM_addr}, + {DW_AT_high_pc, DW_FORM_addr}, + {DW_AT_frame_base, DW_FORM_block1}, + {DW_AT_decl_file, DW_FORM_data4}, + {DW_AT_external, DW_FORM_flag}, + }, + }, + + /* FUNCTION_ABSTRACT */ + { + DW_TAG_subprogram, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_inline, DW_FORM_data1}, + {DW_AT_external, DW_FORM_flag}, + }, + }, + + /* FUNCTION_CONCRETE */ + { + DW_TAG_subprogram, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_abstract_origin, DW_FORM_ref_addr}, + {DW_AT_low_pc, DW_FORM_addr}, + {DW_AT_high_pc, DW_FORM_addr}, + {DW_AT_frame_base, DW_FORM_block1}, + }, + }, + + /* INLINED_SUBROUTINE */ + { + DW_TAG_inlined_subroutine, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_abstract_origin, DW_FORM_ref_addr}, + {DW_AT_low_pc, DW_FORM_addr}, + {DW_AT_high_pc, DW_FORM_addr}, + {DW_AT_call_file, DW_FORM_data4}, + {DW_AT_call_line, DW_FORM_udata_pseudo}, // pseudo-form + }, + }, + + /* INLINED_SUBROUTINE_RANGES */ + { + DW_TAG_inlined_subroutine, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_abstract_origin, DW_FORM_ref_addr}, + {DW_AT_ranges, DW_FORM_sec_offset}, + {DW_AT_call_file, DW_FORM_data4}, + {DW_AT_call_line, DW_FORM_udata_pseudo}, // pseudo-form + }, + }, + + /* VARIABLE */ + { + DW_TAG_variable, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_location, DW_FORM_block1}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_external, DW_FORM_flag}, + }, + }, + + /* INT CONSTANT */ + { + DW_TAG_constant, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_const_value, DW_FORM_sdata}, + }, + }, + + /* AUTO */ + { + DW_TAG_variable, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_decl_line, DW_FORM_udata}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_block1}, + }, + }, + + /* AUTO_LOCLIST */ + { + DW_TAG_variable, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_decl_line, DW_FORM_udata}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_sec_offset}, + }, + }, + + /* AUTO_ABSTRACT */ + { + DW_TAG_variable, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_decl_line, DW_FORM_udata}, + {DW_AT_type, DW_FORM_ref_addr}, + }, + }, + + /* AUTO_CONCRETE */ + { + DW_TAG_variable, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_abstract_origin, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_block1}, + }, + }, + + /* AUTO_CONCRETE_LOCLIST */ + { + DW_TAG_variable, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_abstract_origin, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_sec_offset}, + }, + }, + + /* PARAM */ + { + DW_TAG_formal_parameter, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_variable_parameter, DW_FORM_flag}, + {DW_AT_decl_line, DW_FORM_udata}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_block1}, + }, + }, + + /* PARAM_LOCLIST */ + { + DW_TAG_formal_parameter, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_variable_parameter, DW_FORM_flag}, + {DW_AT_decl_line, DW_FORM_udata}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_sec_offset}, + }, + }, + + /* PARAM_ABSTRACT */ + { + DW_TAG_formal_parameter, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_variable_parameter, DW_FORM_flag}, + {DW_AT_type, DW_FORM_ref_addr}, + }, + }, + + /* PARAM_CONCRETE */ + { + DW_TAG_formal_parameter, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_abstract_origin, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_block1}, + }, + }, + + /* PARAM_CONCRETE_LOCLIST */ + { + DW_TAG_formal_parameter, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_abstract_origin, DW_FORM_ref_addr}, + {DW_AT_location, DW_FORM_sec_offset}, + }, + }, + + /* LEXICAL_BLOCK_RANGES */ + { + DW_TAG_lexical_block, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_ranges, DW_FORM_sec_offset}, + }, + }, + + /* LEXICAL_BLOCK_SIMPLE */ + { + DW_TAG_lexical_block, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_low_pc, DW_FORM_addr}, + {DW_AT_high_pc, DW_FORM_addr}, + }, + }, + + /* STRUCTFIELD */ + { + DW_TAG_member, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_data_member_location, DW_FORM_udata}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_go_embedded_field, DW_FORM_flag}, + }, + }, + + /* FUNCTYPEPARAM */ + { + DW_TAG_formal_parameter, + DW_CHILDREN_no, + + // No name! + []dwAttrForm{ + {DW_AT_type, DW_FORM_ref_addr}, + }, + }, + + /* DOTDOTDOT */ + { + DW_TAG_unspecified_parameters, + DW_CHILDREN_no, + []dwAttrForm{}, + }, + + /* ARRAYRANGE */ + { + DW_TAG_subrange_type, + DW_CHILDREN_no, + + // No name! + []dwAttrForm{ + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_count, DW_FORM_udata}, + }, + }, + + // Below here are the types considered public by ispubtype + /* NULLTYPE */ + { + DW_TAG_unspecified_type, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + }, + }, + + /* BASETYPE */ + { + DW_TAG_base_type, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_encoding, DW_FORM_data1}, + {DW_AT_byte_size, DW_FORM_data1}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + }, + }, + + /* ARRAYTYPE */ + // child is subrange with upper bound + { + DW_TAG_array_type, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_byte_size, DW_FORM_udata}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + }, + }, + + /* CHANTYPE */ + { + DW_TAG_typedef, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + {DW_AT_go_elem, DW_FORM_ref_addr}, + }, + }, + + /* FUNCTYPE */ + { + DW_TAG_subroutine_type, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_byte_size, DW_FORM_udata}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + }, + }, + + /* IFACETYPE */ + { + DW_TAG_typedef, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + }, + }, + + /* MAPTYPE */ + { + DW_TAG_typedef, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + {DW_AT_go_key, DW_FORM_ref_addr}, + {DW_AT_go_elem, DW_FORM_ref_addr}, + }, + }, + + /* PTRTYPE */ + { + DW_TAG_pointer_type, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_type, DW_FORM_ref_addr}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + }, + }, + + /* BARE_PTRTYPE */ + { + DW_TAG_pointer_type, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + }, + }, + + /* SLICETYPE */ + { + DW_TAG_structure_type, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_byte_size, DW_FORM_udata}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + {DW_AT_go_elem, DW_FORM_ref_addr}, + }, + }, + + /* STRINGTYPE */ + { + DW_TAG_structure_type, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_byte_size, DW_FORM_udata}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + }, + }, + + /* STRUCTTYPE */ + { + DW_TAG_structure_type, + DW_CHILDREN_yes, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_byte_size, DW_FORM_udata}, + {DW_AT_go_kind, DW_FORM_data1}, + {DW_AT_go_runtime_type, DW_FORM_addr}, + }, + }, + + /* TYPEDECL */ + { + DW_TAG_typedef, + DW_CHILDREN_no, + []dwAttrForm{ + {DW_AT_name, DW_FORM_string}, + {DW_AT_type, DW_FORM_ref_addr}, + }, + }, +} + +// GetAbbrev returns the contents of the .debug_abbrev section. +func GetAbbrev() []byte { + abbrevs := Abbrevs() + var buf []byte + for i := 1; i < DW_NABRV; i++ { + // See section 7.5.3 + buf = AppendUleb128(buf, uint64(i)) + buf = AppendUleb128(buf, uint64(abbrevs[i].tag)) + buf = append(buf, abbrevs[i].children) + for _, f := range abbrevs[i].attr { + buf = AppendUleb128(buf, uint64(f.attr)) + buf = AppendUleb128(buf, uint64(f.form)) + } + buf = append(buf, 0, 0) + } + return append(buf, 0) +} + +/* + * Debugging Information Entries and their attributes. + */ + +// DWAttr represents an attribute of a DWDie. +// +// For DW_CLS_string and _block, value should contain the length, and +// data the data, for _reference, value is 0 and data is a DWDie* to +// the referenced instance, for all others, value is the whole thing +// and data is null. +type DWAttr struct { + Link *DWAttr + Atr uint16 // DW_AT_ + Cls uint8 // DW_CLS_ + Value int64 + Data interface{} +} + +// DWDie represents a DWARF debug info entry. +type DWDie struct { + Abbrev int + Link *DWDie + Child *DWDie + Attr *DWAttr + Sym Sym +} + +func putattr(ctxt Context, s Sym, abbrev int, form int, cls int, value int64, data interface{}) error { + switch form { + case DW_FORM_addr: // address + // Allow nil addresses for DW_AT_go_runtime_type. + if data == nil && value == 0 { + ctxt.AddInt(s, ctxt.PtrSize(), 0) + break + } + if cls == DW_CLS_GO_TYPEREF { + ctxt.AddSectionOffset(s, ctxt.PtrSize(), data, value) + break + } + ctxt.AddAddress(s, data, value) + + case DW_FORM_block1: // block + if cls == DW_CLS_ADDRESS { + ctxt.AddInt(s, 1, int64(1+ctxt.PtrSize())) + ctxt.AddInt(s, 1, DW_OP_addr) + ctxt.AddAddress(s, data, 0) + break + } + + value &= 0xff + ctxt.AddInt(s, 1, value) + p := data.([]byte)[:value] + ctxt.AddBytes(s, p) + + case DW_FORM_block2: // block + value &= 0xffff + + ctxt.AddInt(s, 2, value) + p := data.([]byte)[:value] + ctxt.AddBytes(s, p) + + case DW_FORM_block4: // block + value &= 0xffffffff + + ctxt.AddInt(s, 4, value) + p := data.([]byte)[:value] + ctxt.AddBytes(s, p) + + case DW_FORM_block: // block + Uleb128put(ctxt, s, value) + + p := data.([]byte)[:value] + ctxt.AddBytes(s, p) + + case DW_FORM_data1: // constant + ctxt.AddInt(s, 1, value) + + case DW_FORM_data2: // constant + ctxt.AddInt(s, 2, value) + + case DW_FORM_data4: // constant, {line,loclist,mac,rangelist}ptr + if cls == DW_CLS_PTR { // DW_AT_stmt_list and DW_AT_ranges + ctxt.AddDWARFAddrSectionOffset(s, data, value) + break + } + ctxt.AddInt(s, 4, value) + + case DW_FORM_data8: // constant, {line,loclist,mac,rangelist}ptr + ctxt.AddInt(s, 8, value) + + case DW_FORM_sdata: // constant + Sleb128put(ctxt, s, value) + + case DW_FORM_udata: // constant + Uleb128put(ctxt, s, value) + + case DW_FORM_string: // string + str := data.(string) + ctxt.AddString(s, str) + // TODO(ribrdb): verify padded strings are never used and remove this + for i := int64(len(str)); i < value; i++ { + ctxt.AddInt(s, 1, 0) + } + + case DW_FORM_flag: // flag + if value != 0 { + ctxt.AddInt(s, 1, 1) + } else { + ctxt.AddInt(s, 1, 0) + } + + // As of DWARF 3 the ref_addr is always 32 bits, unless emitting a large + // (> 4 GB of debug info aka "64-bit") unit, which we don't implement. + case DW_FORM_ref_addr: // reference to a DIE in the .info section + fallthrough + case DW_FORM_sec_offset: // offset into a DWARF section other than .info + if data == nil { + return fmt.Errorf("dwarf: null reference in %d", abbrev) + } + ctxt.AddDWARFAddrSectionOffset(s, data, value) + + case DW_FORM_ref1, // reference within the compilation unit + DW_FORM_ref2, // reference + DW_FORM_ref4, // reference + DW_FORM_ref8, // reference + DW_FORM_ref_udata, // reference + + DW_FORM_strp, // string + DW_FORM_indirect: // (see Section 7.5.3) + fallthrough + default: + return fmt.Errorf("dwarf: unsupported attribute form %d / class %d", form, cls) + } + return nil +} + +// PutAttrs writes the attributes for a DIE to symbol 's'. +// +// Note that we can (and do) add arbitrary attributes to a DIE, but +// only the ones actually listed in the Abbrev will be written out. +func PutAttrs(ctxt Context, s Sym, abbrev int, attr *DWAttr) { + abbrevs := Abbrevs() +Outer: + for _, f := range abbrevs[abbrev].attr { + for ap := attr; ap != nil; ap = ap.Link { + if ap.Atr == f.attr { + putattr(ctxt, s, abbrev, int(f.form), int(ap.Cls), ap.Value, ap.Data) + continue Outer + } + } + + putattr(ctxt, s, abbrev, int(f.form), 0, 0, nil) + } +} + +// HasChildren reports whether 'die' uses an abbrev that supports children. +func HasChildren(die *DWDie) bool { + abbrevs := Abbrevs() + return abbrevs[die.Abbrev].children != 0 +} + +// PutIntConst writes a DIE for an integer constant +func PutIntConst(ctxt Context, info, typ Sym, name string, val int64) { + Uleb128put(ctxt, info, DW_ABRV_INT_CONSTANT) + putattr(ctxt, info, DW_ABRV_INT_CONSTANT, DW_FORM_string, DW_CLS_STRING, int64(len(name)), name) + putattr(ctxt, info, DW_ABRV_INT_CONSTANT, DW_FORM_ref_addr, DW_CLS_REFERENCE, 0, typ) + putattr(ctxt, info, DW_ABRV_INT_CONSTANT, DW_FORM_sdata, DW_CLS_CONSTANT, val, nil) +} + +// PutBasedRanges writes a range table to sym. All addresses in ranges are +// relative to some base address, which must be arranged by the caller +// (e.g., with a DW_AT_low_pc attribute, or in a BASE-prefixed range). +func PutBasedRanges(ctxt Context, sym Sym, ranges []Range) { + ps := ctxt.PtrSize() + // Write ranges. + for _, r := range ranges { + ctxt.AddInt(sym, ps, r.Start) + ctxt.AddInt(sym, ps, r.End) + } + // Write trailer. + ctxt.AddInt(sym, ps, 0) + ctxt.AddInt(sym, ps, 0) +} + +// PutRanges writes a range table to s.Ranges. +// All addresses in ranges are relative to s.base. +func (s *FnState) PutRanges(ctxt Context, ranges []Range) { + ps := ctxt.PtrSize() + sym, base := s.Ranges, s.StartPC + + if s.UseBASEntries { + // Using a Base Address Selection Entry reduces the number of relocations, but + // this is not done on macOS because it is not supported by dsymutil/dwarfdump/lldb + ctxt.AddInt(sym, ps, -1) + ctxt.AddAddress(sym, base, 0) + PutBasedRanges(ctxt, sym, ranges) + return + } + + // Write ranges full of relocations + for _, r := range ranges { + ctxt.AddCURelativeAddress(sym, base, r.Start) + ctxt.AddCURelativeAddress(sym, base, r.End) + } + // Write trailer. + ctxt.AddInt(sym, ps, 0) + ctxt.AddInt(sym, ps, 0) +} + +// Return TRUE if the inlined call in the specified slot is empty, +// meaning it has a zero-length range (no instructions), and all +// of its children are empty. +func isEmptyInlinedCall(slot int, calls *InlCalls) bool { + ic := &calls.Calls[slot] + if ic.InlIndex == -2 { + return true + } + live := false + for _, k := range ic.Children { + if !isEmptyInlinedCall(k, calls) { + live = true + } + } + if len(ic.Ranges) > 0 { + live = true + } + if !live { + ic.InlIndex = -2 + } + return !live +} + +// Slot -1: return top-level inlines +// Slot >= 0: return children of that slot +func inlChildren(slot int, calls *InlCalls) []int { + var kids []int + if slot != -1 { + for _, k := range calls.Calls[slot].Children { + if !isEmptyInlinedCall(k, calls) { + kids = append(kids, k) + } + } + } else { + for k := 0; k < len(calls.Calls); k += 1 { + if calls.Calls[k].Root && !isEmptyInlinedCall(k, calls) { + kids = append(kids, k) + } + } + } + return kids +} + +func inlinedVarTable(inlcalls *InlCalls) map[*Var]bool { + vars := make(map[*Var]bool) + for _, ic := range inlcalls.Calls { + for _, v := range ic.InlVars { + vars[v] = true + } + } + return vars +} + +// The s.Scopes slice contains variables were originally part of the +// function being emitted, as well as variables that were imported +// from various callee functions during the inlining process. This +// function prunes out any variables from the latter category (since +// they will be emitted as part of DWARF inlined_subroutine DIEs) and +// then generates scopes for vars in the former category. +func putPrunedScopes(ctxt Context, s *FnState, fnabbrev int) error { + if len(s.Scopes) == 0 { + return nil + } + scopes := make([]Scope, len(s.Scopes), len(s.Scopes)) + pvars := inlinedVarTable(&s.InlCalls) + for k, s := range s.Scopes { + var pruned Scope = Scope{Parent: s.Parent, Ranges: s.Ranges} + for i := 0; i < len(s.Vars); i++ { + _, found := pvars[s.Vars[i]] + if !found { + pruned.Vars = append(pruned.Vars, s.Vars[i]) + } + } + sort.Sort(byChildIndex(pruned.Vars)) + scopes[k] = pruned + } + var encbuf [20]byte + if putscope(ctxt, s, scopes, 0, fnabbrev, encbuf[:0]) < int32(len(scopes)) { + return errors.New("multiple toplevel scopes") + } + return nil +} + +// Emit DWARF attributes and child DIEs for an 'abstract' subprogram. +// The abstract subprogram DIE for a function contains its +// location-independent attributes (name, type, etc). Other instances +// of the function (any inlined copy of it, or the single out-of-line +// 'concrete' instance) will contain a pointer back to this abstract +// DIE (as a space-saving measure, so that name/type etc doesn't have +// to be repeated for each inlined copy). +func PutAbstractFunc(ctxt Context, s *FnState) error { + + if logDwarf { + ctxt.Logf("PutAbstractFunc(%v)\n", s.Absfn) + } + + abbrev := DW_ABRV_FUNCTION_ABSTRACT + Uleb128put(ctxt, s.Absfn, int64(abbrev)) + + fullname := s.Name + if strings.HasPrefix(s.Name, "\"\".") { + // Generate a fully qualified name for the function in the + // abstract case. This is so as to avoid the need for the + // linker to process the DIE with patchDWARFName(); we can't + // allow the name attribute of an abstract subprogram DIE to + // be rewritten, since it would change the offsets of the + // child DIEs (which we're relying on in order for abstract + // origin references to work). + fullname = objabi.PathToPrefix(s.Importpath) + "." + s.Name[3:] + } + putattr(ctxt, s.Absfn, abbrev, DW_FORM_string, DW_CLS_STRING, int64(len(fullname)), fullname) + + // DW_AT_inlined value + putattr(ctxt, s.Absfn, abbrev, DW_FORM_data1, DW_CLS_CONSTANT, int64(DW_INL_inlined), nil) + + var ev int64 + if s.External { + ev = 1 + } + putattr(ctxt, s.Absfn, abbrev, DW_FORM_flag, DW_CLS_FLAG, ev, 0) + + // Child variables (may be empty) + var flattened []*Var + + // This slice will hold the offset in bytes for each child var DIE + // with respect to the start of the parent subprogram DIE. + var offsets []int32 + + // Scopes/vars + if len(s.Scopes) > 0 { + // For abstract subprogram DIEs we want to flatten out scope info: + // lexical scope DIEs contain range and/or hi/lo PC attributes, + // which we explicitly don't want for the abstract subprogram DIE. + pvars := inlinedVarTable(&s.InlCalls) + for _, scope := range s.Scopes { + for i := 0; i < len(scope.Vars); i++ { + _, found := pvars[scope.Vars[i]] + if found || !scope.Vars[i].IsInAbstract { + continue + } + flattened = append(flattened, scope.Vars[i]) + } + } + if len(flattened) > 0 { + sort.Sort(byChildIndex(flattened)) + + if logDwarf { + ctxt.Logf("putAbstractScope(%v): vars:", s.Info) + for i, v := range flattened { + ctxt.Logf(" %d:%s", i, v.Name) + } + ctxt.Logf("\n") + } + + // This slice will hold the offset in bytes for each child + // variable DIE with respect to the start of the parent + // subprogram DIE. + for _, v := range flattened { + offsets = append(offsets, int32(ctxt.CurrentOffset(s.Absfn))) + putAbstractVar(ctxt, s.Absfn, v) + } + } + } + ctxt.RecordChildDieOffsets(s.Absfn, flattened, offsets) + + Uleb128put(ctxt, s.Absfn, 0) + return nil +} + +// Emit DWARF attributes and child DIEs for an inlined subroutine. The +// first attribute of an inlined subroutine DIE is a reference back to +// its corresponding 'abstract' DIE (containing location-independent +// attributes such as name, type, etc). Inlined subroutine DIEs can +// have other inlined subroutine DIEs as children. +func PutInlinedFunc(ctxt Context, s *FnState, callersym Sym, callIdx int) error { + ic := s.InlCalls.Calls[callIdx] + callee := ic.AbsFunSym + + abbrev := DW_ABRV_INLINED_SUBROUTINE_RANGES + if len(ic.Ranges) == 1 { + abbrev = DW_ABRV_INLINED_SUBROUTINE + } + Uleb128put(ctxt, s.Info, int64(abbrev)) + + if logDwarf { + ctxt.Logf("PutInlinedFunc(caller=%v,callee=%v,abbrev=%d)\n", callersym, callee, abbrev) + } + + // Abstract origin. + putattr(ctxt, s.Info, abbrev, DW_FORM_ref_addr, DW_CLS_REFERENCE, 0, callee) + + if abbrev == DW_ABRV_INLINED_SUBROUTINE_RANGES { + putattr(ctxt, s.Info, abbrev, DW_FORM_sec_offset, DW_CLS_PTR, s.Ranges.Length(ctxt), s.Ranges) + s.PutRanges(ctxt, ic.Ranges) + } else { + st := ic.Ranges[0].Start + en := ic.Ranges[0].End + putattr(ctxt, s.Info, abbrev, DW_FORM_addr, DW_CLS_ADDRESS, st, s.StartPC) + putattr(ctxt, s.Info, abbrev, DW_FORM_addr, DW_CLS_ADDRESS, en, s.StartPC) + } + + // Emit call file, line attrs. + ctxt.AddFileRef(s.Info, ic.CallFile) + form := int(expandPseudoForm(DW_FORM_udata_pseudo)) + putattr(ctxt, s.Info, abbrev, form, DW_CLS_CONSTANT, int64(ic.CallLine), nil) + + // Variables associated with this inlined routine instance. + vars := ic.InlVars + sort.Sort(byChildIndex(vars)) + inlIndex := ic.InlIndex + var encbuf [20]byte + for _, v := range vars { + if !v.IsInAbstract { + continue + } + putvar(ctxt, s, v, callee, abbrev, inlIndex, encbuf[:0]) + } + + // Children of this inline. + for _, sib := range inlChildren(callIdx, &s.InlCalls) { + absfn := s.InlCalls.Calls[sib].AbsFunSym + err := PutInlinedFunc(ctxt, s, absfn, sib) + if err != nil { + return err + } + } + + Uleb128put(ctxt, s.Info, 0) + return nil +} + +// Emit DWARF attributes and child DIEs for a 'concrete' subprogram, +// meaning the out-of-line copy of a function that was inlined at some +// point during the compilation of its containing package. The first +// attribute for a concrete DIE is a reference to the 'abstract' DIE +// for the function (which holds location-independent attributes such +// as name, type), then the remainder of the attributes are specific +// to this instance (location, frame base, etc). +func PutConcreteFunc(ctxt Context, s *FnState) error { + if logDwarf { + ctxt.Logf("PutConcreteFunc(%v)\n", s.Info) + } + abbrev := DW_ABRV_FUNCTION_CONCRETE + Uleb128put(ctxt, s.Info, int64(abbrev)) + + // Abstract origin. + putattr(ctxt, s.Info, abbrev, DW_FORM_ref_addr, DW_CLS_REFERENCE, 0, s.Absfn) + + // Start/end PC. + putattr(ctxt, s.Info, abbrev, DW_FORM_addr, DW_CLS_ADDRESS, 0, s.StartPC) + putattr(ctxt, s.Info, abbrev, DW_FORM_addr, DW_CLS_ADDRESS, s.Size, s.StartPC) + + // cfa / frame base + putattr(ctxt, s.Info, abbrev, DW_FORM_block1, DW_CLS_BLOCK, 1, []byte{DW_OP_call_frame_cfa}) + + // Scopes + if err := putPrunedScopes(ctxt, s, abbrev); err != nil { + return err + } + + // Inlined subroutines. + for _, sib := range inlChildren(-1, &s.InlCalls) { + absfn := s.InlCalls.Calls[sib].AbsFunSym + err := PutInlinedFunc(ctxt, s, absfn, sib) + if err != nil { + return err + } + } + + Uleb128put(ctxt, s.Info, 0) + return nil +} + +// Emit DWARF attributes and child DIEs for a subprogram. Here +// 'default' implies that the function in question was not inlined +// when its containing package was compiled (hence there is no need to +// emit an abstract version for it to use as a base for inlined +// routine records). +func PutDefaultFunc(ctxt Context, s *FnState) error { + if logDwarf { + ctxt.Logf("PutDefaultFunc(%v)\n", s.Info) + } + abbrev := DW_ABRV_FUNCTION + Uleb128put(ctxt, s.Info, int64(abbrev)) + + // Expand '"".' to import path. + name := s.Name + if s.Importpath != "" { + name = strings.Replace(name, "\"\".", objabi.PathToPrefix(s.Importpath)+".", -1) + } + + putattr(ctxt, s.Info, DW_ABRV_FUNCTION, DW_FORM_string, DW_CLS_STRING, int64(len(name)), name) + putattr(ctxt, s.Info, abbrev, DW_FORM_addr, DW_CLS_ADDRESS, 0, s.StartPC) + putattr(ctxt, s.Info, abbrev, DW_FORM_addr, DW_CLS_ADDRESS, s.Size, s.StartPC) + putattr(ctxt, s.Info, abbrev, DW_FORM_block1, DW_CLS_BLOCK, 1, []byte{DW_OP_call_frame_cfa}) + ctxt.AddFileRef(s.Info, s.Filesym) + + var ev int64 + if s.External { + ev = 1 + } + putattr(ctxt, s.Info, abbrev, DW_FORM_flag, DW_CLS_FLAG, ev, 0) + + // Scopes + if err := putPrunedScopes(ctxt, s, abbrev); err != nil { + return err + } + + // Inlined subroutines. + for _, sib := range inlChildren(-1, &s.InlCalls) { + absfn := s.InlCalls.Calls[sib].AbsFunSym + err := PutInlinedFunc(ctxt, s, absfn, sib) + if err != nil { + return err + } + } + + Uleb128put(ctxt, s.Info, 0) + return nil +} + +func putscope(ctxt Context, s *FnState, scopes []Scope, curscope int32, fnabbrev int, encbuf []byte) int32 { + + if logDwarf { + ctxt.Logf("putscope(%v,%d): vars:", s.Info, curscope) + for i, v := range scopes[curscope].Vars { + ctxt.Logf(" %d:%d:%s", i, v.ChildIndex, v.Name) + } + ctxt.Logf("\n") + } + + for _, v := range scopes[curscope].Vars { + putvar(ctxt, s, v, s.Absfn, fnabbrev, -1, encbuf) + } + this := curscope + curscope++ + for curscope < int32(len(scopes)) { + scope := scopes[curscope] + if scope.Parent != this { + return curscope + } + + if len(scopes[curscope].Vars) == 0 { + curscope = putscope(ctxt, s, scopes, curscope, fnabbrev, encbuf) + continue + } + + if len(scope.Ranges) == 1 { + Uleb128put(ctxt, s.Info, DW_ABRV_LEXICAL_BLOCK_SIMPLE) + putattr(ctxt, s.Info, DW_ABRV_LEXICAL_BLOCK_SIMPLE, DW_FORM_addr, DW_CLS_ADDRESS, scope.Ranges[0].Start, s.StartPC) + putattr(ctxt, s.Info, DW_ABRV_LEXICAL_BLOCK_SIMPLE, DW_FORM_addr, DW_CLS_ADDRESS, scope.Ranges[0].End, s.StartPC) + } else { + Uleb128put(ctxt, s.Info, DW_ABRV_LEXICAL_BLOCK_RANGES) + putattr(ctxt, s.Info, DW_ABRV_LEXICAL_BLOCK_RANGES, DW_FORM_sec_offset, DW_CLS_PTR, s.Ranges.Length(ctxt), s.Ranges) + + s.PutRanges(ctxt, scope.Ranges) + } + + curscope = putscope(ctxt, s, scopes, curscope, fnabbrev, encbuf) + + Uleb128put(ctxt, s.Info, 0) + } + return curscope +} + +// Given a default var abbrev code, select corresponding concrete code. +func concreteVarAbbrev(varAbbrev int) int { + switch varAbbrev { + case DW_ABRV_AUTO: + return DW_ABRV_AUTO_CONCRETE + case DW_ABRV_PARAM: + return DW_ABRV_PARAM_CONCRETE + case DW_ABRV_AUTO_LOCLIST: + return DW_ABRV_AUTO_CONCRETE_LOCLIST + case DW_ABRV_PARAM_LOCLIST: + return DW_ABRV_PARAM_CONCRETE_LOCLIST + default: + panic("should never happen") + } +} + +// Pick the correct abbrev code for variable or parameter DIE. +func determineVarAbbrev(v *Var, fnabbrev int) (int, bool, bool) { + abbrev := v.Abbrev + + // If the variable was entirely optimized out, don't emit a location list; + // convert to an inline abbreviation and emit an empty location. + missing := false + switch { + case abbrev == DW_ABRV_AUTO_LOCLIST && v.PutLocationList == nil: + missing = true + abbrev = DW_ABRV_AUTO + case abbrev == DW_ABRV_PARAM_LOCLIST && v.PutLocationList == nil: + missing = true + abbrev = DW_ABRV_PARAM + } + + // Determine whether to use a concrete variable or regular variable DIE. + concrete := true + switch fnabbrev { + case DW_ABRV_FUNCTION: + concrete = false + break + case DW_ABRV_FUNCTION_CONCRETE: + // If we're emitting a concrete subprogram DIE and the variable + // in question is not part of the corresponding abstract function DIE, + // then use the default (non-concrete) abbrev for this param. + if !v.IsInAbstract { + concrete = false + } + case DW_ABRV_INLINED_SUBROUTINE, DW_ABRV_INLINED_SUBROUTINE_RANGES: + default: + panic("should never happen") + } + + // Select proper abbrev based on concrete/non-concrete + if concrete { + abbrev = concreteVarAbbrev(abbrev) + } + + return abbrev, missing, concrete +} + +func abbrevUsesLoclist(abbrev int) bool { + switch abbrev { + case DW_ABRV_AUTO_LOCLIST, DW_ABRV_AUTO_CONCRETE_LOCLIST, + DW_ABRV_PARAM_LOCLIST, DW_ABRV_PARAM_CONCRETE_LOCLIST: + return true + default: + return false + } +} + +// Emit DWARF attributes for a variable belonging to an 'abstract' subprogram. +func putAbstractVar(ctxt Context, info Sym, v *Var) { + // Remap abbrev + abbrev := v.Abbrev + switch abbrev { + case DW_ABRV_AUTO, DW_ABRV_AUTO_LOCLIST: + abbrev = DW_ABRV_AUTO_ABSTRACT + case DW_ABRV_PARAM, DW_ABRV_PARAM_LOCLIST: + abbrev = DW_ABRV_PARAM_ABSTRACT + } + + Uleb128put(ctxt, info, int64(abbrev)) + putattr(ctxt, info, abbrev, DW_FORM_string, DW_CLS_STRING, int64(len(v.Name)), v.Name) + + // Isreturn attribute if this is a param + if abbrev == DW_ABRV_PARAM_ABSTRACT { + var isReturn int64 + if v.IsReturnValue { + isReturn = 1 + } + putattr(ctxt, info, abbrev, DW_FORM_flag, DW_CLS_FLAG, isReturn, nil) + } + + // Line + if abbrev != DW_ABRV_PARAM_ABSTRACT { + // See issue 23374 for more on why decl line is skipped for abs params. + putattr(ctxt, info, abbrev, DW_FORM_udata, DW_CLS_CONSTANT, int64(v.DeclLine), nil) + } + + // Type + putattr(ctxt, info, abbrev, DW_FORM_ref_addr, DW_CLS_REFERENCE, 0, v.Type) + + // Var has no children => no terminator +} + +func putvar(ctxt Context, s *FnState, v *Var, absfn Sym, fnabbrev, inlIndex int, encbuf []byte) { + // Remap abbrev according to parent DIE abbrev + abbrev, missing, concrete := determineVarAbbrev(v, fnabbrev) + + Uleb128put(ctxt, s.Info, int64(abbrev)) + + // Abstract origin for concrete / inlined case + if concrete { + // Here we are making a reference to a child DIE of an abstract + // function subprogram DIE. The child DIE has no LSym, so instead + // after the call to 'putattr' below we make a call to register + // the child DIE reference. + putattr(ctxt, s.Info, abbrev, DW_FORM_ref_addr, DW_CLS_REFERENCE, 0, absfn) + ctxt.RecordDclReference(s.Info, absfn, int(v.ChildIndex), inlIndex) + } else { + // Var name, line for abstract and default cases + n := v.Name + putattr(ctxt, s.Info, abbrev, DW_FORM_string, DW_CLS_STRING, int64(len(n)), n) + if abbrev == DW_ABRV_PARAM || abbrev == DW_ABRV_PARAM_LOCLIST || abbrev == DW_ABRV_PARAM_ABSTRACT { + var isReturn int64 + if v.IsReturnValue { + isReturn = 1 + } + putattr(ctxt, s.Info, abbrev, DW_FORM_flag, DW_CLS_FLAG, isReturn, nil) + } + putattr(ctxt, s.Info, abbrev, DW_FORM_udata, DW_CLS_CONSTANT, int64(v.DeclLine), nil) + putattr(ctxt, s.Info, abbrev, DW_FORM_ref_addr, DW_CLS_REFERENCE, 0, v.Type) + } + + if abbrevUsesLoclist(abbrev) { + putattr(ctxt, s.Info, abbrev, DW_FORM_sec_offset, DW_CLS_PTR, s.Loc.Length(ctxt), s.Loc) + v.PutLocationList(s.Loc, s.StartPC) + } else { + loc := encbuf[:0] + switch { + case missing: + break // no location + case v.StackOffset == 0: + loc = append(loc, DW_OP_call_frame_cfa) + default: + loc = append(loc, DW_OP_fbreg) + loc = AppendSleb128(loc, int64(v.StackOffset)) + } + putattr(ctxt, s.Info, abbrev, DW_FORM_block1, DW_CLS_BLOCK, int64(len(loc)), loc) + } + + // Var has no children => no terminator +} + +// VarsByOffset attaches the methods of sort.Interface to []*Var, +// sorting in increasing StackOffset. +type VarsByOffset []*Var + +func (s VarsByOffset) Len() int { return len(s) } +func (s VarsByOffset) Less(i, j int) bool { return s[i].StackOffset < s[j].StackOffset } +func (s VarsByOffset) Swap(i, j int) { s[i], s[j] = s[j], s[i] } + +// byChildIndex implements sort.Interface for []*dwarf.Var by child index. +type byChildIndex []*Var + +func (s byChildIndex) Len() int { return len(s) } +func (s byChildIndex) Less(i, j int) bool { return s[i].ChildIndex < s[j].ChildIndex } +func (s byChildIndex) Swap(i, j int) { s[i], s[j] = s[j], s[i] } + +// IsDWARFEnabledOnAIX returns true if DWARF is possible on the +// current extld. +// AIX ld doesn't support DWARF with -bnoobjreorder with version +// prior to 7.2.2. +func IsDWARFEnabledOnAIXLd(extld string) (bool, error) { + out, err := exec.Command(extld, "-Wl,-V").CombinedOutput() + if err != nil { + // The normal output should display ld version and + // then fails because ".main" is not defined: + // ld: 0711-317 ERROR: Undefined symbol: .main + if !bytes.Contains(out, []byte("0711-317")) { + return false, fmt.Errorf("%s -Wl,-V failed: %v\n%s", extld, err, out) + } + } + // gcc -Wl,-V output should be: + // /usr/bin/ld: LD X.X.X(date) + // ... + out = bytes.TrimPrefix(out, []byte("/usr/bin/ld: LD ")) + vers := string(bytes.Split(out, []byte("("))[0]) + subvers := strings.Split(vers, ".") + if len(subvers) != 3 { + return false, fmt.Errorf("cannot parse %s -Wl,-V (%s): %v\n", extld, out, err) + } + if v, err := strconv.Atoi(subvers[0]); err != nil || v < 7 { + return false, nil + } else if v > 7 { + return true, nil + } + if v, err := strconv.Atoi(subvers[1]); err != nil || v < 2 { + return false, nil + } else if v > 2 { + return true, nil + } + if v, err := strconv.Atoi(subvers[2]); err != nil || v < 2 { + return false, nil + } + return true, nil +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/dwarf/dwarf_defs.go b/vendor/github.com/twitchyliquid64/golang-asm/dwarf/dwarf_defs.go new file mode 100644 index 00000000..e2716e50 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/dwarf/dwarf_defs.go @@ -0,0 +1,493 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package dwarf + +// Cut, pasted, tr-and-awk'ed from tables in +// http://dwarfstd.org/doc/Dwarf3.pdf + +// Table 18 +const ( + DW_TAG_array_type = 0x01 + DW_TAG_class_type = 0x02 + DW_TAG_entry_point = 0x03 + DW_TAG_enumeration_type = 0x04 + DW_TAG_formal_parameter = 0x05 + DW_TAG_imported_declaration = 0x08 + DW_TAG_label = 0x0a + DW_TAG_lexical_block = 0x0b + DW_TAG_member = 0x0d + DW_TAG_pointer_type = 0x0f + DW_TAG_reference_type = 0x10 + DW_TAG_compile_unit = 0x11 + DW_TAG_string_type = 0x12 + DW_TAG_structure_type = 0x13 + DW_TAG_subroutine_type = 0x15 + DW_TAG_typedef = 0x16 + DW_TAG_union_type = 0x17 + DW_TAG_unspecified_parameters = 0x18 + DW_TAG_variant = 0x19 + DW_TAG_common_block = 0x1a + DW_TAG_common_inclusion = 0x1b + DW_TAG_inheritance = 0x1c + DW_TAG_inlined_subroutine = 0x1d + DW_TAG_module = 0x1e + DW_TAG_ptr_to_member_type = 0x1f + DW_TAG_set_type = 0x20 + DW_TAG_subrange_type = 0x21 + DW_TAG_with_stmt = 0x22 + DW_TAG_access_declaration = 0x23 + DW_TAG_base_type = 0x24 + DW_TAG_catch_block = 0x25 + DW_TAG_const_type = 0x26 + DW_TAG_constant = 0x27 + DW_TAG_enumerator = 0x28 + DW_TAG_file_type = 0x29 + DW_TAG_friend = 0x2a + DW_TAG_namelist = 0x2b + DW_TAG_namelist_item = 0x2c + DW_TAG_packed_type = 0x2d + DW_TAG_subprogram = 0x2e + DW_TAG_template_type_parameter = 0x2f + DW_TAG_template_value_parameter = 0x30 + DW_TAG_thrown_type = 0x31 + DW_TAG_try_block = 0x32 + DW_TAG_variant_part = 0x33 + DW_TAG_variable = 0x34 + DW_TAG_volatile_type = 0x35 + // Dwarf3 + DW_TAG_dwarf_procedure = 0x36 + DW_TAG_restrict_type = 0x37 + DW_TAG_interface_type = 0x38 + DW_TAG_namespace = 0x39 + DW_TAG_imported_module = 0x3a + DW_TAG_unspecified_type = 0x3b + DW_TAG_partial_unit = 0x3c + DW_TAG_imported_unit = 0x3d + DW_TAG_condition = 0x3f + DW_TAG_shared_type = 0x40 + // Dwarf4 + DW_TAG_type_unit = 0x41 + DW_TAG_rvalue_reference_type = 0x42 + DW_TAG_template_alias = 0x43 + + // User defined + DW_TAG_lo_user = 0x4080 + DW_TAG_hi_user = 0xffff +) + +// Table 19 +const ( + DW_CHILDREN_no = 0x00 + DW_CHILDREN_yes = 0x01 +) + +// Not from the spec, but logically belongs here +const ( + DW_CLS_ADDRESS = 0x01 + iota + DW_CLS_BLOCK + DW_CLS_CONSTANT + DW_CLS_FLAG + DW_CLS_PTR // lineptr, loclistptr, macptr, rangelistptr + DW_CLS_REFERENCE + DW_CLS_ADDRLOC + DW_CLS_STRING + + // Go-specific internal hackery. + DW_CLS_GO_TYPEREF +) + +// Table 20 +const ( + DW_AT_sibling = 0x01 // reference + DW_AT_location = 0x02 // block, loclistptr + DW_AT_name = 0x03 // string + DW_AT_ordering = 0x09 // constant + DW_AT_byte_size = 0x0b // block, constant, reference + DW_AT_bit_offset = 0x0c // block, constant, reference + DW_AT_bit_size = 0x0d // block, constant, reference + DW_AT_stmt_list = 0x10 // lineptr + DW_AT_low_pc = 0x11 // address + DW_AT_high_pc = 0x12 // address + DW_AT_language = 0x13 // constant + DW_AT_discr = 0x15 // reference + DW_AT_discr_value = 0x16 // constant + DW_AT_visibility = 0x17 // constant + DW_AT_import = 0x18 // reference + DW_AT_string_length = 0x19 // block, loclistptr + DW_AT_common_reference = 0x1a // reference + DW_AT_comp_dir = 0x1b // string + DW_AT_const_value = 0x1c // block, constant, string + DW_AT_containing_type = 0x1d // reference + DW_AT_default_value = 0x1e // reference + DW_AT_inline = 0x20 // constant + DW_AT_is_optional = 0x21 // flag + DW_AT_lower_bound = 0x22 // block, constant, reference + DW_AT_producer = 0x25 // string + DW_AT_prototyped = 0x27 // flag + DW_AT_return_addr = 0x2a // block, loclistptr + DW_AT_start_scope = 0x2c // constant + DW_AT_bit_stride = 0x2e // constant + DW_AT_upper_bound = 0x2f // block, constant, reference + DW_AT_abstract_origin = 0x31 // reference + DW_AT_accessibility = 0x32 // constant + DW_AT_address_class = 0x33 // constant + DW_AT_artificial = 0x34 // flag + DW_AT_base_types = 0x35 // reference + DW_AT_calling_convention = 0x36 // constant + DW_AT_count = 0x37 // block, constant, reference + DW_AT_data_member_location = 0x38 // block, constant, loclistptr + DW_AT_decl_column = 0x39 // constant + DW_AT_decl_file = 0x3a // constant + DW_AT_decl_line = 0x3b // constant + DW_AT_declaration = 0x3c // flag + DW_AT_discr_list = 0x3d // block + DW_AT_encoding = 0x3e // constant + DW_AT_external = 0x3f // flag + DW_AT_frame_base = 0x40 // block, loclistptr + DW_AT_friend = 0x41 // reference + DW_AT_identifier_case = 0x42 // constant + DW_AT_macro_info = 0x43 // macptr + DW_AT_namelist_item = 0x44 // block + DW_AT_priority = 0x45 // reference + DW_AT_segment = 0x46 // block, loclistptr + DW_AT_specification = 0x47 // reference + DW_AT_static_link = 0x48 // block, loclistptr + DW_AT_type = 0x49 // reference + DW_AT_use_location = 0x4a // block, loclistptr + DW_AT_variable_parameter = 0x4b // flag + DW_AT_virtuality = 0x4c // constant + DW_AT_vtable_elem_location = 0x4d // block, loclistptr + // Dwarf3 + DW_AT_allocated = 0x4e // block, constant, reference + DW_AT_associated = 0x4f // block, constant, reference + DW_AT_data_location = 0x50 // block + DW_AT_byte_stride = 0x51 // block, constant, reference + DW_AT_entry_pc = 0x52 // address + DW_AT_use_UTF8 = 0x53 // flag + DW_AT_extension = 0x54 // reference + DW_AT_ranges = 0x55 // rangelistptr + DW_AT_trampoline = 0x56 // address, flag, reference, string + DW_AT_call_column = 0x57 // constant + DW_AT_call_file = 0x58 // constant + DW_AT_call_line = 0x59 // constant + DW_AT_description = 0x5a // string + DW_AT_binary_scale = 0x5b // constant + DW_AT_decimal_scale = 0x5c // constant + DW_AT_small = 0x5d // reference + DW_AT_decimal_sign = 0x5e // constant + DW_AT_digit_count = 0x5f // constant + DW_AT_picture_string = 0x60 // string + DW_AT_mutable = 0x61 // flag + DW_AT_threads_scaled = 0x62 // flag + DW_AT_explicit = 0x63 // flag + DW_AT_object_pointer = 0x64 // reference + DW_AT_endianity = 0x65 // constant + DW_AT_elemental = 0x66 // flag + DW_AT_pure = 0x67 // flag + DW_AT_recursive = 0x68 // flag + + DW_AT_lo_user = 0x2000 // --- + DW_AT_hi_user = 0x3fff // --- +) + +// Table 21 +const ( + DW_FORM_addr = 0x01 // address + DW_FORM_block2 = 0x03 // block + DW_FORM_block4 = 0x04 // block + DW_FORM_data2 = 0x05 // constant + DW_FORM_data4 = 0x06 // constant, lineptr, loclistptr, macptr, rangelistptr + DW_FORM_data8 = 0x07 // constant, lineptr, loclistptr, macptr, rangelistptr + DW_FORM_string = 0x08 // string + DW_FORM_block = 0x09 // block + DW_FORM_block1 = 0x0a // block + DW_FORM_data1 = 0x0b // constant + DW_FORM_flag = 0x0c // flag + DW_FORM_sdata = 0x0d // constant + DW_FORM_strp = 0x0e // string + DW_FORM_udata = 0x0f // constant + DW_FORM_ref_addr = 0x10 // reference + DW_FORM_ref1 = 0x11 // reference + DW_FORM_ref2 = 0x12 // reference + DW_FORM_ref4 = 0x13 // reference + DW_FORM_ref8 = 0x14 // reference + DW_FORM_ref_udata = 0x15 // reference + DW_FORM_indirect = 0x16 // (see Section 7.5.3) + // Dwarf4 + DW_FORM_sec_offset = 0x17 // lineptr, loclistptr, macptr, rangelistptr + DW_FORM_exprloc = 0x18 // exprloc + DW_FORM_flag_present = 0x19 // flag + DW_FORM_ref_sig8 = 0x20 // reference + // Pseudo-form: expanded to data4 on IOS, udata elsewhere. + DW_FORM_udata_pseudo = 0x99 +) + +// Table 24 (#operands, notes) +const ( + DW_OP_addr = 0x03 // 1 constant address (size target specific) + DW_OP_deref = 0x06 // 0 + DW_OP_const1u = 0x08 // 1 1-byte constant + DW_OP_const1s = 0x09 // 1 1-byte constant + DW_OP_const2u = 0x0a // 1 2-byte constant + DW_OP_const2s = 0x0b // 1 2-byte constant + DW_OP_const4u = 0x0c // 1 4-byte constant + DW_OP_const4s = 0x0d // 1 4-byte constant + DW_OP_const8u = 0x0e // 1 8-byte constant + DW_OP_const8s = 0x0f // 1 8-byte constant + DW_OP_constu = 0x10 // 1 ULEB128 constant + DW_OP_consts = 0x11 // 1 SLEB128 constant + DW_OP_dup = 0x12 // 0 + DW_OP_drop = 0x13 // 0 + DW_OP_over = 0x14 // 0 + DW_OP_pick = 0x15 // 1 1-byte stack index + DW_OP_swap = 0x16 // 0 + DW_OP_rot = 0x17 // 0 + DW_OP_xderef = 0x18 // 0 + DW_OP_abs = 0x19 // 0 + DW_OP_and = 0x1a // 0 + DW_OP_div = 0x1b // 0 + DW_OP_minus = 0x1c // 0 + DW_OP_mod = 0x1d // 0 + DW_OP_mul = 0x1e // 0 + DW_OP_neg = 0x1f // 0 + DW_OP_not = 0x20 // 0 + DW_OP_or = 0x21 // 0 + DW_OP_plus = 0x22 // 0 + DW_OP_plus_uconst = 0x23 // 1 ULEB128 addend + DW_OP_shl = 0x24 // 0 + DW_OP_shr = 0x25 // 0 + DW_OP_shra = 0x26 // 0 + DW_OP_xor = 0x27 // 0 + DW_OP_skip = 0x2f // 1 signed 2-byte constant + DW_OP_bra = 0x28 // 1 signed 2-byte constant + DW_OP_eq = 0x29 // 0 + DW_OP_ge = 0x2a // 0 + DW_OP_gt = 0x2b // 0 + DW_OP_le = 0x2c // 0 + DW_OP_lt = 0x2d // 0 + DW_OP_ne = 0x2e // 0 + DW_OP_lit0 = 0x30 // 0 ... + DW_OP_lit31 = 0x4f // 0 literals 0..31 = (DW_OP_lit0 + literal) + DW_OP_reg0 = 0x50 // 0 .. + DW_OP_reg31 = 0x6f // 0 reg 0..31 = (DW_OP_reg0 + regnum) + DW_OP_breg0 = 0x70 // 1 ... + DW_OP_breg31 = 0x8f // 1 SLEB128 offset base register 0..31 = (DW_OP_breg0 + regnum) + DW_OP_regx = 0x90 // 1 ULEB128 register + DW_OP_fbreg = 0x91 // 1 SLEB128 offset + DW_OP_bregx = 0x92 // 2 ULEB128 register followed by SLEB128 offset + DW_OP_piece = 0x93 // 1 ULEB128 size of piece addressed + DW_OP_deref_size = 0x94 // 1 1-byte size of data retrieved + DW_OP_xderef_size = 0x95 // 1 1-byte size of data retrieved + DW_OP_nop = 0x96 // 0 + DW_OP_push_object_address = 0x97 // 0 + DW_OP_call2 = 0x98 // 1 2-byte offset of DIE + DW_OP_call4 = 0x99 // 1 4-byte offset of DIE + DW_OP_call_ref = 0x9a // 1 4- or 8-byte offset of DIE + DW_OP_form_tls_address = 0x9b // 0 + DW_OP_call_frame_cfa = 0x9c // 0 + DW_OP_bit_piece = 0x9d // 2 + DW_OP_lo_user = 0xe0 + DW_OP_hi_user = 0xff +) + +// Table 25 +const ( + DW_ATE_address = 0x01 + DW_ATE_boolean = 0x02 + DW_ATE_complex_float = 0x03 + DW_ATE_float = 0x04 + DW_ATE_signed = 0x05 + DW_ATE_signed_char = 0x06 + DW_ATE_unsigned = 0x07 + DW_ATE_unsigned_char = 0x08 + DW_ATE_imaginary_float = 0x09 + DW_ATE_packed_decimal = 0x0a + DW_ATE_numeric_string = 0x0b + DW_ATE_edited = 0x0c + DW_ATE_signed_fixed = 0x0d + DW_ATE_unsigned_fixed = 0x0e + DW_ATE_decimal_float = 0x0f + DW_ATE_lo_user = 0x80 + DW_ATE_hi_user = 0xff +) + +// Table 26 +const ( + DW_DS_unsigned = 0x01 + DW_DS_leading_overpunch = 0x02 + DW_DS_trailing_overpunch = 0x03 + DW_DS_leading_separate = 0x04 + DW_DS_trailing_separate = 0x05 +) + +// Table 27 +const ( + DW_END_default = 0x00 + DW_END_big = 0x01 + DW_END_little = 0x02 + DW_END_lo_user = 0x40 + DW_END_hi_user = 0xff +) + +// Table 28 +const ( + DW_ACCESS_public = 0x01 + DW_ACCESS_protected = 0x02 + DW_ACCESS_private = 0x03 +) + +// Table 29 +const ( + DW_VIS_local = 0x01 + DW_VIS_exported = 0x02 + DW_VIS_qualified = 0x03 +) + +// Table 30 +const ( + DW_VIRTUALITY_none = 0x00 + DW_VIRTUALITY_virtual = 0x01 + DW_VIRTUALITY_pure_virtual = 0x02 +) + +// Table 31 +const ( + DW_LANG_C89 = 0x0001 + DW_LANG_C = 0x0002 + DW_LANG_Ada83 = 0x0003 + DW_LANG_C_plus_plus = 0x0004 + DW_LANG_Cobol74 = 0x0005 + DW_LANG_Cobol85 = 0x0006 + DW_LANG_Fortran77 = 0x0007 + DW_LANG_Fortran90 = 0x0008 + DW_LANG_Pascal83 = 0x0009 + DW_LANG_Modula2 = 0x000a + // Dwarf3 + DW_LANG_Java = 0x000b + DW_LANG_C99 = 0x000c + DW_LANG_Ada95 = 0x000d + DW_LANG_Fortran95 = 0x000e + DW_LANG_PLI = 0x000f + DW_LANG_ObjC = 0x0010 + DW_LANG_ObjC_plus_plus = 0x0011 + DW_LANG_UPC = 0x0012 + DW_LANG_D = 0x0013 + // Dwarf4 + DW_LANG_Python = 0x0014 + // Dwarf5 + DW_LANG_Go = 0x0016 + + DW_LANG_lo_user = 0x8000 + DW_LANG_hi_user = 0xffff +) + +// Table 32 +const ( + DW_ID_case_sensitive = 0x00 + DW_ID_up_case = 0x01 + DW_ID_down_case = 0x02 + DW_ID_case_insensitive = 0x03 +) + +// Table 33 +const ( + DW_CC_normal = 0x01 + DW_CC_program = 0x02 + DW_CC_nocall = 0x03 + DW_CC_lo_user = 0x40 + DW_CC_hi_user = 0xff +) + +// Table 34 +const ( + DW_INL_not_inlined = 0x00 + DW_INL_inlined = 0x01 + DW_INL_declared_not_inlined = 0x02 + DW_INL_declared_inlined = 0x03 +) + +// Table 35 +const ( + DW_ORD_row_major = 0x00 + DW_ORD_col_major = 0x01 +) + +// Table 36 +const ( + DW_DSC_label = 0x00 + DW_DSC_range = 0x01 +) + +// Table 37 +const ( + DW_LNS_copy = 0x01 + DW_LNS_advance_pc = 0x02 + DW_LNS_advance_line = 0x03 + DW_LNS_set_file = 0x04 + DW_LNS_set_column = 0x05 + DW_LNS_negate_stmt = 0x06 + DW_LNS_set_basic_block = 0x07 + DW_LNS_const_add_pc = 0x08 + DW_LNS_fixed_advance_pc = 0x09 + // Dwarf3 + DW_LNS_set_prologue_end = 0x0a + DW_LNS_set_epilogue_begin = 0x0b + DW_LNS_set_isa = 0x0c +) + +// Table 38 +const ( + DW_LNE_end_sequence = 0x01 + DW_LNE_set_address = 0x02 + DW_LNE_define_file = 0x03 + DW_LNE_lo_user = 0x80 + DW_LNE_hi_user = 0xff +) + +// Table 39 +const ( + DW_MACINFO_define = 0x01 + DW_MACINFO_undef = 0x02 + DW_MACINFO_start_file = 0x03 + DW_MACINFO_end_file = 0x04 + DW_MACINFO_vendor_ext = 0xff +) + +// Table 40. +const ( + // operand,... + DW_CFA_nop = 0x00 + DW_CFA_set_loc = 0x01 // address + DW_CFA_advance_loc1 = 0x02 // 1-byte delta + DW_CFA_advance_loc2 = 0x03 // 2-byte delta + DW_CFA_advance_loc4 = 0x04 // 4-byte delta + DW_CFA_offset_extended = 0x05 // ULEB128 register, ULEB128 offset + DW_CFA_restore_extended = 0x06 // ULEB128 register + DW_CFA_undefined = 0x07 // ULEB128 register + DW_CFA_same_value = 0x08 // ULEB128 register + DW_CFA_register = 0x09 // ULEB128 register, ULEB128 register + DW_CFA_remember_state = 0x0a + DW_CFA_restore_state = 0x0b + + DW_CFA_def_cfa = 0x0c // ULEB128 register, ULEB128 offset + DW_CFA_def_cfa_register = 0x0d // ULEB128 register + DW_CFA_def_cfa_offset = 0x0e // ULEB128 offset + DW_CFA_def_cfa_expression = 0x0f // BLOCK + DW_CFA_expression = 0x10 // ULEB128 register, BLOCK + DW_CFA_offset_extended_sf = 0x11 // ULEB128 register, SLEB128 offset + DW_CFA_def_cfa_sf = 0x12 // ULEB128 register, SLEB128 offset + DW_CFA_def_cfa_offset_sf = 0x13 // SLEB128 offset + DW_CFA_val_offset = 0x14 // ULEB128, ULEB128 + DW_CFA_val_offset_sf = 0x15 // ULEB128, SLEB128 + DW_CFA_val_expression = 0x16 // ULEB128, BLOCK + + DW_CFA_lo_user = 0x1c + DW_CFA_hi_user = 0x3f + + // Opcodes that take an addend operand. + DW_CFA_advance_loc = 0x1 << 6 // +delta + DW_CFA_offset = 0x2 << 6 // +register (ULEB128 offset) + DW_CFA_restore = 0x3 << 6 // +register +) diff --git a/vendor/github.com/twitchyliquid64/golang-asm/goobj/builtin.go b/vendor/github.com/twitchyliquid64/golang-asm/goobj/builtin.go new file mode 100644 index 00000000..e7d612ae --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/goobj/builtin.go @@ -0,0 +1,45 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package goobj + +// Builtin (compiler-generated) function references appear +// frequently. We assign special indices for them, so they +// don't need to be referenced by name. + +// NBuiltin returns the number of listed builtin +// symbols. +func NBuiltin() int { + return len(builtins) +} + +// BuiltinName returns the name and ABI of the i-th +// builtin symbol. +func BuiltinName(i int) (string, int) { + return builtins[i].name, builtins[i].abi +} + +// BuiltinIdx returns the index of the builtin with the +// given name and abi, or -1 if it is not a builtin. +func BuiltinIdx(name string, abi int) int { + i, ok := builtinMap[name] + if !ok { + return -1 + } + if builtins[i].abi != abi { + return -1 + } + return i +} + +//go:generate go run mkbuiltin.go + +var builtinMap map[string]int + +func init() { + builtinMap = make(map[string]int, len(builtins)) + for i, b := range builtins { + builtinMap[b.name] = i + } +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/goobj/builtinlist.go b/vendor/github.com/twitchyliquid64/golang-asm/goobj/builtinlist.go new file mode 100644 index 00000000..0cca7523 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/goobj/builtinlist.go @@ -0,0 +1,245 @@ +// Code generated by mkbuiltin.go. DO NOT EDIT. + +package goobj + +var builtins = [...]struct { + name string + abi int +}{ + {"runtime.newobject", 1}, + {"runtime.mallocgc", 1}, + {"runtime.panicdivide", 1}, + {"runtime.panicshift", 1}, + {"runtime.panicmakeslicelen", 1}, + {"runtime.panicmakeslicecap", 1}, + {"runtime.throwinit", 1}, + {"runtime.panicwrap", 1}, + {"runtime.gopanic", 1}, + {"runtime.gorecover", 1}, + {"runtime.goschedguarded", 1}, + {"runtime.goPanicIndex", 1}, + {"runtime.goPanicIndexU", 1}, + {"runtime.goPanicSliceAlen", 1}, + {"runtime.goPanicSliceAlenU", 1}, + {"runtime.goPanicSliceAcap", 1}, + {"runtime.goPanicSliceAcapU", 1}, + {"runtime.goPanicSliceB", 1}, + {"runtime.goPanicSliceBU", 1}, + {"runtime.goPanicSlice3Alen", 1}, + {"runtime.goPanicSlice3AlenU", 1}, + {"runtime.goPanicSlice3Acap", 1}, + {"runtime.goPanicSlice3AcapU", 1}, + {"runtime.goPanicSlice3B", 1}, + {"runtime.goPanicSlice3BU", 1}, + {"runtime.goPanicSlice3C", 1}, + {"runtime.goPanicSlice3CU", 1}, + {"runtime.printbool", 1}, + {"runtime.printfloat", 1}, + {"runtime.printint", 1}, + {"runtime.printhex", 1}, + {"runtime.printuint", 1}, + {"runtime.printcomplex", 1}, + {"runtime.printstring", 1}, + {"runtime.printpointer", 1}, + {"runtime.printiface", 1}, + {"runtime.printeface", 1}, + {"runtime.printslice", 1}, + {"runtime.printnl", 1}, + {"runtime.printsp", 1}, + {"runtime.printlock", 1}, + {"runtime.printunlock", 1}, + {"runtime.concatstring2", 1}, + {"runtime.concatstring3", 1}, + {"runtime.concatstring4", 1}, + {"runtime.concatstring5", 1}, + {"runtime.concatstrings", 1}, + {"runtime.cmpstring", 1}, + {"runtime.intstring", 1}, + {"runtime.slicebytetostring", 1}, + {"runtime.slicebytetostringtmp", 1}, + {"runtime.slicerunetostring", 1}, + {"runtime.stringtoslicebyte", 1}, + {"runtime.stringtoslicerune", 1}, + {"runtime.slicecopy", 1}, + {"runtime.slicestringcopy", 1}, + {"runtime.decoderune", 1}, + {"runtime.countrunes", 1}, + {"runtime.convI2I", 1}, + {"runtime.convT16", 1}, + {"runtime.convT32", 1}, + {"runtime.convT64", 1}, + {"runtime.convTstring", 1}, + {"runtime.convTslice", 1}, + {"runtime.convT2E", 1}, + {"runtime.convT2Enoptr", 1}, + {"runtime.convT2I", 1}, + {"runtime.convT2Inoptr", 1}, + {"runtime.assertE2I", 1}, + {"runtime.assertE2I2", 1}, + {"runtime.assertI2I", 1}, + {"runtime.assertI2I2", 1}, + {"runtime.panicdottypeE", 1}, + {"runtime.panicdottypeI", 1}, + {"runtime.panicnildottype", 1}, + {"runtime.ifaceeq", 1}, + {"runtime.efaceeq", 1}, + {"runtime.fastrand", 1}, + {"runtime.makemap64", 1}, + {"runtime.makemap", 1}, + {"runtime.makemap_small", 1}, + {"runtime.mapaccess1", 1}, + {"runtime.mapaccess1_fast32", 1}, + {"runtime.mapaccess1_fast64", 1}, + {"runtime.mapaccess1_faststr", 1}, + {"runtime.mapaccess1_fat", 1}, + {"runtime.mapaccess2", 1}, + {"runtime.mapaccess2_fast32", 1}, + {"runtime.mapaccess2_fast64", 1}, + {"runtime.mapaccess2_faststr", 1}, + {"runtime.mapaccess2_fat", 1}, + {"runtime.mapassign", 1}, + {"runtime.mapassign_fast32", 1}, + {"runtime.mapassign_fast32ptr", 1}, + {"runtime.mapassign_fast64", 1}, + {"runtime.mapassign_fast64ptr", 1}, + {"runtime.mapassign_faststr", 1}, + {"runtime.mapiterinit", 1}, + {"runtime.mapdelete", 1}, + {"runtime.mapdelete_fast32", 1}, + {"runtime.mapdelete_fast64", 1}, + {"runtime.mapdelete_faststr", 1}, + {"runtime.mapiternext", 1}, + {"runtime.mapclear", 1}, + {"runtime.makechan64", 1}, + {"runtime.makechan", 1}, + {"runtime.chanrecv1", 1}, + {"runtime.chanrecv2", 1}, + {"runtime.chansend1", 1}, + {"runtime.closechan", 1}, + {"runtime.writeBarrier", 0}, + {"runtime.typedmemmove", 1}, + {"runtime.typedmemclr", 1}, + {"runtime.typedslicecopy", 1}, + {"runtime.selectnbsend", 1}, + {"runtime.selectnbrecv", 1}, + {"runtime.selectnbrecv2", 1}, + {"runtime.selectsetpc", 1}, + {"runtime.selectgo", 1}, + {"runtime.block", 1}, + {"runtime.makeslice", 1}, + {"runtime.makeslice64", 1}, + {"runtime.makeslicecopy", 1}, + {"runtime.growslice", 1}, + {"runtime.memmove", 1}, + {"runtime.memclrNoHeapPointers", 1}, + {"runtime.memclrHasPointers", 1}, + {"runtime.memequal", 1}, + {"runtime.memequal0", 1}, + {"runtime.memequal8", 1}, + {"runtime.memequal16", 1}, + {"runtime.memequal32", 1}, + {"runtime.memequal64", 1}, + {"runtime.memequal128", 1}, + {"runtime.f32equal", 1}, + {"runtime.f64equal", 1}, + {"runtime.c64equal", 1}, + {"runtime.c128equal", 1}, + {"runtime.strequal", 1}, + {"runtime.interequal", 1}, + {"runtime.nilinterequal", 1}, + {"runtime.memhash", 1}, + {"runtime.memhash0", 1}, + {"runtime.memhash8", 1}, + {"runtime.memhash16", 1}, + {"runtime.memhash32", 1}, + {"runtime.memhash64", 1}, + {"runtime.memhash128", 1}, + {"runtime.f32hash", 1}, + {"runtime.f64hash", 1}, + {"runtime.c64hash", 1}, + {"runtime.c128hash", 1}, + {"runtime.strhash", 1}, + {"runtime.interhash", 1}, + {"runtime.nilinterhash", 1}, + {"runtime.int64div", 1}, + {"runtime.uint64div", 1}, + {"runtime.int64mod", 1}, + {"runtime.uint64mod", 1}, + {"runtime.float64toint64", 1}, + {"runtime.float64touint64", 1}, + {"runtime.float64touint32", 1}, + {"runtime.int64tofloat64", 1}, + {"runtime.uint64tofloat64", 1}, + {"runtime.uint32tofloat64", 1}, + {"runtime.complex128div", 1}, + {"runtime.racefuncenter", 1}, + {"runtime.racefuncenterfp", 1}, + {"runtime.racefuncexit", 1}, + {"runtime.raceread", 1}, + {"runtime.racewrite", 1}, + {"runtime.racereadrange", 1}, + {"runtime.racewriterange", 1}, + {"runtime.msanread", 1}, + {"runtime.msanwrite", 1}, + {"runtime.checkptrAlignment", 1}, + {"runtime.checkptrArithmetic", 1}, + {"runtime.libfuzzerTraceCmp1", 1}, + {"runtime.libfuzzerTraceCmp2", 1}, + {"runtime.libfuzzerTraceCmp4", 1}, + {"runtime.libfuzzerTraceCmp8", 1}, + {"runtime.libfuzzerTraceConstCmp1", 1}, + {"runtime.libfuzzerTraceConstCmp2", 1}, + {"runtime.libfuzzerTraceConstCmp4", 1}, + {"runtime.libfuzzerTraceConstCmp8", 1}, + {"runtime.x86HasPOPCNT", 0}, + {"runtime.x86HasSSE41", 0}, + {"runtime.x86HasFMA", 0}, + {"runtime.armHasVFPv4", 0}, + {"runtime.arm64HasATOMICS", 0}, + {"runtime.deferproc", 1}, + {"runtime.deferprocStack", 1}, + {"runtime.deferreturn", 1}, + {"runtime.newproc", 1}, + {"runtime.panicoverflow", 1}, + {"runtime.sigpanic", 1}, + {"runtime.gcWriteBarrier", 0}, + {"runtime.morestack", 0}, + {"runtime.morestackc", 0}, + {"runtime.morestack_noctxt", 0}, + {"type.int8", 0}, + {"type.*int8", 0}, + {"type.uint8", 0}, + {"type.*uint8", 0}, + {"type.int16", 0}, + {"type.*int16", 0}, + {"type.uint16", 0}, + {"type.*uint16", 0}, + {"type.int32", 0}, + {"type.*int32", 0}, + {"type.uint32", 0}, + {"type.*uint32", 0}, + {"type.int64", 0}, + {"type.*int64", 0}, + {"type.uint64", 0}, + {"type.*uint64", 0}, + {"type.float32", 0}, + {"type.*float32", 0}, + {"type.float64", 0}, + {"type.*float64", 0}, + {"type.complex64", 0}, + {"type.*complex64", 0}, + {"type.complex128", 0}, + {"type.*complex128", 0}, + {"type.unsafe.Pointer", 0}, + {"type.*unsafe.Pointer", 0}, + {"type.uintptr", 0}, + {"type.*uintptr", 0}, + {"type.bool", 0}, + {"type.*bool", 0}, + {"type.string", 0}, + {"type.*string", 0}, + {"type.error", 0}, + {"type.*error", 0}, + {"type.func(error) string", 0}, + {"type.*func(error) string", 0}, +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/goobj/funcinfo.go b/vendor/github.com/twitchyliquid64/golang-asm/goobj/funcinfo.go new file mode 100644 index 00000000..9e192330 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/goobj/funcinfo.go @@ -0,0 +1,233 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package goobj + +import ( + "bytes" + "github.com/twitchyliquid64/golang-asm/objabi" + "encoding/binary" +) + +// CUFileIndex is used to index the filenames that are stored in the +// per-package/per-CU FileList. +type CUFileIndex uint32 + +// FuncInfo is serialized as a symbol (aux symbol). The symbol data is +// the binary encoding of the struct below. +// +// TODO: make each pcdata a separate symbol? +type FuncInfo struct { + Args uint32 + Locals uint32 + FuncID objabi.FuncID + + Pcsp uint32 + Pcfile uint32 + Pcline uint32 + Pcinline uint32 + Pcdata []uint32 + PcdataEnd uint32 + Funcdataoff []uint32 + File []CUFileIndex + + InlTree []InlTreeNode +} + +func (a *FuncInfo) Write(w *bytes.Buffer) { + var b [4]byte + writeUint32 := func(x uint32) { + binary.LittleEndian.PutUint32(b[:], x) + w.Write(b[:]) + } + + writeUint32(a.Args) + writeUint32(a.Locals) + writeUint32(uint32(a.FuncID)) + + writeUint32(a.Pcsp) + writeUint32(a.Pcfile) + writeUint32(a.Pcline) + writeUint32(a.Pcinline) + writeUint32(uint32(len(a.Pcdata))) + for _, x := range a.Pcdata { + writeUint32(x) + } + writeUint32(a.PcdataEnd) + writeUint32(uint32(len(a.Funcdataoff))) + for _, x := range a.Funcdataoff { + writeUint32(x) + } + writeUint32(uint32(len(a.File))) + for _, f := range a.File { + writeUint32(uint32(f)) + } + writeUint32(uint32(len(a.InlTree))) + for i := range a.InlTree { + a.InlTree[i].Write(w) + } +} + +func (a *FuncInfo) Read(b []byte) { + readUint32 := func() uint32 { + x := binary.LittleEndian.Uint32(b) + b = b[4:] + return x + } + + a.Args = readUint32() + a.Locals = readUint32() + a.FuncID = objabi.FuncID(readUint32()) + + a.Pcsp = readUint32() + a.Pcfile = readUint32() + a.Pcline = readUint32() + a.Pcinline = readUint32() + pcdatalen := readUint32() + a.Pcdata = make([]uint32, pcdatalen) + for i := range a.Pcdata { + a.Pcdata[i] = readUint32() + } + a.PcdataEnd = readUint32() + funcdataofflen := readUint32() + a.Funcdataoff = make([]uint32, funcdataofflen) + for i := range a.Funcdataoff { + a.Funcdataoff[i] = readUint32() + } + filelen := readUint32() + a.File = make([]CUFileIndex, filelen) + for i := range a.File { + a.File[i] = CUFileIndex(readUint32()) + } + inltreelen := readUint32() + a.InlTree = make([]InlTreeNode, inltreelen) + for i := range a.InlTree { + b = a.InlTree[i].Read(b) + } +} + +// FuncInfoLengths is a cache containing a roadmap of offsets and +// lengths for things within a serialized FuncInfo. Each length field +// stores the number of items (e.g. files, inltree nodes, etc), and the +// corresponding "off" field stores the byte offset of the start of +// the items in question. +type FuncInfoLengths struct { + NumPcdata uint32 + PcdataOff uint32 + NumFuncdataoff uint32 + FuncdataoffOff uint32 + NumFile uint32 + FileOff uint32 + NumInlTree uint32 + InlTreeOff uint32 + Initialized bool +} + +func (*FuncInfo) ReadFuncInfoLengths(b []byte) FuncInfoLengths { + var result FuncInfoLengths + + const numpcdataOff = 28 + result.NumPcdata = binary.LittleEndian.Uint32(b[numpcdataOff:]) + result.PcdataOff = numpcdataOff + 4 + + numfuncdataoffOff := result.PcdataOff + 4*(result.NumPcdata+1) + result.NumFuncdataoff = binary.LittleEndian.Uint32(b[numfuncdataoffOff:]) + result.FuncdataoffOff = numfuncdataoffOff + 4 + + numfileOff := result.FuncdataoffOff + 4*result.NumFuncdataoff + result.NumFile = binary.LittleEndian.Uint32(b[numfileOff:]) + result.FileOff = numfileOff + 4 + + numinltreeOff := result.FileOff + 4*result.NumFile + result.NumInlTree = binary.LittleEndian.Uint32(b[numinltreeOff:]) + result.InlTreeOff = numinltreeOff + 4 + + result.Initialized = true + + return result +} + +func (*FuncInfo) ReadArgs(b []byte) uint32 { return binary.LittleEndian.Uint32(b) } + +func (*FuncInfo) ReadLocals(b []byte) uint32 { return binary.LittleEndian.Uint32(b[4:]) } + +func (*FuncInfo) ReadFuncID(b []byte) uint32 { return binary.LittleEndian.Uint32(b[8:]) } + +// return start and end offsets. +func (*FuncInfo) ReadPcsp(b []byte) (uint32, uint32) { + return binary.LittleEndian.Uint32(b[12:]), binary.LittleEndian.Uint32(b[16:]) +} + +// return start and end offsets. +func (*FuncInfo) ReadPcfile(b []byte) (uint32, uint32) { + return binary.LittleEndian.Uint32(b[16:]), binary.LittleEndian.Uint32(b[20:]) +} + +// return start and end offsets. +func (*FuncInfo) ReadPcline(b []byte) (uint32, uint32) { + return binary.LittleEndian.Uint32(b[20:]), binary.LittleEndian.Uint32(b[24:]) +} + +// return start and end offsets. +func (*FuncInfo) ReadPcinline(b []byte, pcdataoffset uint32) (uint32, uint32) { + return binary.LittleEndian.Uint32(b[24:]), binary.LittleEndian.Uint32(b[pcdataoffset:]) +} + +// return start and end offsets. +func (*FuncInfo) ReadPcdata(b []byte, pcdataoffset uint32, k uint32) (uint32, uint32) { + return binary.LittleEndian.Uint32(b[pcdataoffset+4*k:]), binary.LittleEndian.Uint32(b[pcdataoffset+4+4*k:]) +} + +func (*FuncInfo) ReadFuncdataoff(b []byte, funcdataofffoff uint32, k uint32) int64 { + return int64(binary.LittleEndian.Uint32(b[funcdataofffoff+4*k:])) +} + +func (*FuncInfo) ReadFile(b []byte, filesoff uint32, k uint32) CUFileIndex { + return CUFileIndex(binary.LittleEndian.Uint32(b[filesoff+4*k:])) +} + +func (*FuncInfo) ReadInlTree(b []byte, inltreeoff uint32, k uint32) InlTreeNode { + const inlTreeNodeSize = 4 * 6 + var result InlTreeNode + result.Read(b[inltreeoff+k*inlTreeNodeSize:]) + return result +} + +// InlTreeNode is the serialized form of FileInfo.InlTree. +type InlTreeNode struct { + Parent int32 + File CUFileIndex + Line int32 + Func SymRef + ParentPC int32 +} + +func (inl *InlTreeNode) Write(w *bytes.Buffer) { + var b [4]byte + writeUint32 := func(x uint32) { + binary.LittleEndian.PutUint32(b[:], x) + w.Write(b[:]) + } + writeUint32(uint32(inl.Parent)) + writeUint32(uint32(inl.File)) + writeUint32(uint32(inl.Line)) + writeUint32(inl.Func.PkgIdx) + writeUint32(inl.Func.SymIdx) + writeUint32(uint32(inl.ParentPC)) +} + +// Read an InlTreeNode from b, return the remaining bytes. +func (inl *InlTreeNode) Read(b []byte) []byte { + readUint32 := func() uint32 { + x := binary.LittleEndian.Uint32(b) + b = b[4:] + return x + } + inl.Parent = int32(readUint32()) + inl.File = CUFileIndex(readUint32()) + inl.Line = int32(readUint32()) + inl.Func = SymRef{readUint32(), readUint32()} + inl.ParentPC = int32(readUint32()) + return b +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/goobj/objfile.go b/vendor/github.com/twitchyliquid64/golang-asm/goobj/objfile.go new file mode 100644 index 00000000..3303549a --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/goobj/objfile.go @@ -0,0 +1,871 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This package defines the Go object file format, and provide "low-level" functions +// for reading and writing object files. + +// The object file is understood by the compiler, assembler, linker, and tools. They +// have "high level" code that operates on object files, handling application-specific +// logics, and use this package for the actual reading and writing. Specifically, the +// code below: +// +// - cmd/internal/obj/objfile.go (used by cmd/asm and cmd/compile) +// - cmd/internal/objfile/goobj.go (used cmd/nm, cmd/objdump) +// - cmd/link/internal/loader package (used by cmd/link) +// +// If the object file format changes, they may (or may not) need to change. + +package goobj + +import ( + "bytes" + "github.com/twitchyliquid64/golang-asm/bio" + "crypto/sha1" + "encoding/binary" + "errors" + "fmt" + "github.com/twitchyliquid64/golang-asm/unsafeheader" + "io" + "unsafe" +) + +// New object file format. +// +// Header struct { +// Magic [...]byte // "\x00go116ld" +// Fingerprint [8]byte +// Flags uint32 +// Offsets [...]uint32 // byte offset of each block below +// } +// +// Strings [...]struct { +// Data [...]byte +// } +// +// Autolib [...]struct { // imported packages (for file loading) +// Pkg string +// Fingerprint [8]byte +// } +// +// PkgIndex [...]string // referenced packages by index +// +// Files [...]string +// +// SymbolDefs [...]struct { +// Name string +// ABI uint16 +// Type uint8 +// Flag uint8 +// Flag2 uint8 +// Size uint32 +// } +// Hashed64Defs [...]struct { // short hashed (content-addressable) symbol definitions +// ... // same as SymbolDefs +// } +// HashedDefs [...]struct { // hashed (content-addressable) symbol definitions +// ... // same as SymbolDefs +// } +// NonPkgDefs [...]struct { // non-pkg symbol definitions +// ... // same as SymbolDefs +// } +// NonPkgRefs [...]struct { // non-pkg symbol references +// ... // same as SymbolDefs +// } +// +// RefFlags [...]struct { // referenced symbol flags +// Sym symRef +// Flag uint8 +// Flag2 uint8 +// } +// +// Hash64 [...][8]byte +// Hash [...][N]byte +// +// RelocIndex [...]uint32 // index to Relocs +// AuxIndex [...]uint32 // index to Aux +// DataIndex [...]uint32 // offset to Data +// +// Relocs [...]struct { +// Off int32 +// Size uint8 +// Type uint8 +// Add int64 +// Sym symRef +// } +// +// Aux [...]struct { +// Type uint8 +// Sym symRef +// } +// +// Data [...]byte +// Pcdata [...]byte +// +// // blocks only used by tools (objdump, nm) +// +// RefNames [...]struct { // referenced symbol names +// Sym symRef +// Name string +// // TODO: include ABI version as well? +// } +// +// string is encoded as is a uint32 length followed by a uint32 offset +// that points to the corresponding string bytes. +// +// symRef is struct { PkgIdx, SymIdx uint32 }. +// +// Slice type (e.g. []symRef) is encoded as a length prefix (uint32) +// followed by that number of elements. +// +// The types below correspond to the encoded data structure in the +// object file. + +// Symbol indexing. +// +// Each symbol is referenced with a pair of indices, { PkgIdx, SymIdx }, +// as the symRef struct above. +// +// PkgIdx is either a predeclared index (see PkgIdxNone below) or +// an index of an imported package. For the latter case, PkgIdx is the +// index of the package in the PkgIndex array. 0 is an invalid index. +// +// SymIdx is the index of the symbol in the given package. +// - If PkgIdx is PkgIdxSelf, SymIdx is the index of the symbol in the +// SymbolDefs array. +// - If PkgIdx is PkgIdxHashed64, SymIdx is the index of the symbol in the +// Hashed64Defs array. +// - If PkgIdx is PkgIdxHashed, SymIdx is the index of the symbol in the +// HashedDefs array. +// - If PkgIdx is PkgIdxNone, SymIdx is the index of the symbol in the +// NonPkgDefs array (could natually overflow to NonPkgRefs array). +// - Otherwise, SymIdx is the index of the symbol in some other package's +// SymbolDefs array. +// +// {0, 0} represents a nil symbol. Otherwise PkgIdx should not be 0. +// +// Hash contains the content hashes of content-addressable symbols, of +// which PkgIdx is PkgIdxHashed, in the same order of HashedDefs array. +// Hash64 is similar, for PkgIdxHashed64 symbols. +// +// RelocIndex, AuxIndex, and DataIndex contains indices/offsets to +// Relocs/Aux/Data blocks, one element per symbol, first for all the +// defined symbols, then all the defined hashed and non-package symbols, +// in the same order of SymbolDefs/Hashed64Defs/HashedDefs/NonPkgDefs +// arrays. For N total defined symbols, the array is of length N+1. The +// last element is the total number of relocations (aux symbols, data +// blocks, etc.). +// +// They can be accessed by index. For the i-th symbol, its relocations +// are the RelocIndex[i]-th (inclusive) to RelocIndex[i+1]-th (exclusive) +// elements in the Relocs array. Aux/Data are likewise. (The index is +// 0-based.) + +// Auxiliary symbols. +// +// Each symbol may (or may not) be associated with a number of auxiliary +// symbols. They are described in the Aux block. See Aux struct below. +// Currently a symbol's Gotype, FuncInfo, and associated DWARF symbols +// are auxiliary symbols. + +const stringRefSize = 8 // two uint32s + +type FingerprintType [8]byte + +func (fp FingerprintType) IsZero() bool { return fp == FingerprintType{} } + +// Package Index. +const ( + PkgIdxNone = (1<<31 - 1) - iota // Non-package symbols + PkgIdxHashed64 // Short hashed (content-addressable) symbols + PkgIdxHashed // Hashed (content-addressable) symbols + PkgIdxBuiltin // Predefined runtime symbols (ex: runtime.newobject) + PkgIdxSelf // Symbols defined in the current package + PkgIdxInvalid = 0 + // The index of other referenced packages starts from 1. +) + +// Blocks +const ( + BlkAutolib = iota + BlkPkgIdx + BlkFile + BlkSymdef + BlkHashed64def + BlkHasheddef + BlkNonpkgdef + BlkNonpkgref + BlkRefFlags + BlkHash64 + BlkHash + BlkRelocIdx + BlkAuxIdx + BlkDataIdx + BlkReloc + BlkAux + BlkData + BlkPcdata + BlkRefName + BlkEnd + NBlk +) + +// File header. +// TODO: probably no need to export this. +type Header struct { + Magic string + Fingerprint FingerprintType + Flags uint32 + Offsets [NBlk]uint32 +} + +const Magic = "\x00go116ld" + +func (h *Header) Write(w *Writer) { + w.RawString(h.Magic) + w.Bytes(h.Fingerprint[:]) + w.Uint32(h.Flags) + for _, x := range h.Offsets { + w.Uint32(x) + } +} + +func (h *Header) Read(r *Reader) error { + b := r.BytesAt(0, len(Magic)) + h.Magic = string(b) + if h.Magic != Magic { + return errors.New("wrong magic, not a Go object file") + } + off := uint32(len(h.Magic)) + copy(h.Fingerprint[:], r.BytesAt(off, len(h.Fingerprint))) + off += 8 + h.Flags = r.uint32At(off) + off += 4 + for i := range h.Offsets { + h.Offsets[i] = r.uint32At(off) + off += 4 + } + return nil +} + +func (h *Header) Size() int { + return len(h.Magic) + 4 + 4*len(h.Offsets) +} + +// Autolib +type ImportedPkg struct { + Pkg string + Fingerprint FingerprintType +} + +const importedPkgSize = stringRefSize + 8 + +func (p *ImportedPkg) Write(w *Writer) { + w.StringRef(p.Pkg) + w.Bytes(p.Fingerprint[:]) +} + +// Symbol definition. +// +// Serialized format: +// Sym struct { +// Name string +// ABI uint16 +// Type uint8 +// Flag uint8 +// Flag2 uint8 +// Siz uint32 +// Align uint32 +// } +type Sym [SymSize]byte + +const SymSize = stringRefSize + 2 + 1 + 1 + 1 + 4 + 4 + +const SymABIstatic = ^uint16(0) + +const ( + ObjFlagShared = 1 << iota // this object is built with -shared + ObjFlagNeedNameExpansion // the linker needs to expand `"".` to package path in symbol names + ObjFlagFromAssembly // object is from asm src, not go +) + +// Sym.Flag +const ( + SymFlagDupok = 1 << iota + SymFlagLocal + SymFlagTypelink + SymFlagLeaf + SymFlagNoSplit + SymFlagReflectMethod + SymFlagGoType + SymFlagTopFrame +) + +// Sym.Flag2 +const ( + SymFlagUsedInIface = 1 << iota + SymFlagItab +) + +// Returns the length of the name of the symbol. +func (s *Sym) NameLen(r *Reader) int { + return int(binary.LittleEndian.Uint32(s[:])) +} + +func (s *Sym) Name(r *Reader) string { + len := binary.LittleEndian.Uint32(s[:]) + off := binary.LittleEndian.Uint32(s[4:]) + return r.StringAt(off, len) +} + +func (s *Sym) ABI() uint16 { return binary.LittleEndian.Uint16(s[8:]) } +func (s *Sym) Type() uint8 { return s[10] } +func (s *Sym) Flag() uint8 { return s[11] } +func (s *Sym) Flag2() uint8 { return s[12] } +func (s *Sym) Siz() uint32 { return binary.LittleEndian.Uint32(s[13:]) } +func (s *Sym) Align() uint32 { return binary.LittleEndian.Uint32(s[17:]) } + +func (s *Sym) Dupok() bool { return s.Flag()&SymFlagDupok != 0 } +func (s *Sym) Local() bool { return s.Flag()&SymFlagLocal != 0 } +func (s *Sym) Typelink() bool { return s.Flag()&SymFlagTypelink != 0 } +func (s *Sym) Leaf() bool { return s.Flag()&SymFlagLeaf != 0 } +func (s *Sym) NoSplit() bool { return s.Flag()&SymFlagNoSplit != 0 } +func (s *Sym) ReflectMethod() bool { return s.Flag()&SymFlagReflectMethod != 0 } +func (s *Sym) IsGoType() bool { return s.Flag()&SymFlagGoType != 0 } +func (s *Sym) TopFrame() bool { return s.Flag()&SymFlagTopFrame != 0 } +func (s *Sym) UsedInIface() bool { return s.Flag2()&SymFlagUsedInIface != 0 } +func (s *Sym) IsItab() bool { return s.Flag2()&SymFlagItab != 0 } + +func (s *Sym) SetName(x string, w *Writer) { + binary.LittleEndian.PutUint32(s[:], uint32(len(x))) + binary.LittleEndian.PutUint32(s[4:], w.stringOff(x)) +} + +func (s *Sym) SetABI(x uint16) { binary.LittleEndian.PutUint16(s[8:], x) } +func (s *Sym) SetType(x uint8) { s[10] = x } +func (s *Sym) SetFlag(x uint8) { s[11] = x } +func (s *Sym) SetFlag2(x uint8) { s[12] = x } +func (s *Sym) SetSiz(x uint32) { binary.LittleEndian.PutUint32(s[13:], x) } +func (s *Sym) SetAlign(x uint32) { binary.LittleEndian.PutUint32(s[17:], x) } + +func (s *Sym) Write(w *Writer) { w.Bytes(s[:]) } + +// for testing +func (s *Sym) fromBytes(b []byte) { copy(s[:], b) } + +// Symbol reference. +type SymRef struct { + PkgIdx uint32 + SymIdx uint32 +} + +// Hash64 +type Hash64Type [Hash64Size]byte + +const Hash64Size = 8 + +// Hash +type HashType [HashSize]byte + +const HashSize = sha1.Size + +// Relocation. +// +// Serialized format: +// Reloc struct { +// Off int32 +// Siz uint8 +// Type uint8 +// Add int64 +// Sym SymRef +// } +type Reloc [RelocSize]byte + +const RelocSize = 4 + 1 + 1 + 8 + 8 + +func (r *Reloc) Off() int32 { return int32(binary.LittleEndian.Uint32(r[:])) } +func (r *Reloc) Siz() uint8 { return r[4] } +func (r *Reloc) Type() uint8 { return r[5] } +func (r *Reloc) Add() int64 { return int64(binary.LittleEndian.Uint64(r[6:])) } +func (r *Reloc) Sym() SymRef { + return SymRef{binary.LittleEndian.Uint32(r[14:]), binary.LittleEndian.Uint32(r[18:])} +} + +func (r *Reloc) SetOff(x int32) { binary.LittleEndian.PutUint32(r[:], uint32(x)) } +func (r *Reloc) SetSiz(x uint8) { r[4] = x } +func (r *Reloc) SetType(x uint8) { r[5] = x } +func (r *Reloc) SetAdd(x int64) { binary.LittleEndian.PutUint64(r[6:], uint64(x)) } +func (r *Reloc) SetSym(x SymRef) { + binary.LittleEndian.PutUint32(r[14:], x.PkgIdx) + binary.LittleEndian.PutUint32(r[18:], x.SymIdx) +} + +func (r *Reloc) Set(off int32, size uint8, typ uint8, add int64, sym SymRef) { + r.SetOff(off) + r.SetSiz(size) + r.SetType(typ) + r.SetAdd(add) + r.SetSym(sym) +} + +func (r *Reloc) Write(w *Writer) { w.Bytes(r[:]) } + +// for testing +func (r *Reloc) fromBytes(b []byte) { copy(r[:], b) } + +// Aux symbol info. +// +// Serialized format: +// Aux struct { +// Type uint8 +// Sym SymRef +// } +type Aux [AuxSize]byte + +const AuxSize = 1 + 8 + +// Aux Type +const ( + AuxGotype = iota + AuxFuncInfo + AuxFuncdata + AuxDwarfInfo + AuxDwarfLoc + AuxDwarfRanges + AuxDwarfLines + + // TODO: more. Pcdata? +) + +func (a *Aux) Type() uint8 { return a[0] } +func (a *Aux) Sym() SymRef { + return SymRef{binary.LittleEndian.Uint32(a[1:]), binary.LittleEndian.Uint32(a[5:])} +} + +func (a *Aux) SetType(x uint8) { a[0] = x } +func (a *Aux) SetSym(x SymRef) { + binary.LittleEndian.PutUint32(a[1:], x.PkgIdx) + binary.LittleEndian.PutUint32(a[5:], x.SymIdx) +} + +func (a *Aux) Write(w *Writer) { w.Bytes(a[:]) } + +// for testing +func (a *Aux) fromBytes(b []byte) { copy(a[:], b) } + +// Referenced symbol flags. +// +// Serialized format: +// RefFlags struct { +// Sym symRef +// Flag uint8 +// Flag2 uint8 +// } +type RefFlags [RefFlagsSize]byte + +const RefFlagsSize = 8 + 1 + 1 + +func (r *RefFlags) Sym() SymRef { + return SymRef{binary.LittleEndian.Uint32(r[:]), binary.LittleEndian.Uint32(r[4:])} +} +func (r *RefFlags) Flag() uint8 { return r[8] } +func (r *RefFlags) Flag2() uint8 { return r[9] } + +func (r *RefFlags) SetSym(x SymRef) { + binary.LittleEndian.PutUint32(r[:], x.PkgIdx) + binary.LittleEndian.PutUint32(r[4:], x.SymIdx) +} +func (r *RefFlags) SetFlag(x uint8) { r[8] = x } +func (r *RefFlags) SetFlag2(x uint8) { r[9] = x } + +func (r *RefFlags) Write(w *Writer) { w.Bytes(r[:]) } + +// Referenced symbol name. +// +// Serialized format: +// RefName struct { +// Sym symRef +// Name string +// } +type RefName [RefNameSize]byte + +const RefNameSize = 8 + stringRefSize + +func (n *RefName) Sym() SymRef { + return SymRef{binary.LittleEndian.Uint32(n[:]), binary.LittleEndian.Uint32(n[4:])} +} +func (n *RefName) Name(r *Reader) string { + len := binary.LittleEndian.Uint32(n[8:]) + off := binary.LittleEndian.Uint32(n[12:]) + return r.StringAt(off, len) +} + +func (n *RefName) SetSym(x SymRef) { + binary.LittleEndian.PutUint32(n[:], x.PkgIdx) + binary.LittleEndian.PutUint32(n[4:], x.SymIdx) +} +func (n *RefName) SetName(x string, w *Writer) { + binary.LittleEndian.PutUint32(n[8:], uint32(len(x))) + binary.LittleEndian.PutUint32(n[12:], w.stringOff(x)) +} + +func (n *RefName) Write(w *Writer) { w.Bytes(n[:]) } + +type Writer struct { + wr *bio.Writer + stringMap map[string]uint32 + off uint32 // running offset +} + +func NewWriter(wr *bio.Writer) *Writer { + return &Writer{wr: wr, stringMap: make(map[string]uint32)} +} + +func (w *Writer) AddString(s string) { + if _, ok := w.stringMap[s]; ok { + return + } + w.stringMap[s] = w.off + w.RawString(s) +} + +func (w *Writer) stringOff(s string) uint32 { + off, ok := w.stringMap[s] + if !ok { + panic(fmt.Sprintf("writeStringRef: string not added: %q", s)) + } + return off +} + +func (w *Writer) StringRef(s string) { + w.Uint32(uint32(len(s))) + w.Uint32(w.stringOff(s)) +} + +func (w *Writer) RawString(s string) { + w.wr.WriteString(s) + w.off += uint32(len(s)) +} + +func (w *Writer) Bytes(s []byte) { + w.wr.Write(s) + w.off += uint32(len(s)) +} + +func (w *Writer) Uint64(x uint64) { + var b [8]byte + binary.LittleEndian.PutUint64(b[:], x) + w.wr.Write(b[:]) + w.off += 8 +} + +func (w *Writer) Uint32(x uint32) { + var b [4]byte + binary.LittleEndian.PutUint32(b[:], x) + w.wr.Write(b[:]) + w.off += 4 +} + +func (w *Writer) Uint16(x uint16) { + var b [2]byte + binary.LittleEndian.PutUint16(b[:], x) + w.wr.Write(b[:]) + w.off += 2 +} + +func (w *Writer) Uint8(x uint8) { + w.wr.WriteByte(x) + w.off++ +} + +func (w *Writer) Offset() uint32 { + return w.off +} + +type Reader struct { + b []byte // mmapped bytes, if not nil + readonly bool // whether b is backed with read-only memory + + rd io.ReaderAt + start uint32 + h Header // keep block offsets +} + +func NewReaderFromBytes(b []byte, readonly bool) *Reader { + r := &Reader{b: b, readonly: readonly, rd: bytes.NewReader(b), start: 0} + err := r.h.Read(r) + if err != nil { + return nil + } + return r +} + +func (r *Reader) BytesAt(off uint32, len int) []byte { + if len == 0 { + return nil + } + end := int(off) + len + return r.b[int(off):end:end] +} + +func (r *Reader) uint64At(off uint32) uint64 { + b := r.BytesAt(off, 8) + return binary.LittleEndian.Uint64(b) +} + +func (r *Reader) int64At(off uint32) int64 { + return int64(r.uint64At(off)) +} + +func (r *Reader) uint32At(off uint32) uint32 { + b := r.BytesAt(off, 4) + return binary.LittleEndian.Uint32(b) +} + +func (r *Reader) int32At(off uint32) int32 { + return int32(r.uint32At(off)) +} + +func (r *Reader) uint16At(off uint32) uint16 { + b := r.BytesAt(off, 2) + return binary.LittleEndian.Uint16(b) +} + +func (r *Reader) uint8At(off uint32) uint8 { + b := r.BytesAt(off, 1) + return b[0] +} + +func (r *Reader) StringAt(off uint32, len uint32) string { + b := r.b[off : off+len] + if r.readonly { + return toString(b) // backed by RO memory, ok to make unsafe string + } + return string(b) +} + +func toString(b []byte) string { + if len(b) == 0 { + return "" + } + + var s string + hdr := (*unsafeheader.String)(unsafe.Pointer(&s)) + hdr.Data = unsafe.Pointer(&b[0]) + hdr.Len = len(b) + + return s +} + +func (r *Reader) StringRef(off uint32) string { + l := r.uint32At(off) + return r.StringAt(r.uint32At(off+4), l) +} + +func (r *Reader) Fingerprint() FingerprintType { + return r.h.Fingerprint +} + +func (r *Reader) Autolib() []ImportedPkg { + n := (r.h.Offsets[BlkAutolib+1] - r.h.Offsets[BlkAutolib]) / importedPkgSize + s := make([]ImportedPkg, n) + off := r.h.Offsets[BlkAutolib] + for i := range s { + s[i].Pkg = r.StringRef(off) + copy(s[i].Fingerprint[:], r.BytesAt(off+stringRefSize, len(s[i].Fingerprint))) + off += importedPkgSize + } + return s +} + +func (r *Reader) Pkglist() []string { + n := (r.h.Offsets[BlkPkgIdx+1] - r.h.Offsets[BlkPkgIdx]) / stringRefSize + s := make([]string, n) + off := r.h.Offsets[BlkPkgIdx] + for i := range s { + s[i] = r.StringRef(off) + off += stringRefSize + } + return s +} + +func (r *Reader) NPkg() int { + return int(r.h.Offsets[BlkPkgIdx+1]-r.h.Offsets[BlkPkgIdx]) / stringRefSize +} + +func (r *Reader) Pkg(i int) string { + off := r.h.Offsets[BlkPkgIdx] + uint32(i)*stringRefSize + return r.StringRef(off) +} + +func (r *Reader) NFile() int { + return int(r.h.Offsets[BlkFile+1]-r.h.Offsets[BlkFile]) / stringRefSize +} + +func (r *Reader) File(i int) string { + off := r.h.Offsets[BlkFile] + uint32(i)*stringRefSize + return r.StringRef(off) +} + +func (r *Reader) NSym() int { + return int(r.h.Offsets[BlkSymdef+1]-r.h.Offsets[BlkSymdef]) / SymSize +} + +func (r *Reader) NHashed64def() int { + return int(r.h.Offsets[BlkHashed64def+1]-r.h.Offsets[BlkHashed64def]) / SymSize +} + +func (r *Reader) NHasheddef() int { + return int(r.h.Offsets[BlkHasheddef+1]-r.h.Offsets[BlkHasheddef]) / SymSize +} + +func (r *Reader) NNonpkgdef() int { + return int(r.h.Offsets[BlkNonpkgdef+1]-r.h.Offsets[BlkNonpkgdef]) / SymSize +} + +func (r *Reader) NNonpkgref() int { + return int(r.h.Offsets[BlkNonpkgref+1]-r.h.Offsets[BlkNonpkgref]) / SymSize +} + +// SymOff returns the offset of the i-th symbol. +func (r *Reader) SymOff(i uint32) uint32 { + return r.h.Offsets[BlkSymdef] + uint32(i*SymSize) +} + +// Sym returns a pointer to the i-th symbol. +func (r *Reader) Sym(i uint32) *Sym { + off := r.SymOff(i) + return (*Sym)(unsafe.Pointer(&r.b[off])) +} + +// NRefFlags returns the number of referenced symbol flags. +func (r *Reader) NRefFlags() int { + return int(r.h.Offsets[BlkRefFlags+1]-r.h.Offsets[BlkRefFlags]) / RefFlagsSize +} + +// RefFlags returns a pointer to the i-th referenced symbol flags. +// Note: here i is not a local symbol index, just a counter. +func (r *Reader) RefFlags(i int) *RefFlags { + off := r.h.Offsets[BlkRefFlags] + uint32(i*RefFlagsSize) + return (*RefFlags)(unsafe.Pointer(&r.b[off])) +} + +// Hash64 returns the i-th short hashed symbol's hash. +// Note: here i is the index of short hashed symbols, not all symbols +// (unlike other accessors). +func (r *Reader) Hash64(i uint32) uint64 { + off := r.h.Offsets[BlkHash64] + uint32(i*Hash64Size) + return r.uint64At(off) +} + +// Hash returns a pointer to the i-th hashed symbol's hash. +// Note: here i is the index of hashed symbols, not all symbols +// (unlike other accessors). +func (r *Reader) Hash(i uint32) *HashType { + off := r.h.Offsets[BlkHash] + uint32(i*HashSize) + return (*HashType)(unsafe.Pointer(&r.b[off])) +} + +// NReloc returns the number of relocations of the i-th symbol. +func (r *Reader) NReloc(i uint32) int { + relocIdxOff := r.h.Offsets[BlkRelocIdx] + uint32(i*4) + return int(r.uint32At(relocIdxOff+4) - r.uint32At(relocIdxOff)) +} + +// RelocOff returns the offset of the j-th relocation of the i-th symbol. +func (r *Reader) RelocOff(i uint32, j int) uint32 { + relocIdxOff := r.h.Offsets[BlkRelocIdx] + uint32(i*4) + relocIdx := r.uint32At(relocIdxOff) + return r.h.Offsets[BlkReloc] + (relocIdx+uint32(j))*uint32(RelocSize) +} + +// Reloc returns a pointer to the j-th relocation of the i-th symbol. +func (r *Reader) Reloc(i uint32, j int) *Reloc { + off := r.RelocOff(i, j) + return (*Reloc)(unsafe.Pointer(&r.b[off])) +} + +// Relocs returns a pointer to the relocations of the i-th symbol. +func (r *Reader) Relocs(i uint32) []Reloc { + off := r.RelocOff(i, 0) + n := r.NReloc(i) + return (*[1 << 20]Reloc)(unsafe.Pointer(&r.b[off]))[:n:n] +} + +// NAux returns the number of aux symbols of the i-th symbol. +func (r *Reader) NAux(i uint32) int { + auxIdxOff := r.h.Offsets[BlkAuxIdx] + i*4 + return int(r.uint32At(auxIdxOff+4) - r.uint32At(auxIdxOff)) +} + +// AuxOff returns the offset of the j-th aux symbol of the i-th symbol. +func (r *Reader) AuxOff(i uint32, j int) uint32 { + auxIdxOff := r.h.Offsets[BlkAuxIdx] + i*4 + auxIdx := r.uint32At(auxIdxOff) + return r.h.Offsets[BlkAux] + (auxIdx+uint32(j))*uint32(AuxSize) +} + +// Aux returns a pointer to the j-th aux symbol of the i-th symbol. +func (r *Reader) Aux(i uint32, j int) *Aux { + off := r.AuxOff(i, j) + return (*Aux)(unsafe.Pointer(&r.b[off])) +} + +// Auxs returns the aux symbols of the i-th symbol. +func (r *Reader) Auxs(i uint32) []Aux { + off := r.AuxOff(i, 0) + n := r.NAux(i) + return (*[1 << 20]Aux)(unsafe.Pointer(&r.b[off]))[:n:n] +} + +// DataOff returns the offset of the i-th symbol's data. +func (r *Reader) DataOff(i uint32) uint32 { + dataIdxOff := r.h.Offsets[BlkDataIdx] + i*4 + return r.h.Offsets[BlkData] + r.uint32At(dataIdxOff) +} + +// DataSize returns the size of the i-th symbol's data. +func (r *Reader) DataSize(i uint32) int { + dataIdxOff := r.h.Offsets[BlkDataIdx] + i*4 + return int(r.uint32At(dataIdxOff+4) - r.uint32At(dataIdxOff)) +} + +// Data returns the i-th symbol's data. +func (r *Reader) Data(i uint32) []byte { + dataIdxOff := r.h.Offsets[BlkDataIdx] + i*4 + base := r.h.Offsets[BlkData] + off := r.uint32At(dataIdxOff) + end := r.uint32At(dataIdxOff + 4) + return r.BytesAt(base+off, int(end-off)) +} + +// AuxDataBase returns the base offset of the aux data block. +func (r *Reader) PcdataBase() uint32 { + return r.h.Offsets[BlkPcdata] +} + +// NRefName returns the number of referenced symbol names. +func (r *Reader) NRefName() int { + return int(r.h.Offsets[BlkRefName+1]-r.h.Offsets[BlkRefName]) / RefNameSize +} + +// RefName returns a pointer to the i-th referenced symbol name. +// Note: here i is not a local symbol index, just a counter. +func (r *Reader) RefName(i int) *RefName { + off := r.h.Offsets[BlkRefName] + uint32(i*RefNameSize) + return (*RefName)(unsafe.Pointer(&r.b[off])) +} + +// ReadOnly returns whether r.BytesAt returns read-only bytes. +func (r *Reader) ReadOnly() bool { + return r.readonly +} + +// Flags returns the flag bits read from the object file header. +func (r *Reader) Flags() uint32 { + return r.h.Flags +} + +func (r *Reader) Shared() bool { return r.Flags()&ObjFlagShared != 0 } +func (r *Reader) NeedNameExpansion() bool { return r.Flags()&ObjFlagNeedNameExpansion != 0 } +func (r *Reader) FromAssembly() bool { return r.Flags()&ObjFlagFromAssembly != 0 } diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/abi_string.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/abi_string.go new file mode 100644 index 00000000..a439da36 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/abi_string.go @@ -0,0 +1,16 @@ +// Code generated by "stringer -type ABI"; DO NOT EDIT. + +package obj + +import "strconv" + +const _ABI_name = "ABI0ABIInternalABICount" + +var _ABI_index = [...]uint8{0, 4, 15, 23} + +func (i ABI) String() string { + if i >= ABI(len(_ABI_index)-1) { + return "ABI(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _ABI_name[_ABI_index[i]:_ABI_index[i+1]] +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/addrtype_string.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/addrtype_string.go new file mode 100644 index 00000000..71f0dd97 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/addrtype_string.go @@ -0,0 +1,16 @@ +// Code generated by "stringer -type AddrType"; DO NOT EDIT. + +package obj + +import "strconv" + +const _AddrType_name = "TYPE_NONETYPE_BRANCHTYPE_TEXTSIZETYPE_MEMTYPE_CONSTTYPE_FCONSTTYPE_SCONSTTYPE_REGTYPE_ADDRTYPE_SHIFTTYPE_REGREGTYPE_REGREG2TYPE_INDIRTYPE_REGLIST" + +var _AddrType_index = [...]uint8{0, 9, 20, 33, 41, 51, 62, 73, 81, 90, 100, 111, 123, 133, 145} + +func (i AddrType) String() string { + if i >= AddrType(len(_AddrType_index)-1) { + return "AddrType(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _AddrType_name[_AddrType_index[i]:_AddrType_index[i+1]] +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/a.out.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/a.out.go new file mode 100644 index 00000000..8f8b8dbc --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/a.out.go @@ -0,0 +1,410 @@ +// Inferno utils/5c/5.out.h +// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/5c/5.out.h +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package arm + +import "github.com/twitchyliquid64/golang-asm/obj" + +//go:generate go run ../stringer.go -i $GOFILE -o anames.go -p arm + +const ( + NSNAME = 8 + NSYM = 50 + NREG = 16 +) + +/* -1 disables use of REGARG */ +const ( + REGARG = -1 +) + +const ( + REG_R0 = obj.RBaseARM + iota // must be 16-aligned + REG_R1 + REG_R2 + REG_R3 + REG_R4 + REG_R5 + REG_R6 + REG_R7 + REG_R8 + REG_R9 + REG_R10 + REG_R11 + REG_R12 + REG_R13 + REG_R14 + REG_R15 + + REG_F0 // must be 16-aligned + REG_F1 + REG_F2 + REG_F3 + REG_F4 + REG_F5 + REG_F6 + REG_F7 + REG_F8 + REG_F9 + REG_F10 + REG_F11 + REG_F12 + REG_F13 + REG_F14 + REG_F15 + + REG_FPSR // must be 2-aligned + REG_FPCR + + REG_CPSR // must be 2-aligned + REG_SPSR + + REGRET = REG_R0 + /* compiler allocates R1 up as temps */ + /* compiler allocates register variables R3 up */ + /* compiler allocates external registers R10 down */ + REGEXT = REG_R10 + /* these two registers are declared in runtime.h */ + REGG = REGEXT - 0 + REGM = REGEXT - 1 + + REGCTXT = REG_R7 + REGTMP = REG_R11 + REGSP = REG_R13 + REGLINK = REG_R14 + REGPC = REG_R15 + + NFREG = 16 + /* compiler allocates register variables F0 up */ + /* compiler allocates external registers F7 down */ + FREGRET = REG_F0 + FREGEXT = REG_F7 + FREGTMP = REG_F15 +) + +// http://infocenter.arm.com/help/topic/com.arm.doc.ihi0040b/IHI0040B_aadwarf.pdf +var ARMDWARFRegisters = map[int16]int16{} + +func init() { + // f assigns dwarfregisters[from:to] = (base):(step*(to-from)+base) + f := func(from, to, base, step int16) { + for r := int16(from); r <= to; r++ { + ARMDWARFRegisters[r] = step*(r-from) + base + } + } + f(REG_R0, REG_R15, 0, 1) + f(REG_F0, REG_F15, 64, 2) // Use d0 through D15, aka S0, S2, ..., S30 +} + +// Special registers, after subtracting obj.RBaseARM, bit 9 indicates +// a special register and the low bits select the register. +const ( + REG_SPECIAL = obj.RBaseARM + 1<<9 + iota + REG_MB_SY + REG_MB_ST + REG_MB_ISH + REG_MB_ISHST + REG_MB_NSH + REG_MB_NSHST + REG_MB_OSH + REG_MB_OSHST + + MAXREG +) + +const ( + C_NONE = iota + C_REG + C_REGREG + C_REGREG2 + C_REGLIST + C_SHIFT /* register shift R>>x */ + C_SHIFTADDR /* memory address with shifted offset R>>x(R) */ + C_FREG + C_PSR + C_FCR + C_SPR /* REG_MB_SY */ + + C_RCON /* 0xff rotated */ + C_NCON /* ~RCON */ + C_RCON2A /* OR of two disjoint C_RCON constants */ + C_RCON2S /* subtraction of two disjoint C_RCON constants */ + C_SCON /* 0xffff */ + C_LCON + C_LCONADDR + C_ZFCON + C_SFCON + C_LFCON + + C_RACON + C_LACON + + C_SBRA + C_LBRA + + C_HAUTO /* halfword insn offset (-0xff to 0xff) */ + C_FAUTO /* float insn offset (0 to 0x3fc, word aligned) */ + C_HFAUTO /* both H and F */ + C_SAUTO /* -0xfff to 0xfff */ + C_LAUTO + + C_HOREG + C_FOREG + C_HFOREG + C_SOREG + C_ROREG + C_SROREG /* both nil and R */ + C_LOREG + + C_PC + C_SP + C_HREG + + C_ADDR /* reference to relocatable address */ + + // TLS "var" in local exec mode: will become a constant offset from + // thread local base that is ultimately chosen by the program linker. + C_TLS_LE + + // TLS "var" in initial exec mode: will become a memory address (chosen + // by the program linker) that the dynamic linker will fill with the + // offset from the thread local base. + C_TLS_IE + + C_TEXTSIZE + + C_GOK + + C_NCLASS /* must be the last */ +) + +const ( + AAND = obj.ABaseARM + obj.A_ARCHSPECIFIC + iota + AEOR + ASUB + ARSB + AADD + AADC + ASBC + ARSC + ATST + ATEQ + ACMP + ACMN + AORR + ABIC + + AMVN + + /* + * Do not reorder or fragment the conditional branch + * opcodes, or the predication code will break + */ + ABEQ + ABNE + ABCS + ABHS + ABCC + ABLO + ABMI + ABPL + ABVS + ABVC + ABHI + ABLS + ABGE + ABLT + ABGT + ABLE + + AMOVWD + AMOVWF + AMOVDW + AMOVFW + AMOVFD + AMOVDF + AMOVF + AMOVD + + ACMPF + ACMPD + AADDF + AADDD + ASUBF + ASUBD + AMULF + AMULD + ANMULF + ANMULD + AMULAF + AMULAD + ANMULAF + ANMULAD + AMULSF + AMULSD + ANMULSF + ANMULSD + AFMULAF + AFMULAD + AFNMULAF + AFNMULAD + AFMULSF + AFMULSD + AFNMULSF + AFNMULSD + ADIVF + ADIVD + ASQRTF + ASQRTD + AABSF + AABSD + ANEGF + ANEGD + + ASRL + ASRA + ASLL + AMULU + ADIVU + AMUL + AMMUL + ADIV + AMOD + AMODU + ADIVHW + ADIVUHW + + AMOVB + AMOVBS + AMOVBU + AMOVH + AMOVHS + AMOVHU + AMOVW + AMOVM + ASWPBU + ASWPW + + ARFE + ASWI + AMULA + AMULS + AMMULA + AMMULS + + AWORD + + AMULL + AMULAL + AMULLU + AMULALU + + ABX + ABXRET + ADWORD + + ALDREX + ASTREX + ALDREXD + ASTREXD + + ADMB + + APLD + + ACLZ + AREV + AREV16 + AREVSH + ARBIT + + AXTAB + AXTAH + AXTABU + AXTAHU + + ABFX + ABFXU + ABFC + ABFI + + AMULWT + AMULWB + AMULBB + AMULAWT + AMULAWB + AMULABB + + AMRC // MRC/MCR + + ALAST + + // aliases + AB = obj.AJMP + ABL = obj.ACALL +) + +/* scond byte */ +const ( + C_SCOND = (1 << 4) - 1 + C_SBIT = 1 << 4 + C_PBIT = 1 << 5 + C_WBIT = 1 << 6 + C_FBIT = 1 << 7 /* psr flags-only */ + C_UBIT = 1 << 7 /* up bit, unsigned bit */ + + // These constants are the ARM condition codes encodings, + // XORed with 14 so that C_SCOND_NONE has value 0, + // so that a zeroed Prog.scond means "always execute". + C_SCOND_XOR = 14 + + C_SCOND_EQ = 0 ^ C_SCOND_XOR + C_SCOND_NE = 1 ^ C_SCOND_XOR + C_SCOND_HS = 2 ^ C_SCOND_XOR + C_SCOND_LO = 3 ^ C_SCOND_XOR + C_SCOND_MI = 4 ^ C_SCOND_XOR + C_SCOND_PL = 5 ^ C_SCOND_XOR + C_SCOND_VS = 6 ^ C_SCOND_XOR + C_SCOND_VC = 7 ^ C_SCOND_XOR + C_SCOND_HI = 8 ^ C_SCOND_XOR + C_SCOND_LS = 9 ^ C_SCOND_XOR + C_SCOND_GE = 10 ^ C_SCOND_XOR + C_SCOND_LT = 11 ^ C_SCOND_XOR + C_SCOND_GT = 12 ^ C_SCOND_XOR + C_SCOND_LE = 13 ^ C_SCOND_XOR + C_SCOND_NONE = 14 ^ C_SCOND_XOR + C_SCOND_NV = 15 ^ C_SCOND_XOR + + /* D_SHIFT type */ + SHIFT_LL = 0 << 5 + SHIFT_LR = 1 << 5 + SHIFT_AR = 2 << 5 + SHIFT_RR = 3 << 5 +) diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/anames.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/anames.go new file mode 100644 index 00000000..8a05133e --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/anames.go @@ -0,0 +1,144 @@ +// Code generated by stringer -i a.out.go -o anames.go -p arm; DO NOT EDIT. + +package arm + +import "github.com/twitchyliquid64/golang-asm/obj" + +var Anames = []string{ + obj.A_ARCHSPECIFIC: "AND", + "EOR", + "SUB", + "RSB", + "ADD", + "ADC", + "SBC", + "RSC", + "TST", + "TEQ", + "CMP", + "CMN", + "ORR", + "BIC", + "MVN", + "BEQ", + "BNE", + "BCS", + "BHS", + "BCC", + "BLO", + "BMI", + "BPL", + "BVS", + "BVC", + "BHI", + "BLS", + "BGE", + "BLT", + "BGT", + "BLE", + "MOVWD", + "MOVWF", + "MOVDW", + "MOVFW", + "MOVFD", + "MOVDF", + "MOVF", + "MOVD", + "CMPF", + "CMPD", + "ADDF", + "ADDD", + "SUBF", + "SUBD", + "MULF", + "MULD", + "NMULF", + "NMULD", + "MULAF", + "MULAD", + "NMULAF", + "NMULAD", + "MULSF", + "MULSD", + "NMULSF", + "NMULSD", + "FMULAF", + "FMULAD", + "FNMULAF", + "FNMULAD", + "FMULSF", + "FMULSD", + "FNMULSF", + "FNMULSD", + "DIVF", + "DIVD", + "SQRTF", + "SQRTD", + "ABSF", + "ABSD", + "NEGF", + "NEGD", + "SRL", + "SRA", + "SLL", + "MULU", + "DIVU", + "MUL", + "MMUL", + "DIV", + "MOD", + "MODU", + "DIVHW", + "DIVUHW", + "MOVB", + "MOVBS", + "MOVBU", + "MOVH", + "MOVHS", + "MOVHU", + "MOVW", + "MOVM", + "SWPBU", + "SWPW", + "RFE", + "SWI", + "MULA", + "MULS", + "MMULA", + "MMULS", + "WORD", + "MULL", + "MULAL", + "MULLU", + "MULALU", + "BX", + "BXRET", + "DWORD", + "LDREX", + "STREX", + "LDREXD", + "STREXD", + "DMB", + "PLD", + "CLZ", + "REV", + "REV16", + "REVSH", + "RBIT", + "XTAB", + "XTAH", + "XTABU", + "XTAHU", + "BFX", + "BFXU", + "BFC", + "BFI", + "MULWT", + "MULWB", + "MULBB", + "MULAWT", + "MULAWB", + "MULABB", + "MRC", + "LAST", +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/anames5.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/anames5.go new file mode 100644 index 00000000..78fcd55f --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/anames5.go @@ -0,0 +1,77 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package arm + +var cnames5 = []string{ + "NONE", + "REG", + "REGREG", + "REGREG2", + "REGLIST", + "SHIFT", + "SHIFTADDR", + "FREG", + "PSR", + "FCR", + "SPR", + "RCON", + "NCON", + "RCON2A", + "RCON2S", + "SCON", + "LCON", + "LCONADDR", + "ZFCON", + "SFCON", + "LFCON", + "RACON", + "LACON", + "SBRA", + "LBRA", + "HAUTO", + "FAUTO", + "HFAUTO", + "SAUTO", + "LAUTO", + "HOREG", + "FOREG", + "HFOREG", + "SOREG", + "ROREG", + "SROREG", + "LOREG", + "PC", + "SP", + "HREG", + "ADDR", + "C_TLS_LE", + "C_TLS_IE", + "TEXTSIZE", + "GOK", + "NCLASS", + "SCOND = (1<<4)-1", + "SBIT = 1<<4", + "PBIT = 1<<5", + "WBIT = 1<<6", + "FBIT = 1<<7", + "UBIT = 1<<7", + "SCOND_XOR = 14", + "SCOND_EQ = 0 ^ C_SCOND_XOR", + "SCOND_NE = 1 ^ C_SCOND_XOR", + "SCOND_HS = 2 ^ C_SCOND_XOR", + "SCOND_LO = 3 ^ C_SCOND_XOR", + "SCOND_MI = 4 ^ C_SCOND_XOR", + "SCOND_PL = 5 ^ C_SCOND_XOR", + "SCOND_VS = 6 ^ C_SCOND_XOR", + "SCOND_VC = 7 ^ C_SCOND_XOR", + "SCOND_HI = 8 ^ C_SCOND_XOR", + "SCOND_LS = 9 ^ C_SCOND_XOR", + "SCOND_GE = 10 ^ C_SCOND_XOR", + "SCOND_LT = 11 ^ C_SCOND_XOR", + "SCOND_GT = 12 ^ C_SCOND_XOR", + "SCOND_LE = 13 ^ C_SCOND_XOR", + "SCOND_NONE = 14 ^ C_SCOND_XOR", + "SCOND_NV = 15 ^ C_SCOND_XOR", +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/asm5.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/asm5.go new file mode 100644 index 00000000..924657fb --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/asm5.go @@ -0,0 +1,3096 @@ +// Inferno utils/5l/span.c +// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/5l/span.c +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package arm + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/objabi" + "fmt" + "log" + "math" + "sort" +) + +// ctxt5 holds state while assembling a single function. +// Each function gets a fresh ctxt5. +// This allows for multiple functions to be safely concurrently assembled. +type ctxt5 struct { + ctxt *obj.Link + newprog obj.ProgAlloc + cursym *obj.LSym + printp *obj.Prog + blitrl *obj.Prog + elitrl *obj.Prog + autosize int64 + instoffset int64 + pc int64 + pool struct { + start uint32 + size uint32 + extra uint32 + } +} + +type Optab struct { + as obj.As + a1 uint8 + a2 int8 + a3 uint8 + type_ uint8 + size int8 + param int16 + flag int8 + pcrelsiz uint8 + scond uint8 // optional flags accepted by the instruction +} + +type Opcross [32][2][32]uint8 + +const ( + LFROM = 1 << 0 + LTO = 1 << 1 + LPOOL = 1 << 2 + LPCREL = 1 << 3 +) + +var optab = []Optab{ + /* struct Optab: + OPCODE, from, prog->reg, to, type, size, param, flag, extra data size, optional suffix */ + {obj.ATEXT, C_ADDR, C_NONE, C_TEXTSIZE, 0, 0, 0, 0, 0, 0}, + {AADD, C_REG, C_REG, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {AADD, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {AAND, C_REG, C_REG, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {AAND, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {AORR, C_REG, C_REG, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {AORR, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {AMOVW, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {AMVN, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0, C_SBIT}, + {ACMP, C_REG, C_REG, C_NONE, 1, 4, 0, 0, 0, 0}, + {AADD, C_RCON, C_REG, C_REG, 2, 4, 0, 0, 0, C_SBIT}, + {AADD, C_RCON, C_NONE, C_REG, 2, 4, 0, 0, 0, C_SBIT}, + {AAND, C_RCON, C_REG, C_REG, 2, 4, 0, 0, 0, C_SBIT}, + {AAND, C_RCON, C_NONE, C_REG, 2, 4, 0, 0, 0, C_SBIT}, + {AORR, C_RCON, C_REG, C_REG, 2, 4, 0, 0, 0, C_SBIT}, + {AORR, C_RCON, C_NONE, C_REG, 2, 4, 0, 0, 0, C_SBIT}, + {AMOVW, C_RCON, C_NONE, C_REG, 2, 4, 0, 0, 0, 0}, + {AMVN, C_RCON, C_NONE, C_REG, 2, 4, 0, 0, 0, 0}, + {ACMP, C_RCON, C_REG, C_NONE, 2, 4, 0, 0, 0, 0}, + {AADD, C_SHIFT, C_REG, C_REG, 3, 4, 0, 0, 0, C_SBIT}, + {AADD, C_SHIFT, C_NONE, C_REG, 3, 4, 0, 0, 0, C_SBIT}, + {AAND, C_SHIFT, C_REG, C_REG, 3, 4, 0, 0, 0, C_SBIT}, + {AAND, C_SHIFT, C_NONE, C_REG, 3, 4, 0, 0, 0, C_SBIT}, + {AORR, C_SHIFT, C_REG, C_REG, 3, 4, 0, 0, 0, C_SBIT}, + {AORR, C_SHIFT, C_NONE, C_REG, 3, 4, 0, 0, 0, C_SBIT}, + {AMVN, C_SHIFT, C_NONE, C_REG, 3, 4, 0, 0, 0, C_SBIT}, + {ACMP, C_SHIFT, C_REG, C_NONE, 3, 4, 0, 0, 0, 0}, + {AMOVW, C_RACON, C_NONE, C_REG, 4, 4, REGSP, 0, 0, C_SBIT}, + {AB, C_NONE, C_NONE, C_SBRA, 5, 4, 0, LPOOL, 0, 0}, + {ABL, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0, 0}, + {ABX, C_NONE, C_NONE, C_SBRA, 74, 20, 0, 0, 0, 0}, + {ABEQ, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0, 0}, + {ABEQ, C_RCON, C_NONE, C_SBRA, 5, 4, 0, 0, 0, 0}, // prediction hinted form, hint ignored + {AB, C_NONE, C_NONE, C_ROREG, 6, 4, 0, LPOOL, 0, 0}, + {ABL, C_NONE, C_NONE, C_ROREG, 7, 4, 0, 0, 0, 0}, + {ABL, C_REG, C_NONE, C_ROREG, 7, 4, 0, 0, 0, 0}, + {ABX, C_NONE, C_NONE, C_ROREG, 75, 12, 0, 0, 0, 0}, + {ABXRET, C_NONE, C_NONE, C_ROREG, 76, 4, 0, 0, 0, 0}, + {ASLL, C_RCON, C_REG, C_REG, 8, 4, 0, 0, 0, C_SBIT}, + {ASLL, C_RCON, C_NONE, C_REG, 8, 4, 0, 0, 0, C_SBIT}, + {ASLL, C_REG, C_NONE, C_REG, 9, 4, 0, 0, 0, C_SBIT}, + {ASLL, C_REG, C_REG, C_REG, 9, 4, 0, 0, 0, C_SBIT}, + {ASWI, C_NONE, C_NONE, C_NONE, 10, 4, 0, 0, 0, 0}, + {ASWI, C_NONE, C_NONE, C_LCON, 10, 4, 0, 0, 0, 0}, + {AWORD, C_NONE, C_NONE, C_LCON, 11, 4, 0, 0, 0, 0}, + {AWORD, C_NONE, C_NONE, C_LCONADDR, 11, 4, 0, 0, 0, 0}, + {AWORD, C_NONE, C_NONE, C_ADDR, 11, 4, 0, 0, 0, 0}, + {AWORD, C_NONE, C_NONE, C_TLS_LE, 103, 4, 0, 0, 0, 0}, + {AWORD, C_NONE, C_NONE, C_TLS_IE, 104, 4, 0, 0, 0, 0}, + {AMOVW, C_NCON, C_NONE, C_REG, 12, 4, 0, 0, 0, 0}, + {AMOVW, C_SCON, C_NONE, C_REG, 12, 4, 0, 0, 0, 0}, + {AMOVW, C_LCON, C_NONE, C_REG, 12, 4, 0, LFROM, 0, 0}, + {AMOVW, C_LCONADDR, C_NONE, C_REG, 12, 4, 0, LFROM | LPCREL, 4, 0}, + {AMVN, C_NCON, C_NONE, C_REG, 12, 4, 0, 0, 0, 0}, + {AADD, C_NCON, C_REG, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AADD, C_NCON, C_NONE, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AAND, C_NCON, C_REG, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AAND, C_NCON, C_NONE, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AORR, C_NCON, C_REG, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AORR, C_NCON, C_NONE, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {ACMP, C_NCON, C_REG, C_NONE, 13, 8, 0, 0, 0, 0}, + {AADD, C_SCON, C_REG, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AADD, C_SCON, C_NONE, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AAND, C_SCON, C_REG, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AAND, C_SCON, C_NONE, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AORR, C_SCON, C_REG, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AORR, C_SCON, C_NONE, C_REG, 13, 8, 0, 0, 0, C_SBIT}, + {AMVN, C_SCON, C_NONE, C_REG, 13, 8, 0, 0, 0, 0}, + {ACMP, C_SCON, C_REG, C_NONE, 13, 8, 0, 0, 0, 0}, + {AADD, C_RCON2A, C_REG, C_REG, 106, 8, 0, 0, 0, 0}, + {AADD, C_RCON2A, C_NONE, C_REG, 106, 8, 0, 0, 0, 0}, + {AORR, C_RCON2A, C_REG, C_REG, 106, 8, 0, 0, 0, 0}, + {AORR, C_RCON2A, C_NONE, C_REG, 106, 8, 0, 0, 0, 0}, + {AADD, C_RCON2S, C_REG, C_REG, 107, 8, 0, 0, 0, 0}, + {AADD, C_RCON2S, C_NONE, C_REG, 107, 8, 0, 0, 0, 0}, + {AADD, C_LCON, C_REG, C_REG, 13, 8, 0, LFROM, 0, C_SBIT}, + {AADD, C_LCON, C_NONE, C_REG, 13, 8, 0, LFROM, 0, C_SBIT}, + {AAND, C_LCON, C_REG, C_REG, 13, 8, 0, LFROM, 0, C_SBIT}, + {AAND, C_LCON, C_NONE, C_REG, 13, 8, 0, LFROM, 0, C_SBIT}, + {AORR, C_LCON, C_REG, C_REG, 13, 8, 0, LFROM, 0, C_SBIT}, + {AORR, C_LCON, C_NONE, C_REG, 13, 8, 0, LFROM, 0, C_SBIT}, + {AMVN, C_LCON, C_NONE, C_REG, 13, 8, 0, LFROM, 0, 0}, + {ACMP, C_LCON, C_REG, C_NONE, 13, 8, 0, LFROM, 0, 0}, + {AMOVB, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0, 0}, + {AMOVBS, C_REG, C_NONE, C_REG, 14, 8, 0, 0, 0, 0}, + {AMOVBU, C_REG, C_NONE, C_REG, 58, 4, 0, 0, 0, 0}, + {AMOVH, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0, 0}, + {AMOVHS, C_REG, C_NONE, C_REG, 14, 8, 0, 0, 0, 0}, + {AMOVHU, C_REG, C_NONE, C_REG, 14, 8, 0, 0, 0, 0}, + {AMUL, C_REG, C_REG, C_REG, 15, 4, 0, 0, 0, C_SBIT}, + {AMUL, C_REG, C_NONE, C_REG, 15, 4, 0, 0, 0, C_SBIT}, + {ADIV, C_REG, C_REG, C_REG, 16, 4, 0, 0, 0, 0}, + {ADIV, C_REG, C_NONE, C_REG, 16, 4, 0, 0, 0, 0}, + {ADIVHW, C_REG, C_REG, C_REG, 105, 4, 0, 0, 0, 0}, + {ADIVHW, C_REG, C_NONE, C_REG, 105, 4, 0, 0, 0, 0}, + {AMULL, C_REG, C_REG, C_REGREG, 17, 4, 0, 0, 0, C_SBIT}, + {ABFX, C_LCON, C_REG, C_REG, 18, 4, 0, 0, 0, 0}, // width in From, LSB in From3 + {ABFX, C_LCON, C_NONE, C_REG, 18, 4, 0, 0, 0, 0}, // width in From, LSB in From3 + {AMOVW, C_REG, C_NONE, C_SAUTO, 20, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_REG, C_NONE, C_SOREG, 20, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_REG, C_NONE, C_SAUTO, 20, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_REG, C_NONE, C_SOREG, 20, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_REG, C_NONE, C_SAUTO, 20, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_REG, C_NONE, C_SOREG, 20, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_REG, C_NONE, C_SAUTO, 20, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_REG, C_NONE, C_SOREG, 20, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_SAUTO, C_NONE, C_REG, 21, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_SOREG, C_NONE, C_REG, 21, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_SAUTO, C_NONE, C_REG, 21, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_SOREG, C_NONE, C_REG, 21, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AXTAB, C_SHIFT, C_REG, C_REG, 22, 4, 0, 0, 0, 0}, + {AXTAB, C_SHIFT, C_NONE, C_REG, 22, 4, 0, 0, 0, 0}, + {AMOVW, C_SHIFT, C_NONE, C_REG, 23, 4, 0, 0, 0, C_SBIT}, + {AMOVB, C_SHIFT, C_NONE, C_REG, 23, 4, 0, 0, 0, 0}, + {AMOVBS, C_SHIFT, C_NONE, C_REG, 23, 4, 0, 0, 0, 0}, + {AMOVBU, C_SHIFT, C_NONE, C_REG, 23, 4, 0, 0, 0, 0}, + {AMOVH, C_SHIFT, C_NONE, C_REG, 23, 4, 0, 0, 0, 0}, + {AMOVHS, C_SHIFT, C_NONE, C_REG, 23, 4, 0, 0, 0, 0}, + {AMOVHU, C_SHIFT, C_NONE, C_REG, 23, 4, 0, 0, 0, 0}, + {AMOVW, C_REG, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_REG, C_NONE, C_LOREG, 30, 8, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_REG, C_NONE, C_ADDR, 64, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_REG, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_REG, C_NONE, C_LOREG, 30, 8, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_REG, C_NONE, C_ADDR, 64, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_REG, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_REG, C_NONE, C_LOREG, 30, 8, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_REG, C_NONE, C_ADDR, 64, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_REG, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_REG, C_NONE, C_LOREG, 30, 8, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_REG, C_NONE, C_ADDR, 64, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_TLS_LE, C_NONE, C_REG, 101, 4, 0, LFROM, 0, 0}, + {AMOVW, C_TLS_IE, C_NONE, C_REG, 102, 8, 0, LFROM, 0, 0}, + {AMOVW, C_LAUTO, C_NONE, C_REG, 31, 8, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_LOREG, C_NONE, C_REG, 31, 8, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_ADDR, C_NONE, C_REG, 65, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_LAUTO, C_NONE, C_REG, 31, 8, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_LOREG, C_NONE, C_REG, 31, 8, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_ADDR, C_NONE, C_REG, 65, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_LACON, C_NONE, C_REG, 34, 8, REGSP, LFROM, 0, C_SBIT}, + {AMOVW, C_PSR, C_NONE, C_REG, 35, 4, 0, 0, 0, 0}, + {AMOVW, C_REG, C_NONE, C_PSR, 36, 4, 0, 0, 0, 0}, + {AMOVW, C_RCON, C_NONE, C_PSR, 37, 4, 0, 0, 0, 0}, + {AMOVM, C_REGLIST, C_NONE, C_SOREG, 38, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVM, C_SOREG, C_NONE, C_REGLIST, 39, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {ASWPW, C_SOREG, C_REG, C_REG, 40, 4, 0, 0, 0, 0}, + {ARFE, C_NONE, C_NONE, C_NONE, 41, 4, 0, 0, 0, 0}, + {AMOVF, C_FREG, C_NONE, C_FAUTO, 50, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_FREG, C_NONE, C_FOREG, 50, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_FAUTO, C_NONE, C_FREG, 51, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_FOREG, C_NONE, C_FREG, 51, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_FREG, C_NONE, C_LAUTO, 52, 12, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_FREG, C_NONE, C_LOREG, 52, 12, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_LAUTO, C_NONE, C_FREG, 53, 12, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_LOREG, C_NONE, C_FREG, 53, 12, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_FREG, C_NONE, C_ADDR, 68, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVF, C_ADDR, C_NONE, C_FREG, 69, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AADDF, C_FREG, C_NONE, C_FREG, 54, 4, 0, 0, 0, 0}, + {AADDF, C_FREG, C_FREG, C_FREG, 54, 4, 0, 0, 0, 0}, + {AMOVF, C_FREG, C_NONE, C_FREG, 55, 4, 0, 0, 0, 0}, + {ANEGF, C_FREG, C_NONE, C_FREG, 55, 4, 0, 0, 0, 0}, + {AMOVW, C_REG, C_NONE, C_FCR, 56, 4, 0, 0, 0, 0}, + {AMOVW, C_FCR, C_NONE, C_REG, 57, 4, 0, 0, 0, 0}, + {AMOVW, C_SHIFTADDR, C_NONE, C_REG, 59, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_SHIFTADDR, C_NONE, C_REG, 59, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_SHIFTADDR, C_NONE, C_REG, 60, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_SHIFTADDR, C_NONE, C_REG, 60, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_SHIFTADDR, C_NONE, C_REG, 60, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_SHIFTADDR, C_NONE, C_REG, 60, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_SHIFTADDR, C_NONE, C_REG, 60, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVW, C_REG, C_NONE, C_SHIFTADDR, 61, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_REG, C_NONE, C_SHIFTADDR, 61, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_REG, C_NONE, C_SHIFTADDR, 61, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBU, C_REG, C_NONE, C_SHIFTADDR, 61, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_REG, C_NONE, C_SHIFTADDR, 62, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_REG, C_NONE, C_SHIFTADDR, 62, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_REG, C_NONE, C_SHIFTADDR, 62, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_REG, C_NONE, C_HAUTO, 70, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_REG, C_NONE, C_HOREG, 70, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_REG, C_NONE, C_HAUTO, 70, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_REG, C_NONE, C_HOREG, 70, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_REG, C_NONE, C_HAUTO, 70, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_REG, C_NONE, C_HOREG, 70, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_HAUTO, C_NONE, C_REG, 71, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_HOREG, C_NONE, C_REG, 71, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_HAUTO, C_NONE, C_REG, 71, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_HOREG, C_NONE, C_REG, 71, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_HAUTO, C_NONE, C_REG, 71, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_HOREG, C_NONE, C_REG, 71, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_HAUTO, C_NONE, C_REG, 71, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_HOREG, C_NONE, C_REG, 71, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_HAUTO, C_NONE, C_REG, 71, 4, REGSP, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_HOREG, C_NONE, C_REG, 71, 4, 0, 0, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_REG, C_NONE, C_LAUTO, 72, 8, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_REG, C_NONE, C_LOREG, 72, 8, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_REG, C_NONE, C_ADDR, 94, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_REG, C_NONE, C_LAUTO, 72, 8, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_REG, C_NONE, C_LOREG, 72, 8, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_REG, C_NONE, C_ADDR, 94, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_REG, C_NONE, C_LAUTO, 72, 8, REGSP, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_REG, C_NONE, C_LOREG, 72, 8, 0, LTO, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_REG, C_NONE, C_ADDR, 94, 8, 0, LTO | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_LAUTO, C_NONE, C_REG, 73, 8, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_LOREG, C_NONE, C_REG, 73, 8, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVB, C_ADDR, C_NONE, C_REG, 93, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_LAUTO, C_NONE, C_REG, 73, 8, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_LOREG, C_NONE, C_REG, 73, 8, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVBS, C_ADDR, C_NONE, C_REG, 93, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_LAUTO, C_NONE, C_REG, 73, 8, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_LOREG, C_NONE, C_REG, 73, 8, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVH, C_ADDR, C_NONE, C_REG, 93, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_LAUTO, C_NONE, C_REG, 73, 8, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_LOREG, C_NONE, C_REG, 73, 8, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHS, C_ADDR, C_NONE, C_REG, 93, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_LAUTO, C_NONE, C_REG, 73, 8, REGSP, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_LOREG, C_NONE, C_REG, 73, 8, 0, LFROM, 0, C_PBIT | C_WBIT | C_UBIT}, + {AMOVHU, C_ADDR, C_NONE, C_REG, 93, 8, 0, LFROM | LPCREL, 4, C_PBIT | C_WBIT | C_UBIT}, + {ALDREX, C_SOREG, C_NONE, C_REG, 77, 4, 0, 0, 0, 0}, + {ASTREX, C_SOREG, C_REG, C_REG, 78, 4, 0, 0, 0, 0}, + {ADMB, C_NONE, C_NONE, C_NONE, 110, 4, 0, 0, 0, 0}, + {ADMB, C_LCON, C_NONE, C_NONE, 110, 4, 0, 0, 0, 0}, + {ADMB, C_SPR, C_NONE, C_NONE, 110, 4, 0, 0, 0, 0}, + {AMOVF, C_ZFCON, C_NONE, C_FREG, 80, 8, 0, 0, 0, 0}, + {AMOVF, C_SFCON, C_NONE, C_FREG, 81, 4, 0, 0, 0, 0}, + {ACMPF, C_FREG, C_FREG, C_NONE, 82, 8, 0, 0, 0, 0}, + {ACMPF, C_FREG, C_NONE, C_NONE, 83, 8, 0, 0, 0, 0}, + {AMOVFW, C_FREG, C_NONE, C_FREG, 84, 4, 0, 0, 0, C_UBIT}, + {AMOVWF, C_FREG, C_NONE, C_FREG, 85, 4, 0, 0, 0, C_UBIT}, + {AMOVFW, C_FREG, C_NONE, C_REG, 86, 8, 0, 0, 0, C_UBIT}, + {AMOVWF, C_REG, C_NONE, C_FREG, 87, 8, 0, 0, 0, C_UBIT}, + {AMOVW, C_REG, C_NONE, C_FREG, 88, 4, 0, 0, 0, 0}, + {AMOVW, C_FREG, C_NONE, C_REG, 89, 4, 0, 0, 0, 0}, + {ALDREXD, C_SOREG, C_NONE, C_REG, 91, 4, 0, 0, 0, 0}, + {ASTREXD, C_SOREG, C_REG, C_REG, 92, 4, 0, 0, 0, 0}, + {APLD, C_SOREG, C_NONE, C_NONE, 95, 4, 0, 0, 0, 0}, + {obj.AUNDEF, C_NONE, C_NONE, C_NONE, 96, 4, 0, 0, 0, 0}, + {ACLZ, C_REG, C_NONE, C_REG, 97, 4, 0, 0, 0, 0}, + {AMULWT, C_REG, C_REG, C_REG, 98, 4, 0, 0, 0, 0}, + {AMULA, C_REG, C_REG, C_REGREG2, 99, 4, 0, 0, 0, C_SBIT}, + {AMULAWT, C_REG, C_REG, C_REGREG2, 99, 4, 0, 0, 0, 0}, + {obj.APCDATA, C_LCON, C_NONE, C_LCON, 0, 0, 0, 0, 0, 0}, + {obj.AFUNCDATA, C_LCON, C_NONE, C_ADDR, 0, 0, 0, 0, 0, 0}, + {obj.ANOP, C_NONE, C_NONE, C_NONE, 0, 0, 0, 0, 0, 0}, + {obj.ANOP, C_LCON, C_NONE, C_NONE, 0, 0, 0, 0, 0, 0}, // nop variants, see #40689 + {obj.ANOP, C_REG, C_NONE, C_NONE, 0, 0, 0, 0, 0, 0}, + {obj.ANOP, C_FREG, C_NONE, C_NONE, 0, 0, 0, 0, 0, 0}, + {obj.ADUFFZERO, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0, 0}, // same as ABL + {obj.ADUFFCOPY, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0, 0}, // same as ABL + {obj.AXXX, C_NONE, C_NONE, C_NONE, 0, 4, 0, 0, 0, 0}, +} + +var mbOp = []struct { + reg int16 + enc uint32 +}{ + {REG_MB_SY, 15}, + {REG_MB_ST, 14}, + {REG_MB_ISH, 11}, + {REG_MB_ISHST, 10}, + {REG_MB_NSH, 7}, + {REG_MB_NSHST, 6}, + {REG_MB_OSH, 3}, + {REG_MB_OSHST, 2}, +} + +var oprange [ALAST & obj.AMask][]Optab + +var xcmp [C_GOK + 1][C_GOK + 1]bool + +var ( + deferreturn *obj.LSym + symdiv *obj.LSym + symdivu *obj.LSym + symmod *obj.LSym + symmodu *obj.LSym +) + +// Note about encoding: Prog.scond holds the condition encoding, +// but XOR'ed with C_SCOND_XOR, so that C_SCOND_NONE == 0. +// The code that shifts the value << 28 has the responsibility +// for XORing with C_SCOND_XOR too. + +func checkSuffix(c *ctxt5, p *obj.Prog, o *Optab) { + if p.Scond&C_SBIT != 0 && o.scond&C_SBIT == 0 { + c.ctxt.Diag("invalid .S suffix: %v", p) + } + if p.Scond&C_PBIT != 0 && o.scond&C_PBIT == 0 { + c.ctxt.Diag("invalid .P suffix: %v", p) + } + if p.Scond&C_WBIT != 0 && o.scond&C_WBIT == 0 { + c.ctxt.Diag("invalid .W suffix: %v", p) + } + if p.Scond&C_UBIT != 0 && o.scond&C_UBIT == 0 { + c.ctxt.Diag("invalid .U suffix: %v", p) + } +} + +func span5(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { + if ctxt.Retpoline { + ctxt.Diag("-spectre=ret not supported on arm") + ctxt.Retpoline = false // don't keep printing + } + + var p *obj.Prog + var op *obj.Prog + + p = cursym.Func.Text + if p == nil || p.Link == nil { // handle external functions and ELF section symbols + return + } + + if oprange[AAND&obj.AMask] == nil { + ctxt.Diag("arm ops not initialized, call arm.buildop first") + } + + c := ctxt5{ctxt: ctxt, newprog: newprog, cursym: cursym, autosize: p.To.Offset + 4} + pc := int32(0) + + op = p + p = p.Link + var m int + var o *Optab + for ; p != nil || c.blitrl != nil; op, p = p, p.Link { + if p == nil { + if c.checkpool(op, pc) { + p = op + continue + } + + // can't happen: blitrl is not nil, but checkpool didn't flushpool + ctxt.Diag("internal inconsistency") + + break + } + + p.Pc = int64(pc) + o = c.oplook(p) + m = int(o.size) + + if m%4 != 0 || p.Pc%4 != 0 { + ctxt.Diag("!pc invalid: %v size=%d", p, m) + } + + // must check literal pool here in case p generates many instructions + if c.blitrl != nil { + // Emit the constant pool just before p if p + // would push us over the immediate size limit. + if c.checkpool(op, pc+int32(m)) { + // Back up to the instruction just + // before the pool and continue with + // the first instruction of the pool. + p = op + continue + } + } + + if m == 0 && (p.As != obj.AFUNCDATA && p.As != obj.APCDATA && p.As != obj.ANOP) { + ctxt.Diag("zero-width instruction\n%v", p) + continue + } + + switch o.flag & (LFROM | LTO | LPOOL) { + case LFROM: + c.addpool(p, &p.From) + + case LTO: + c.addpool(p, &p.To) + + case LPOOL: + if p.Scond&C_SCOND == C_SCOND_NONE { + c.flushpool(p, 0, 0) + } + } + + if p.As == AMOVW && p.To.Type == obj.TYPE_REG && p.To.Reg == REGPC && p.Scond&C_SCOND == C_SCOND_NONE { + c.flushpool(p, 0, 0) + } + + pc += int32(m) + } + + c.cursym.Size = int64(pc) + + /* + * if any procedure is large enough to + * generate a large SBRA branch, then + * generate extra passes putting branches + * around jmps to fix. this is rare. + */ + times := 0 + + var bflag int + var opc int32 + var out [6 + 3]uint32 + for { + bflag = 0 + pc = 0 + times++ + c.cursym.Func.Text.Pc = 0 // force re-layout the code. + for p = c.cursym.Func.Text; p != nil; p = p.Link { + o = c.oplook(p) + if int64(pc) > p.Pc { + p.Pc = int64(pc) + } + + /* very large branches + if(o->type == 6 && p->pcond) { + otxt = p->pcond->pc - c; + if(otxt < 0) + otxt = -otxt; + if(otxt >= (1L<<17) - 10) { + q = emallocz(sizeof(Prog)); + q->link = p->link; + p->link = q; + q->as = AB; + q->to.type = TYPE_BRANCH; + q->pcond = p->pcond; + p->pcond = q; + q = emallocz(sizeof(Prog)); + q->link = p->link; + p->link = q; + q->as = AB; + q->to.type = TYPE_BRANCH; + q->pcond = q->link->link; + bflag = 1; + } + } + */ + opc = int32(p.Pc) + m = int(o.size) + if p.Pc != int64(opc) { + bflag = 1 + } + + //print("%v pc changed %d to %d in iter. %d\n", p, opc, (int32)p->pc, times); + pc = int32(p.Pc + int64(m)) + + if m%4 != 0 || p.Pc%4 != 0 { + ctxt.Diag("pc invalid: %v size=%d", p, m) + } + + if m/4 > len(out) { + ctxt.Diag("instruction size too large: %d > %d", m/4, len(out)) + } + if m == 0 && (p.As != obj.AFUNCDATA && p.As != obj.APCDATA && p.As != obj.ANOP) { + if p.As == obj.ATEXT { + c.autosize = p.To.Offset + 4 + continue + } + + ctxt.Diag("zero-width instruction\n%v", p) + continue + } + } + + c.cursym.Size = int64(pc) + if bflag == 0 { + break + } + } + + if pc%4 != 0 { + ctxt.Diag("sym->size=%d, invalid", pc) + } + + /* + * lay out the code. all the pc-relative code references, + * even cross-function, are resolved now; + * only data references need to be relocated. + * with more work we could leave cross-function + * code references to be relocated too, and then + * perhaps we'd be able to parallelize the span loop above. + */ + + p = c.cursym.Func.Text + c.autosize = p.To.Offset + 4 + c.cursym.Grow(c.cursym.Size) + + bp := c.cursym.P + pc = int32(p.Pc) // even p->link might need extra padding + var v int + for p = p.Link; p != nil; p = p.Link { + c.pc = p.Pc + o = c.oplook(p) + opc = int32(p.Pc) + c.asmout(p, o, out[:]) + m = int(o.size) + + if m%4 != 0 || p.Pc%4 != 0 { + ctxt.Diag("final stage: pc invalid: %v size=%d", p, m) + } + + if int64(pc) > p.Pc { + ctxt.Diag("PC padding invalid: want %#d, has %#d: %v", p.Pc, pc, p) + } + for int64(pc) != p.Pc { + // emit 0xe1a00000 (MOVW R0, R0) + bp[0] = 0x00 + bp = bp[1:] + + bp[0] = 0x00 + bp = bp[1:] + bp[0] = 0xa0 + bp = bp[1:] + bp[0] = 0xe1 + bp = bp[1:] + pc += 4 + } + + for i := 0; i < m/4; i++ { + v = int(out[i]) + bp[0] = byte(v) + bp = bp[1:] + bp[0] = byte(v >> 8) + bp = bp[1:] + bp[0] = byte(v >> 16) + bp = bp[1:] + bp[0] = byte(v >> 24) + bp = bp[1:] + } + + pc += int32(m) + } +} + +// checkpool flushes the literal pool when the first reference to +// it threatens to go out of range of a 12-bit PC-relative offset. +// +// nextpc is the tentative next PC at which the pool could be emitted. +// checkpool should be called *before* emitting the instruction that +// would cause the PC to reach nextpc. +// If nextpc is too far from the first pool reference, checkpool will +// flush the pool immediately after p. +// The caller should resume processing a p.Link. +func (c *ctxt5) checkpool(p *obj.Prog, nextpc int32) bool { + poolLast := nextpc + poolLast += 4 // the AB instruction to jump around the pool + poolLast += int32(c.pool.size) - 4 // the offset of the last pool entry + + refPC := int32(c.pool.start) // PC of the first pool reference + + v := poolLast - refPC - 8 // 12-bit PC-relative offset (see omvl) + + if c.pool.size >= 0xff0 || immaddr(v) == 0 { + return c.flushpool(p, 1, 0) + } else if p.Link == nil { + return c.flushpool(p, 2, 0) + } + return false +} + +func (c *ctxt5) flushpool(p *obj.Prog, skip int, force int) bool { + if c.blitrl != nil { + if skip != 0 { + if false && skip == 1 { + fmt.Printf("note: flush literal pool at %x: len=%d ref=%x\n", uint64(p.Pc+4), c.pool.size, c.pool.start) + } + q := c.newprog() + q.As = AB + q.To.Type = obj.TYPE_BRANCH + q.To.SetTarget(p.Link) + q.Link = c.blitrl + q.Pos = p.Pos + c.blitrl = q + } else if force == 0 && (p.Pc+int64(c.pool.size)-int64(c.pool.start) < 2048) { + return false + } + + // The line number for constant pool entries doesn't really matter. + // We set it to the line number of the preceding instruction so that + // there are no deltas to encode in the pc-line tables. + for q := c.blitrl; q != nil; q = q.Link { + q.Pos = p.Pos + } + + c.elitrl.Link = p.Link + p.Link = c.blitrl + + c.blitrl = nil /* BUG: should refer back to values until out-of-range */ + c.elitrl = nil + c.pool.size = 0 + c.pool.start = 0 + c.pool.extra = 0 + return true + } + + return false +} + +func (c *ctxt5) addpool(p *obj.Prog, a *obj.Addr) { + t := c.newprog() + t.As = AWORD + + switch c.aclass(a) { + default: + t.To.Offset = a.Offset + t.To.Sym = a.Sym + t.To.Type = a.Type + t.To.Name = a.Name + + if c.ctxt.Flag_shared && t.To.Sym != nil { + t.Rel = p + } + + case C_SROREG, + C_LOREG, + C_ROREG, + C_FOREG, + C_SOREG, + C_HOREG, + C_FAUTO, + C_SAUTO, + C_LAUTO, + C_LACON: + t.To.Type = obj.TYPE_CONST + t.To.Offset = c.instoffset + } + + if t.Rel == nil { + for q := c.blitrl; q != nil; q = q.Link { /* could hash on t.t0.offset */ + if q.Rel == nil && q.To == t.To { + p.Pool = q + return + } + } + } + + q := c.newprog() + *q = *t + q.Pc = int64(c.pool.size) + + if c.blitrl == nil { + c.blitrl = q + c.pool.start = uint32(p.Pc) + } else { + c.elitrl.Link = q + } + c.elitrl = q + c.pool.size += 4 + + // Store the link to the pool entry in Pool. + p.Pool = q +} + +func (c *ctxt5) regoff(a *obj.Addr) int32 { + c.instoffset = 0 + c.aclass(a) + return int32(c.instoffset) +} + +func immrot(v uint32) int32 { + for i := 0; i < 16; i++ { + if v&^0xff == 0 { + return int32(uint32(int32(i)<<8) | v | 1<<25) + } + v = v<<2 | v>>30 + } + + return 0 +} + +// immrot2a returns bits encoding the immediate constant fields of two instructions, +// such that the encoded constants x, y satisfy x|y==v, x&y==0. +// Returns 0,0 if no such decomposition of v exists. +func immrot2a(v uint32) (uint32, uint32) { + for i := uint(1); i < 32; i++ { + m := uint32(1<= 0 && v <= 0xfff { + return v&0xfff | 1<<24 | 1<<23 /* pre indexing */ /* pre indexing, up */ + } + if v >= -0xfff && v < 0 { + return -v&0xfff | 1<<24 /* pre indexing */ + } + return 0 +} + +func immfloat(v int32) bool { + return v&0xC03 == 0 /* offset will fit in floating-point load/store */ +} + +func immhalf(v int32) bool { + if v >= 0 && v <= 0xff { + return v|1<<24|1<<23 != 0 /* pre indexing */ /* pre indexing, up */ + } + if v >= -0xff && v < 0 { + return -v&0xff|1<<24 != 0 /* pre indexing */ + } + return false +} + +func (c *ctxt5) aclass(a *obj.Addr) int { + switch a.Type { + case obj.TYPE_NONE: + return C_NONE + + case obj.TYPE_REG: + c.instoffset = 0 + if REG_R0 <= a.Reg && a.Reg <= REG_R15 { + return C_REG + } + if REG_F0 <= a.Reg && a.Reg <= REG_F15 { + return C_FREG + } + if a.Reg == REG_FPSR || a.Reg == REG_FPCR { + return C_FCR + } + if a.Reg == REG_CPSR || a.Reg == REG_SPSR { + return C_PSR + } + if a.Reg >= REG_SPECIAL { + return C_SPR + } + return C_GOK + + case obj.TYPE_REGREG: + return C_REGREG + + case obj.TYPE_REGREG2: + return C_REGREG2 + + case obj.TYPE_REGLIST: + return C_REGLIST + + case obj.TYPE_SHIFT: + if a.Reg == 0 { + // register shift R>>i + return C_SHIFT + } else { + // memory address with shifted offset R>>i(R) + return C_SHIFTADDR + } + + case obj.TYPE_MEM: + switch a.Name { + case obj.NAME_EXTERN, + obj.NAME_GOTREF, + obj.NAME_STATIC: + if a.Sym == nil || a.Sym.Name == "" { + fmt.Printf("null sym external\n") + return C_GOK + } + + c.instoffset = 0 // s.b. unused but just in case + if a.Sym.Type == objabi.STLSBSS { + if c.ctxt.Flag_shared { + return C_TLS_IE + } else { + return C_TLS_LE + } + } + + return C_ADDR + + case obj.NAME_AUTO: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-SP. + a.Reg = obj.REG_NONE + } + c.instoffset = c.autosize + a.Offset + if t := immaddr(int32(c.instoffset)); t != 0 { + if immhalf(int32(c.instoffset)) { + if immfloat(t) { + return C_HFAUTO + } + return C_HAUTO + } + + if immfloat(t) { + return C_FAUTO + } + return C_SAUTO + } + + return C_LAUTO + + case obj.NAME_PARAM: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-FP. + a.Reg = obj.REG_NONE + } + c.instoffset = c.autosize + a.Offset + 4 + if t := immaddr(int32(c.instoffset)); t != 0 { + if immhalf(int32(c.instoffset)) { + if immfloat(t) { + return C_HFAUTO + } + return C_HAUTO + } + + if immfloat(t) { + return C_FAUTO + } + return C_SAUTO + } + + return C_LAUTO + + case obj.NAME_NONE: + c.instoffset = a.Offset + if t := immaddr(int32(c.instoffset)); t != 0 { + if immhalf(int32(c.instoffset)) { /* n.b. that it will also satisfy immrot */ + if immfloat(t) { + return C_HFOREG + } + return C_HOREG + } + + if immfloat(t) { + return C_FOREG /* n.b. that it will also satisfy immrot */ + } + if immrot(uint32(c.instoffset)) != 0 { + return C_SROREG + } + if immhalf(int32(c.instoffset)) { + return C_HOREG + } + return C_SOREG + } + + if immrot(uint32(c.instoffset)) != 0 { + return C_ROREG + } + return C_LOREG + } + + return C_GOK + + case obj.TYPE_FCONST: + if c.chipzero5(a.Val.(float64)) >= 0 { + return C_ZFCON + } + if c.chipfloat5(a.Val.(float64)) >= 0 { + return C_SFCON + } + return C_LFCON + + case obj.TYPE_TEXTSIZE: + return C_TEXTSIZE + + case obj.TYPE_CONST, + obj.TYPE_ADDR: + switch a.Name { + case obj.NAME_NONE: + c.instoffset = a.Offset + if a.Reg != 0 { + return c.aconsize() + } + + if immrot(uint32(c.instoffset)) != 0 { + return C_RCON + } + if immrot(^uint32(c.instoffset)) != 0 { + return C_NCON + } + if uint32(c.instoffset) <= 0xffff && objabi.GOARM == 7 { + return C_SCON + } + if x, y := immrot2a(uint32(c.instoffset)); x != 0 && y != 0 { + return C_RCON2A + } + if y, x := immrot2s(uint32(c.instoffset)); x != 0 && y != 0 { + return C_RCON2S + } + return C_LCON + + case obj.NAME_EXTERN, + obj.NAME_GOTREF, + obj.NAME_STATIC: + s := a.Sym + if s == nil { + break + } + c.instoffset = 0 // s.b. unused but just in case + return C_LCONADDR + + case obj.NAME_AUTO: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-SP. + a.Reg = obj.REG_NONE + } + c.instoffset = c.autosize + a.Offset + return c.aconsize() + + case obj.NAME_PARAM: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-FP. + a.Reg = obj.REG_NONE + } + c.instoffset = c.autosize + a.Offset + 4 + return c.aconsize() + } + + return C_GOK + + case obj.TYPE_BRANCH: + return C_SBRA + } + + return C_GOK +} + +func (c *ctxt5) aconsize() int { + if immrot(uint32(c.instoffset)) != 0 { + return C_RACON + } + if immrot(uint32(-c.instoffset)) != 0 { + return C_RACON + } + return C_LACON +} + +func (c *ctxt5) oplook(p *obj.Prog) *Optab { + a1 := int(p.Optab) + if a1 != 0 { + return &optab[a1-1] + } + a1 = int(p.From.Class) + if a1 == 0 { + a1 = c.aclass(&p.From) + 1 + p.From.Class = int8(a1) + } + + a1-- + a3 := int(p.To.Class) + if a3 == 0 { + a3 = c.aclass(&p.To) + 1 + p.To.Class = int8(a3) + } + + a3-- + a2 := C_NONE + if p.Reg != 0 { + switch { + case REG_F0 <= p.Reg && p.Reg <= REG_F15: + a2 = C_FREG + case REG_R0 <= p.Reg && p.Reg <= REG_R15: + a2 = C_REG + default: + c.ctxt.Diag("invalid register in %v", p) + } + } + + // check illegal base register + switch a1 { + case C_SOREG, C_LOREG, C_HOREG, C_FOREG, C_ROREG, C_HFOREG, C_SROREG, C_SHIFTADDR: + if p.From.Reg < REG_R0 || REG_R15 < p.From.Reg { + c.ctxt.Diag("illegal base register: %v", p) + } + default: + } + switch a3 { + case C_SOREG, C_LOREG, C_HOREG, C_FOREG, C_ROREG, C_HFOREG, C_SROREG, C_SHIFTADDR: + if p.To.Reg < REG_R0 || REG_R15 < p.To.Reg { + c.ctxt.Diag("illegal base register: %v", p) + } + default: + } + + // If current instruction has a .S suffix (flags update), + // we must use the constant pool instead of splitting it. + if (a1 == C_RCON2A || a1 == C_RCON2S) && p.Scond&C_SBIT != 0 { + a1 = C_LCON + } + if (a3 == C_RCON2A || a3 == C_RCON2S) && p.Scond&C_SBIT != 0 { + a3 = C_LCON + } + + if false { /*debug['O']*/ + fmt.Printf("oplook %v %v %v %v\n", p.As, DRconv(a1), DRconv(a2), DRconv(a3)) + fmt.Printf("\t\t%d %d\n", p.From.Type, p.To.Type) + } + + ops := oprange[p.As&obj.AMask] + c1 := &xcmp[a1] + c3 := &xcmp[a3] + for i := range ops { + op := &ops[i] + if int(op.a2) == a2 && c1[op.a1] && c3[op.a3] { + p.Optab = uint16(cap(optab) - cap(ops) + i + 1) + checkSuffix(c, p, op) + return op + } + } + + c.ctxt.Diag("illegal combination %v; %v %v %v; from %d %d; to %d %d", p, DRconv(a1), DRconv(a2), DRconv(a3), p.From.Type, p.From.Name, p.To.Type, p.To.Name) + if ops == nil { + ops = optab + } + return &ops[0] +} + +func cmp(a int, b int) bool { + if a == b { + return true + } + switch a { + case C_LCON: + if b == C_RCON || b == C_NCON || b == C_SCON || b == C_RCON2A || b == C_RCON2S { + return true + } + + case C_LACON: + if b == C_RACON { + return true + } + + case C_LFCON: + if b == C_ZFCON || b == C_SFCON { + return true + } + + case C_HFAUTO: + return b == C_HAUTO || b == C_FAUTO + + case C_FAUTO, C_HAUTO: + return b == C_HFAUTO + + case C_SAUTO: + return cmp(C_HFAUTO, b) + + case C_LAUTO: + return cmp(C_SAUTO, b) + + case C_HFOREG: + return b == C_HOREG || b == C_FOREG + + case C_FOREG, C_HOREG: + return b == C_HFOREG + + case C_SROREG: + return cmp(C_SOREG, b) || cmp(C_ROREG, b) + + case C_SOREG, C_ROREG: + return b == C_SROREG || cmp(C_HFOREG, b) + + case C_LOREG: + return cmp(C_SROREG, b) + + case C_LBRA: + if b == C_SBRA { + return true + } + + case C_HREG: + return cmp(C_SP, b) || cmp(C_PC, b) + } + + return false +} + +type ocmp []Optab + +func (x ocmp) Len() int { + return len(x) +} + +func (x ocmp) Swap(i, j int) { + x[i], x[j] = x[j], x[i] +} + +func (x ocmp) Less(i, j int) bool { + p1 := &x[i] + p2 := &x[j] + n := int(p1.as) - int(p2.as) + if n != 0 { + return n < 0 + } + n = int(p1.a1) - int(p2.a1) + if n != 0 { + return n < 0 + } + n = int(p1.a2) - int(p2.a2) + if n != 0 { + return n < 0 + } + n = int(p1.a3) - int(p2.a3) + if n != 0 { + return n < 0 + } + return false +} + +func opset(a, b0 obj.As) { + oprange[a&obj.AMask] = oprange[b0] +} + +func buildop(ctxt *obj.Link) { + if oprange[AAND&obj.AMask] != nil { + // Already initialized; stop now. + // This happens in the cmd/asm tests, + // each of which re-initializes the arch. + return + } + + deferreturn = ctxt.LookupABI("runtime.deferreturn", obj.ABIInternal) + + symdiv = ctxt.Lookup("runtime._div") + symdivu = ctxt.Lookup("runtime._divu") + symmod = ctxt.Lookup("runtime._mod") + symmodu = ctxt.Lookup("runtime._modu") + + var n int + + for i := 0; i < C_GOK; i++ { + for n = 0; n < C_GOK; n++ { + if cmp(n, i) { + xcmp[i][n] = true + } + } + } + for n = 0; optab[n].as != obj.AXXX; n++ { + if optab[n].flag&LPCREL != 0 { + if ctxt.Flag_shared { + optab[n].size += int8(optab[n].pcrelsiz) + } else { + optab[n].flag &^= LPCREL + } + } + } + + sort.Sort(ocmp(optab[:n])) + for i := 0; i < n; i++ { + r := optab[i].as + r0 := r & obj.AMask + start := i + for optab[i].as == r { + i++ + } + oprange[r0] = optab[start:i] + i-- + + switch r { + default: + ctxt.Diag("unknown op in build: %v", r) + ctxt.DiagFlush() + log.Fatalf("bad code") + + case AADD: + opset(ASUB, r0) + opset(ARSB, r0) + opset(AADC, r0) + opset(ASBC, r0) + opset(ARSC, r0) + + case AORR: + opset(AEOR, r0) + opset(ABIC, r0) + + case ACMP: + opset(ATEQ, r0) + opset(ACMN, r0) + opset(ATST, r0) + + case AMVN: + break + + case ABEQ: + opset(ABNE, r0) + opset(ABCS, r0) + opset(ABHS, r0) + opset(ABCC, r0) + opset(ABLO, r0) + opset(ABMI, r0) + opset(ABPL, r0) + opset(ABVS, r0) + opset(ABVC, r0) + opset(ABHI, r0) + opset(ABLS, r0) + opset(ABGE, r0) + opset(ABLT, r0) + opset(ABGT, r0) + opset(ABLE, r0) + + case ASLL: + opset(ASRL, r0) + opset(ASRA, r0) + + case AMUL: + opset(AMULU, r0) + + case ADIV: + opset(AMOD, r0) + opset(AMODU, r0) + opset(ADIVU, r0) + + case ADIVHW: + opset(ADIVUHW, r0) + + case AMOVW, + AMOVB, + AMOVBS, + AMOVBU, + AMOVH, + AMOVHS, + AMOVHU: + break + + case ASWPW: + opset(ASWPBU, r0) + + case AB, + ABL, + ABX, + ABXRET, + obj.ADUFFZERO, + obj.ADUFFCOPY, + ASWI, + AWORD, + AMOVM, + ARFE, + obj.ATEXT: + break + + case AADDF: + opset(AADDD, r0) + opset(ASUBF, r0) + opset(ASUBD, r0) + opset(AMULF, r0) + opset(AMULD, r0) + opset(ANMULF, r0) + opset(ANMULD, r0) + opset(AMULAF, r0) + opset(AMULAD, r0) + opset(AMULSF, r0) + opset(AMULSD, r0) + opset(ANMULAF, r0) + opset(ANMULAD, r0) + opset(ANMULSF, r0) + opset(ANMULSD, r0) + opset(AFMULAF, r0) + opset(AFMULAD, r0) + opset(AFMULSF, r0) + opset(AFMULSD, r0) + opset(AFNMULAF, r0) + opset(AFNMULAD, r0) + opset(AFNMULSF, r0) + opset(AFNMULSD, r0) + opset(ADIVF, r0) + opset(ADIVD, r0) + + case ANEGF: + opset(ANEGD, r0) + opset(ASQRTF, r0) + opset(ASQRTD, r0) + opset(AMOVFD, r0) + opset(AMOVDF, r0) + opset(AABSF, r0) + opset(AABSD, r0) + + case ACMPF: + opset(ACMPD, r0) + + case AMOVF: + opset(AMOVD, r0) + + case AMOVFW: + opset(AMOVDW, r0) + + case AMOVWF: + opset(AMOVWD, r0) + + case AMULL: + opset(AMULAL, r0) + opset(AMULLU, r0) + opset(AMULALU, r0) + + case AMULWT: + opset(AMULWB, r0) + opset(AMULBB, r0) + opset(AMMUL, r0) + + case AMULAWT: + opset(AMULAWB, r0) + opset(AMULABB, r0) + opset(AMULS, r0) + opset(AMMULA, r0) + opset(AMMULS, r0) + + case ABFX: + opset(ABFXU, r0) + opset(ABFC, r0) + opset(ABFI, r0) + + case ACLZ: + opset(AREV, r0) + opset(AREV16, r0) + opset(AREVSH, r0) + opset(ARBIT, r0) + + case AXTAB: + opset(AXTAH, r0) + opset(AXTABU, r0) + opset(AXTAHU, r0) + + case ALDREX, + ASTREX, + ALDREXD, + ASTREXD, + ADMB, + APLD, + AAND, + AMULA, + obj.AUNDEF, + obj.AFUNCDATA, + obj.APCDATA, + obj.ANOP: + break + } + } +} + +func (c *ctxt5) asmout(p *obj.Prog, o *Optab, out []uint32) { + c.printp = p + o1 := uint32(0) + o2 := uint32(0) + o3 := uint32(0) + o4 := uint32(0) + o5 := uint32(0) + o6 := uint32(0) + if false { /*debug['P']*/ + fmt.Printf("%x: %v\ttype %d\n", uint32(p.Pc), p, o.type_) + } + switch o.type_ { + default: + c.ctxt.Diag("%v: unknown asm %d", p, o.type_) + + case 0: /* pseudo ops */ + if false { /*debug['G']*/ + fmt.Printf("%x: %s: arm\n", uint32(p.Pc), p.From.Sym.Name) + } + + case 1: /* op R,[R],R */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = 0 + } + if p.As == AMOVB || p.As == AMOVH || p.As == AMOVW || p.As == AMVN { + r = 0 + } else if r == 0 { + r = rt + } + o1 |= (uint32(rf)&15)<<0 | (uint32(r)&15)<<16 | (uint32(rt)&15)<<12 + + case 2: /* movbu $I,[R],R */ + c.aclass(&p.From) + + o1 = c.oprrr(p, p.As, int(p.Scond)) + o1 |= uint32(immrot(uint32(c.instoffset))) + rt := int(p.To.Reg) + r := int(p.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = 0 + } + if p.As == AMOVW || p.As == AMVN { + r = 0 + } else if r == 0 { + r = rt + } + o1 |= (uint32(r)&15)<<16 | (uint32(rt)&15)<<12 + + case 106: /* op $I,R,R where I can be decomposed into 2 immediates */ + c.aclass(&p.From) + r := int(p.Reg) + rt := int(p.To.Reg) + if r == 0 { + r = rt + } + x, y := immrot2a(uint32(c.instoffset)) + var as2 obj.As + switch p.As { + case AADD, ASUB, AORR, AEOR, ABIC: + as2 = p.As // ADD, SUB, ORR, EOR, BIC + case ARSB: + as2 = AADD // RSB -> RSB/ADD pair + case AADC: + as2 = AADD // ADC -> ADC/ADD pair + case ASBC: + as2 = ASUB // SBC -> SBC/SUB pair + case ARSC: + as2 = AADD // RSC -> RSC/ADD pair + default: + c.ctxt.Diag("unknown second op for %v", p) + } + o1 = c.oprrr(p, p.As, int(p.Scond)) + o2 = c.oprrr(p, as2, int(p.Scond)) + o1 |= (uint32(r)&15)<<16 | (uint32(rt)&15)<<12 + o2 |= (uint32(rt)&15)<<16 | (uint32(rt)&15)<<12 + o1 |= x + o2 |= y + + case 107: /* op $I,R,R where I can be decomposed into 2 immediates */ + c.aclass(&p.From) + r := int(p.Reg) + rt := int(p.To.Reg) + if r == 0 { + r = rt + } + y, x := immrot2s(uint32(c.instoffset)) + var as2 obj.As + switch p.As { + case AADD: + as2 = ASUB // ADD -> ADD/SUB pair + case ASUB: + as2 = AADD // SUB -> SUB/ADD pair + case ARSB: + as2 = ASUB // RSB -> RSB/SUB pair + case AADC: + as2 = ASUB // ADC -> ADC/SUB pair + case ASBC: + as2 = AADD // SBC -> SBC/ADD pair + case ARSC: + as2 = ASUB // RSC -> RSC/SUB pair + default: + c.ctxt.Diag("unknown second op for %v", p) + } + o1 = c.oprrr(p, p.As, int(p.Scond)) + o2 = c.oprrr(p, as2, int(p.Scond)) + o1 |= (uint32(r)&15)<<16 | (uint32(rt)&15)<<12 + o2 |= (uint32(rt)&15)<<16 | (uint32(rt)&15)<<12 + o1 |= y + o2 |= x + + case 3: /* add R<<[IR],[R],R */ + o1 = c.mov(p) + + case 4: /* MOVW $off(R), R -> add $off,[R],R */ + c.aclass(&p.From) + if c.instoffset < 0 { + o1 = c.oprrr(p, ASUB, int(p.Scond)) + o1 |= uint32(immrot(uint32(-c.instoffset))) + } else { + o1 = c.oprrr(p, AADD, int(p.Scond)) + o1 |= uint32(immrot(uint32(c.instoffset))) + } + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o1 |= (uint32(r) & 15) << 16 + o1 |= (uint32(p.To.Reg) & 15) << 12 + + case 5: /* bra s */ + o1 = c.opbra(p, p.As, int(p.Scond)) + + v := int32(-8) + if p.To.Sym != nil { + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 4 + rel.Sym = p.To.Sym + v += int32(p.To.Offset) + rel.Add = int64(o1) | (int64(v)>>2)&0xffffff + rel.Type = objabi.R_CALLARM + break + } + + if p.To.Target() != nil { + v = int32((p.To.Target().Pc - c.pc) - 8) + } + o1 |= (uint32(v) >> 2) & 0xffffff + + case 6: /* b ,O(R) -> add $O,R,PC */ + c.aclass(&p.To) + + o1 = c.oprrr(p, AADD, int(p.Scond)) + o1 |= uint32(immrot(uint32(c.instoffset))) + o1 |= (uint32(p.To.Reg) & 15) << 16 + o1 |= (REGPC & 15) << 12 + + case 7: /* bl (R) -> blx R */ + c.aclass(&p.To) + + if c.instoffset != 0 { + c.ctxt.Diag("%v: doesn't support BL offset(REG) with non-zero offset %d", p, c.instoffset) + } + o1 = c.oprrr(p, ABL, int(p.Scond)) + o1 |= (uint32(p.To.Reg) & 15) << 0 + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 0 + rel.Type = objabi.R_CALLIND + + case 8: /* sll $c,[R],R -> mov (R<<$c),R */ + c.aclass(&p.From) + + o1 = c.oprrr(p, p.As, int(p.Scond)) + r := int(p.Reg) + if r == 0 { + r = int(p.To.Reg) + } + o1 |= (uint32(r) & 15) << 0 + o1 |= uint32((c.instoffset & 31) << 7) + o1 |= (uint32(p.To.Reg) & 15) << 12 + + case 9: /* sll R,[R],R -> mov (R< 31 || width <= 0 || (lsb+width) > 32 { + c.ctxt.Diag("%v: wrong width or LSB", p) + } + switch p.As { + case ABFX, ABFXU: // (width-1) is encoded + o1 |= (uint32(r)&15)<<0 | (uint32(rt)&15)<<12 | uint32(lsb)<<7 | uint32(width-1)<<16 + case ABFC, ABFI: // MSB is encoded + o1 |= (uint32(r)&15)<<0 | (uint32(rt)&15)<<12 | uint32(lsb)<<7 | uint32(lsb+width-1)<<16 + default: + c.ctxt.Diag("illegal combination: %v", p) + } + + case 20: /* mov/movb/movbu R,O(R) */ + c.aclass(&p.To) + + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + o1 = c.osr(p.As, int(p.From.Reg), int32(c.instoffset), r, int(p.Scond)) + + case 21: /* mov/movbu O(R),R -> lr */ + c.aclass(&p.From) + + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o1 = c.olr(int32(c.instoffset), r, int(p.To.Reg), int(p.Scond)) + if p.As != AMOVW { + o1 |= 1 << 22 + } + + case 22: /* XTAB R@>i, [R], R */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + switch p.From.Offset &^ 0xf { + // only 0/8/16/24 bits rotation is accepted + case SHIFT_RR, SHIFT_RR | 8<<7, SHIFT_RR | 16<<7, SHIFT_RR | 24<<7: + o1 |= uint32(p.From.Offset) & 0xc0f + default: + c.ctxt.Diag("illegal shift: %v", p) + } + rt := p.To.Reg + r := p.Reg + if r == 0 { + r = rt + } + o1 |= (uint32(rt)&15)<<12 | (uint32(r)&15)<<16 + + case 23: /* MOVW/MOVB/MOVH R@>i, R */ + switch p.As { + case AMOVW: + o1 = c.mov(p) + case AMOVBU, AMOVBS, AMOVB, AMOVHU, AMOVHS, AMOVH: + o1 = c.movxt(p) + default: + c.ctxt.Diag("illegal combination: %v", p) + } + + case 30: /* mov/movb/movbu R,L(R) */ + o1 = c.omvl(p, &p.To, REGTMP) + + if o1 == 0 { + break + } + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + o2 = c.osrr(int(p.From.Reg), REGTMP&15, r, int(p.Scond)) + if p.As != AMOVW { + o2 |= 1 << 22 + } + + case 31: /* mov/movbu L(R),R -> lr[b] */ + o1 = c.omvl(p, &p.From, REGTMP) + + if o1 == 0 { + break + } + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o2 = c.olrr(REGTMP&15, r, int(p.To.Reg), int(p.Scond)) + if p.As == AMOVBU || p.As == AMOVBS || p.As == AMOVB { + o2 |= 1 << 22 + } + + case 34: /* mov $lacon,R */ + o1 = c.omvl(p, &p.From, REGTMP) + + if o1 == 0 { + break + } + + o2 = c.oprrr(p, AADD, int(p.Scond)) + o2 |= REGTMP & 15 + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o2 |= (uint32(r) & 15) << 16 + if p.To.Type != obj.TYPE_NONE { + o2 |= (uint32(p.To.Reg) & 15) << 12 + } + + case 35: /* mov PSR,R */ + o1 = 2<<23 | 0xf<<16 | 0<<0 + + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + o1 |= (uint32(p.From.Reg) & 1) << 22 + o1 |= (uint32(p.To.Reg) & 15) << 12 + + case 36: /* mov R,PSR */ + o1 = 2<<23 | 0x2cf<<12 | 0<<4 + + if p.Scond&C_FBIT != 0 { + o1 ^= 0x010 << 12 + } + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + o1 |= (uint32(p.To.Reg) & 1) << 22 + o1 |= (uint32(p.From.Reg) & 15) << 0 + + case 37: /* mov $con,PSR */ + c.aclass(&p.From) + + o1 = 2<<23 | 0x2cf<<12 | 0<<4 + if p.Scond&C_FBIT != 0 { + o1 ^= 0x010 << 12 + } + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + o1 |= uint32(immrot(uint32(c.instoffset))) + o1 |= (uint32(p.To.Reg) & 1) << 22 + o1 |= (uint32(p.From.Reg) & 15) << 0 + + case 38, 39: + switch o.type_ { + case 38: /* movm $con,oreg -> stm */ + o1 = 0x4 << 25 + + o1 |= uint32(p.From.Offset & 0xffff) + o1 |= (uint32(p.To.Reg) & 15) << 16 + c.aclass(&p.To) + + case 39: /* movm oreg,$con -> ldm */ + o1 = 0x4<<25 | 1<<20 + + o1 |= uint32(p.To.Offset & 0xffff) + o1 |= (uint32(p.From.Reg) & 15) << 16 + c.aclass(&p.From) + } + + if c.instoffset != 0 { + c.ctxt.Diag("offset must be zero in MOVM; %v", p) + } + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + if p.Scond&C_PBIT != 0 { + o1 |= 1 << 24 + } + if p.Scond&C_UBIT != 0 { + o1 |= 1 << 23 + } + if p.Scond&C_WBIT != 0 { + o1 |= 1 << 21 + } + + case 40: /* swp oreg,reg,reg */ + c.aclass(&p.From) + + if c.instoffset != 0 { + c.ctxt.Diag("offset must be zero in SWP") + } + o1 = 0x2<<23 | 0x9<<4 + if p.As != ASWPW { + o1 |= 1 << 22 + } + o1 |= (uint32(p.From.Reg) & 15) << 16 + o1 |= (uint32(p.Reg) & 15) << 0 + o1 |= (uint32(p.To.Reg) & 15) << 12 + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + case 41: /* rfe -> movm.s.w.u 0(r13),[r15] */ + o1 = 0xe8fd8000 + + case 50: /* floating point store */ + v := c.regoff(&p.To) + + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + o1 = c.ofsr(p.As, int(p.From.Reg), v, r, int(p.Scond), p) + + case 51: /* floating point load */ + v := c.regoff(&p.From) + + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o1 = c.ofsr(p.As, int(p.To.Reg), v, r, int(p.Scond), p) | 1<<20 + + case 52: /* floating point store, int32 offset UGLY */ + o1 = c.omvl(p, &p.To, REGTMP) + + if o1 == 0 { + break + } + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + o2 = c.oprrr(p, AADD, int(p.Scond)) | (REGTMP&15)<<12 | (REGTMP&15)<<16 | (uint32(r)&15)<<0 + o3 = c.ofsr(p.As, int(p.From.Reg), 0, REGTMP, int(p.Scond), p) + + case 53: /* floating point load, int32 offset UGLY */ + o1 = c.omvl(p, &p.From, REGTMP) + + if o1 == 0 { + break + } + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o2 = c.oprrr(p, AADD, int(p.Scond)) | (REGTMP&15)<<12 | (REGTMP&15)<<16 | (uint32(r)&15)<<0 + o3 = c.ofsr(p.As, int(p.To.Reg), 0, (REGTMP&15), int(p.Scond), p) | 1<<20 + + case 54: /* floating point arith */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if r == 0 { + switch p.As { + case AMULAD, AMULAF, AMULSF, AMULSD, ANMULAF, ANMULAD, ANMULSF, ANMULSD, + AFMULAD, AFMULAF, AFMULSF, AFMULSD, AFNMULAF, AFNMULAD, AFNMULSF, AFNMULSD: + c.ctxt.Diag("illegal combination: %v", p) + default: + r = rt + } + } + + o1 |= (uint32(rf)&15)<<0 | (uint32(r)&15)<<16 | (uint32(rt)&15)<<12 + + case 55: /* negf freg, freg */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + + o1 |= (uint32(rf)&15)<<0 | (uint32(rt)&15)<<12 + + case 56: /* move to FP[CS]R */ + o1 = ((uint32(p.Scond)&C_SCOND)^C_SCOND_XOR)<<28 | 0xee1<<16 | 0xa1<<4 + + o1 |= (uint32(p.From.Reg) & 15) << 12 + + case 57: /* move from FP[CS]R */ + o1 = ((uint32(p.Scond)&C_SCOND)^C_SCOND_XOR)<<28 | 0xef1<<16 | 0xa1<<4 + + o1 |= (uint32(p.To.Reg) & 15) << 12 + + case 58: /* movbu R,R */ + o1 = c.oprrr(p, AAND, int(p.Scond)) + + o1 |= uint32(immrot(0xff)) + rt := int(p.To.Reg) + r := int(p.From.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = 0 + } + if r == 0 { + r = rt + } + o1 |= (uint32(r)&15)<<16 | (uint32(rt)&15)<<12 + + case 59: /* movw/bu R< ldr indexed */ + if p.From.Reg == 0 { + c.ctxt.Diag("source operand is not a memory address: %v", p) + break + } + if p.From.Offset&(1<<4) != 0 { + c.ctxt.Diag("bad shift in LDR") + break + } + o1 = c.olrr(int(p.From.Offset), int(p.From.Reg), int(p.To.Reg), int(p.Scond)) + if p.As == AMOVBU { + o1 |= 1 << 22 + } + + case 60: /* movb R(R),R -> ldrsb indexed */ + if p.From.Reg == 0 { + c.ctxt.Diag("source operand is not a memory address: %v", p) + break + } + if p.From.Offset&(^0xf) != 0 { + c.ctxt.Diag("bad shift: %v", p) + break + } + o1 = c.olhrr(int(p.From.Offset), int(p.From.Reg), int(p.To.Reg), int(p.Scond)) + switch p.As { + case AMOVB, AMOVBS: + o1 ^= 1<<5 | 1<<6 + case AMOVH, AMOVHS: + o1 ^= 1 << 6 + default: + } + if p.Scond&C_UBIT != 0 { + o1 &^= 1 << 23 + } + + case 61: /* movw/b/bu R,R<<[IR](R) -> str indexed */ + if p.To.Reg == 0 { + c.ctxt.Diag("MOV to shifter operand") + } + o1 = c.osrr(int(p.From.Reg), int(p.To.Offset), int(p.To.Reg), int(p.Scond)) + if p.As == AMOVB || p.As == AMOVBS || p.As == AMOVBU { + o1 |= 1 << 22 + } + + case 62: /* MOVH/MOVHS/MOVHU Reg, Reg<<0(Reg) -> strh */ + if p.To.Reg == 0 { + c.ctxt.Diag("MOV to shifter operand") + } + if p.To.Offset&(^0xf) != 0 { + c.ctxt.Diag("bad shift: %v", p) + } + o1 = c.olhrr(int(p.To.Offset), int(p.To.Reg), int(p.From.Reg), int(p.Scond)) + o1 ^= 1 << 20 + if p.Scond&C_UBIT != 0 { + o1 &^= 1 << 23 + } + + /* reloc ops */ + case 64: /* mov/movb/movbu R,addr */ + o1 = c.omvl(p, &p.To, REGTMP) + + if o1 == 0 { + break + } + o2 = c.osr(p.As, int(p.From.Reg), 0, REGTMP, int(p.Scond)) + if o.flag&LPCREL != 0 { + o3 = o2 + o2 = c.oprrr(p, AADD, int(p.Scond)) | REGTMP&15 | (REGPC&15)<<16 | (REGTMP&15)<<12 + } + + case 65: /* mov/movbu addr,R */ + o1 = c.omvl(p, &p.From, REGTMP) + + if o1 == 0 { + break + } + o2 = c.olr(0, REGTMP, int(p.To.Reg), int(p.Scond)) + if p.As == AMOVBU || p.As == AMOVBS || p.As == AMOVB { + o2 |= 1 << 22 + } + if o.flag&LPCREL != 0 { + o3 = o2 + o2 = c.oprrr(p, AADD, int(p.Scond)) | REGTMP&15 | (REGPC&15)<<16 | (REGTMP&15)<<12 + } + + case 101: /* movw tlsvar,R, local exec*/ + o1 = c.omvl(p, &p.From, int(p.To.Reg)) + + case 102: /* movw tlsvar,R, initial exec*/ + o1 = c.omvl(p, &p.From, int(p.To.Reg)) + o2 = c.olrr(int(p.To.Reg)&15, (REGPC & 15), int(p.To.Reg), int(p.Scond)) + + case 103: /* word tlsvar, local exec */ + if p.To.Sym == nil { + c.ctxt.Diag("nil sym in tls %v", p) + } + if p.To.Offset != 0 { + c.ctxt.Diag("offset against tls var in %v", p) + } + // This case happens with words generated in the PC stream as part of + // the literal c.pool. + rel := obj.Addrel(c.cursym) + + rel.Off = int32(c.pc) + rel.Siz = 4 + rel.Sym = p.To.Sym + rel.Type = objabi.R_TLS_LE + o1 = 0 + + case 104: /* word tlsvar, initial exec */ + if p.To.Sym == nil { + c.ctxt.Diag("nil sym in tls %v", p) + } + if p.To.Offset != 0 { + c.ctxt.Diag("offset against tls var in %v", p) + } + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 4 + rel.Sym = p.To.Sym + rel.Type = objabi.R_TLS_IE + rel.Add = c.pc - p.Rel.Pc - 8 - int64(rel.Siz) + + case 68: /* floating point store -> ADDR */ + o1 = c.omvl(p, &p.To, REGTMP) + + if o1 == 0 { + break + } + o2 = c.ofsr(p.As, int(p.From.Reg), 0, REGTMP, int(p.Scond), p) + if o.flag&LPCREL != 0 { + o3 = o2 + o2 = c.oprrr(p, AADD, int(p.Scond)) | REGTMP&15 | (REGPC&15)<<16 | (REGTMP&15)<<12 + } + + case 69: /* floating point load <- ADDR */ + o1 = c.omvl(p, &p.From, REGTMP) + + if o1 == 0 { + break + } + o2 = c.ofsr(p.As, int(p.To.Reg), 0, (REGTMP&15), int(p.Scond), p) | 1<<20 + if o.flag&LPCREL != 0 { + o3 = o2 + o2 = c.oprrr(p, AADD, int(p.Scond)) | REGTMP&15 | (REGPC&15)<<16 | (REGTMP&15)<<12 + } + + /* ArmV4 ops: */ + case 70: /* movh/movhu R,O(R) -> strh */ + c.aclass(&p.To) + + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + o1 = c.oshr(int(p.From.Reg), int32(c.instoffset), r, int(p.Scond)) + + case 71: /* movb/movh/movhu O(R),R -> ldrsb/ldrsh/ldrh */ + c.aclass(&p.From) + + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o1 = c.olhr(int32(c.instoffset), r, int(p.To.Reg), int(p.Scond)) + if p.As == AMOVB || p.As == AMOVBS { + o1 ^= 1<<5 | 1<<6 + } else if p.As == AMOVH || p.As == AMOVHS { + o1 ^= (1 << 6) + } + + case 72: /* movh/movhu R,L(R) -> strh */ + o1 = c.omvl(p, &p.To, REGTMP) + + if o1 == 0 { + break + } + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + o2 = c.oshrr(int(p.From.Reg), REGTMP&15, r, int(p.Scond)) + + case 73: /* movb/movh/movhu L(R),R -> ldrsb/ldrsh/ldrh */ + o1 = c.omvl(p, &p.From, REGTMP) + + if o1 == 0 { + break + } + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o2 = c.olhrr(REGTMP&15, r, int(p.To.Reg), int(p.Scond)) + if p.As == AMOVB || p.As == AMOVBS { + o2 ^= 1<<5 | 1<<6 + } else if p.As == AMOVH || p.As == AMOVHS { + o2 ^= (1 << 6) + } + + case 74: /* bx $I */ + c.ctxt.Diag("ABX $I") + + case 75: /* bx O(R) */ + c.aclass(&p.To) + + if c.instoffset != 0 { + c.ctxt.Diag("non-zero offset in ABX") + } + + /* + o1 = c.oprrr(p, AADD, p->scond) | immrot(0) | ((REGPC&15)<<16) | ((REGLINK&15)<<12); // mov PC, LR + o2 = (((p->scond&C_SCOND) ^ C_SCOND_XOR)<<28) | (0x12fff<<8) | (1<<4) | ((p->to.reg&15) << 0); // BX R + */ + // p->to.reg may be REGLINK + o1 = c.oprrr(p, AADD, int(p.Scond)) + + o1 |= uint32(immrot(uint32(c.instoffset))) + o1 |= (uint32(p.To.Reg) & 15) << 16 + o1 |= (REGTMP & 15) << 12 + o2 = c.oprrr(p, AADD, int(p.Scond)) | uint32(immrot(0)) | (REGPC&15)<<16 | (REGLINK&15)<<12 // mov PC, LR + o3 = ((uint32(p.Scond)&C_SCOND)^C_SCOND_XOR)<<28 | 0x12fff<<8 | 1<<4 | REGTMP&15 // BX Rtmp + + case 76: /* bx O(R) when returning from fn*/ + c.ctxt.Diag("ABXRET") + + case 77: /* ldrex oreg,reg */ + c.aclass(&p.From) + + if c.instoffset != 0 { + c.ctxt.Diag("offset must be zero in LDREX") + } + o1 = 0x19<<20 | 0xf9f + o1 |= (uint32(p.From.Reg) & 15) << 16 + o1 |= (uint32(p.To.Reg) & 15) << 12 + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + case 78: /* strex reg,oreg,reg */ + c.aclass(&p.From) + + if c.instoffset != 0 { + c.ctxt.Diag("offset must be zero in STREX") + } + if p.To.Reg == p.From.Reg || p.To.Reg == p.Reg { + c.ctxt.Diag("cannot use same register as both source and destination: %v", p) + } + o1 = 0x18<<20 | 0xf90 + o1 |= (uint32(p.From.Reg) & 15) << 16 + o1 |= (uint32(p.Reg) & 15) << 0 + o1 |= (uint32(p.To.Reg) & 15) << 12 + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + case 80: /* fmov zfcon,freg */ + if p.As == AMOVD { + o1 = 0xeeb00b00 // VMOV imm 64 + o2 = c.oprrr(p, ASUBD, int(p.Scond)) + } else { + o1 = 0x0eb00a00 // VMOV imm 32 + o2 = c.oprrr(p, ASUBF, int(p.Scond)) + } + + v := int32(0x70) // 1.0 + r := (int(p.To.Reg) & 15) << 0 + + // movf $1.0, r + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + o1 |= (uint32(r) & 15) << 12 + o1 |= (uint32(v) & 0xf) << 0 + o1 |= (uint32(v) & 0xf0) << 12 + + // subf r,r,r + o2 |= (uint32(r)&15)<<0 | (uint32(r)&15)<<16 | (uint32(r)&15)<<12 + + case 81: /* fmov sfcon,freg */ + o1 = 0x0eb00a00 // VMOV imm 32 + if p.As == AMOVD { + o1 = 0xeeb00b00 // VMOV imm 64 + } + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + o1 |= (uint32(p.To.Reg) & 15) << 12 + v := int32(c.chipfloat5(p.From.Val.(float64))) + o1 |= (uint32(v) & 0xf) << 0 + o1 |= (uint32(v) & 0xf0) << 12 + + case 82: /* fcmp freg,freg, */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.Reg)&15)<<12 | (uint32(p.From.Reg)&15)<<0 + o2 = 0x0ef1fa10 // VMRS R15 + o2 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + case 83: /* fcmp freg,, */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.From.Reg)&15)<<12 | 1<<16 + o2 = 0x0ef1fa10 // VMRS R15 + o2 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + case 84: /* movfw freg,freg - truncate float-to-fix */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.From.Reg) & 15) << 0 + o1 |= (uint32(p.To.Reg) & 15) << 12 + + case 85: /* movwf freg,freg - fix-to-float */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.From.Reg) & 15) << 0 + o1 |= (uint32(p.To.Reg) & 15) << 12 + + // macro for movfw freg,FTMP; movw FTMP,reg + case 86: /* movfw freg,reg - truncate float-to-fix */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.From.Reg) & 15) << 0 + o1 |= (FREGTMP & 15) << 12 + o2 = c.oprrr(p, -AMOVFW, int(p.Scond)) + o2 |= (FREGTMP & 15) << 16 + o2 |= (uint32(p.To.Reg) & 15) << 12 + + // macro for movw reg,FTMP; movwf FTMP,freg + case 87: /* movwf reg,freg - fix-to-float */ + o1 = c.oprrr(p, -AMOVWF, int(p.Scond)) + + o1 |= (uint32(p.From.Reg) & 15) << 12 + o1 |= (FREGTMP & 15) << 16 + o2 = c.oprrr(p, p.As, int(p.Scond)) + o2 |= (FREGTMP & 15) << 0 + o2 |= (uint32(p.To.Reg) & 15) << 12 + + case 88: /* movw reg,freg */ + o1 = c.oprrr(p, -AMOVWF, int(p.Scond)) + + o1 |= (uint32(p.From.Reg) & 15) << 12 + o1 |= (uint32(p.To.Reg) & 15) << 16 + + case 89: /* movw freg,reg */ + o1 = c.oprrr(p, -AMOVFW, int(p.Scond)) + + o1 |= (uint32(p.From.Reg) & 15) << 16 + o1 |= (uint32(p.To.Reg) & 15) << 12 + + case 91: /* ldrexd oreg,reg */ + c.aclass(&p.From) + + if c.instoffset != 0 { + c.ctxt.Diag("offset must be zero in LDREX") + } + o1 = 0x1b<<20 | 0xf9f + o1 |= (uint32(p.From.Reg) & 15) << 16 + o1 |= (uint32(p.To.Reg) & 15) << 12 + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + case 92: /* strexd reg,oreg,reg */ + c.aclass(&p.From) + + if c.instoffset != 0 { + c.ctxt.Diag("offset must be zero in STREX") + } + if p.Reg&1 != 0 { + c.ctxt.Diag("source register must be even in STREXD: %v", p) + } + if p.To.Reg == p.From.Reg || p.To.Reg == p.Reg || p.To.Reg == p.Reg+1 { + c.ctxt.Diag("cannot use same register as both source and destination: %v", p) + } + o1 = 0x1a<<20 | 0xf90 + o1 |= (uint32(p.From.Reg) & 15) << 16 + o1 |= (uint32(p.Reg) & 15) << 0 + o1 |= (uint32(p.To.Reg) & 15) << 12 + o1 |= ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + + case 93: /* movb/movh/movhu addr,R -> ldrsb/ldrsh/ldrh */ + o1 = c.omvl(p, &p.From, REGTMP) + + if o1 == 0 { + break + } + o2 = c.olhr(0, REGTMP, int(p.To.Reg), int(p.Scond)) + if p.As == AMOVB || p.As == AMOVBS { + o2 ^= 1<<5 | 1<<6 + } else if p.As == AMOVH || p.As == AMOVHS { + o2 ^= (1 << 6) + } + if o.flag&LPCREL != 0 { + o3 = o2 + o2 = c.oprrr(p, AADD, int(p.Scond)) | REGTMP&15 | (REGPC&15)<<16 | (REGTMP&15)<<12 + } + + case 94: /* movh/movhu R,addr -> strh */ + o1 = c.omvl(p, &p.To, REGTMP) + + if o1 == 0 { + break + } + o2 = c.oshr(int(p.From.Reg), 0, REGTMP, int(p.Scond)) + if o.flag&LPCREL != 0 { + o3 = o2 + o2 = c.oprrr(p, AADD, int(p.Scond)) | REGTMP&15 | (REGPC&15)<<16 | (REGTMP&15)<<12 + } + + case 95: /* PLD off(reg) */ + o1 = 0xf5d0f000 + + o1 |= (uint32(p.From.Reg) & 15) << 16 + if p.From.Offset < 0 { + o1 &^= (1 << 23) + o1 |= uint32((-p.From.Offset) & 0xfff) + } else { + o1 |= uint32(p.From.Offset & 0xfff) + } + + // This is supposed to be something that stops execution. + // It's not supposed to be reached, ever, but if it is, we'd + // like to be able to tell how we got there. Assemble as + // 0xf7fabcfd which is guaranteed to raise undefined instruction + // exception. + case 96: /* UNDEF */ + o1 = 0xf7fabcfd + + case 97: /* CLZ Rm, Rd */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.To.Reg) & 15) << 12 + o1 |= (uint32(p.From.Reg) & 15) << 0 + + case 98: /* MULW{T,B} Rs, Rm, Rd */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.To.Reg) & 15) << 16 + o1 |= (uint32(p.From.Reg) & 15) << 8 + o1 |= (uint32(p.Reg) & 15) << 0 + + case 99: /* MULAW{T,B} Rs, Rm, Rn, Rd */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + + o1 |= (uint32(p.To.Reg) & 15) << 16 + o1 |= (uint32(p.From.Reg) & 15) << 8 + o1 |= (uint32(p.Reg) & 15) << 0 + o1 |= uint32((p.To.Offset & 15) << 12) + + case 105: /* divhw r,[r,]r */ + o1 = c.oprrr(p, p.As, int(p.Scond)) + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if r == 0 { + r = rt + } + o1 |= (uint32(rf)&15)<<8 | (uint32(r)&15)<<0 | (uint32(rt)&15)<<16 + + case 110: /* dmb [mbop | $con] */ + o1 = 0xf57ff050 + mbop := uint32(0) + + switch c.aclass(&p.From) { + case C_SPR: + for _, f := range mbOp { + if f.reg == p.From.Reg { + mbop = f.enc + break + } + } + case C_RCON: + for _, f := range mbOp { + enc := uint32(c.instoffset) + if f.enc == enc { + mbop = enc + break + } + } + case C_NONE: + mbop = 0xf + } + + if mbop == 0 { + c.ctxt.Diag("illegal mb option:\n%v", p) + } + o1 |= mbop + } + + out[0] = o1 + out[1] = o2 + out[2] = o3 + out[3] = o4 + out[4] = o5 + out[5] = o6 +} + +func (c *ctxt5) movxt(p *obj.Prog) uint32 { + o1 := ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + switch p.As { + case AMOVB, AMOVBS: + o1 |= 0x6af<<16 | 0x7<<4 + case AMOVH, AMOVHS: + o1 |= 0x6bf<<16 | 0x7<<4 + case AMOVBU: + o1 |= 0x6ef<<16 | 0x7<<4 + case AMOVHU: + o1 |= 0x6ff<<16 | 0x7<<4 + default: + c.ctxt.Diag("illegal combination: %v", p) + } + switch p.From.Offset &^ 0xf { + // only 0/8/16/24 bits rotation is accepted + case SHIFT_RR, SHIFT_RR | 8<<7, SHIFT_RR | 16<<7, SHIFT_RR | 24<<7: + o1 |= uint32(p.From.Offset) & 0xc0f + default: + c.ctxt.Diag("illegal shift: %v", p) + } + o1 |= (uint32(p.To.Reg) & 15) << 12 + return o1 +} + +func (c *ctxt5) mov(p *obj.Prog) uint32 { + c.aclass(&p.From) + o1 := c.oprrr(p, p.As, int(p.Scond)) + o1 |= uint32(p.From.Offset) + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = 0 + } + r := int(p.Reg) + if p.As == AMOVW || p.As == AMVN { + r = 0 + } else if r == 0 { + r = rt + } + o1 |= (uint32(r)&15)<<16 | (uint32(rt)&15)<<12 + return o1 +} + +func (c *ctxt5) oprrr(p *obj.Prog, a obj.As, sc int) uint32 { + o := ((uint32(sc) & C_SCOND) ^ C_SCOND_XOR) << 28 + if sc&C_SBIT != 0 { + o |= 1 << 20 + } + switch a { + case ADIVHW: + return o | 0x71<<20 | 0xf<<12 | 0x1<<4 + case ADIVUHW: + return o | 0x73<<20 | 0xf<<12 | 0x1<<4 + case AMMUL: + return o | 0x75<<20 | 0xf<<12 | 0x1<<4 + case AMULS: + return o | 0x6<<20 | 0x9<<4 + case AMMULA: + return o | 0x75<<20 | 0x1<<4 + case AMMULS: + return o | 0x75<<20 | 0xd<<4 + case AMULU, AMUL: + return o | 0x0<<21 | 0x9<<4 + case AMULA: + return o | 0x1<<21 | 0x9<<4 + case AMULLU: + return o | 0x4<<21 | 0x9<<4 + case AMULL: + return o | 0x6<<21 | 0x9<<4 + case AMULALU: + return o | 0x5<<21 | 0x9<<4 + case AMULAL: + return o | 0x7<<21 | 0x9<<4 + case AAND: + return o | 0x0<<21 + case AEOR: + return o | 0x1<<21 + case ASUB: + return o | 0x2<<21 + case ARSB: + return o | 0x3<<21 + case AADD: + return o | 0x4<<21 + case AADC: + return o | 0x5<<21 + case ASBC: + return o | 0x6<<21 + case ARSC: + return o | 0x7<<21 + case ATST: + return o | 0x8<<21 | 1<<20 + case ATEQ: + return o | 0x9<<21 | 1<<20 + case ACMP: + return o | 0xa<<21 | 1<<20 + case ACMN: + return o | 0xb<<21 | 1<<20 + case AORR: + return o | 0xc<<21 + + case AMOVB, AMOVH, AMOVW: + if sc&(C_PBIT|C_WBIT) != 0 { + c.ctxt.Diag("invalid .P/.W suffix: %v", p) + } + return o | 0xd<<21 + case ABIC: + return o | 0xe<<21 + case AMVN: + return o | 0xf<<21 + case ASLL: + return o | 0xd<<21 | 0<<5 + case ASRL: + return o | 0xd<<21 | 1<<5 + case ASRA: + return o | 0xd<<21 | 2<<5 + case ASWI: + return o | 0xf<<24 + + case AADDD: + return o | 0xe<<24 | 0x3<<20 | 0xb<<8 | 0<<4 + case AADDF: + return o | 0xe<<24 | 0x3<<20 | 0xa<<8 | 0<<4 + case ASUBD: + return o | 0xe<<24 | 0x3<<20 | 0xb<<8 | 4<<4 + case ASUBF: + return o | 0xe<<24 | 0x3<<20 | 0xa<<8 | 4<<4 + case AMULD: + return o | 0xe<<24 | 0x2<<20 | 0xb<<8 | 0<<4 + case AMULF: + return o | 0xe<<24 | 0x2<<20 | 0xa<<8 | 0<<4 + case ANMULD: + return o | 0xe<<24 | 0x2<<20 | 0xb<<8 | 0x4<<4 + case ANMULF: + return o | 0xe<<24 | 0x2<<20 | 0xa<<8 | 0x4<<4 + case AMULAD: + return o | 0xe<<24 | 0xb<<8 + case AMULAF: + return o | 0xe<<24 | 0xa<<8 + case AMULSD: + return o | 0xe<<24 | 0xb<<8 | 0x4<<4 + case AMULSF: + return o | 0xe<<24 | 0xa<<8 | 0x4<<4 + case ANMULAD: + return o | 0xe<<24 | 0x1<<20 | 0xb<<8 | 0x4<<4 + case ANMULAF: + return o | 0xe<<24 | 0x1<<20 | 0xa<<8 | 0x4<<4 + case ANMULSD: + return o | 0xe<<24 | 0x1<<20 | 0xb<<8 + case ANMULSF: + return o | 0xe<<24 | 0x1<<20 | 0xa<<8 + case AFMULAD: + return o | 0xe<<24 | 0xa<<20 | 0xb<<8 + case AFMULAF: + return o | 0xe<<24 | 0xa<<20 | 0xa<<8 + case AFMULSD: + return o | 0xe<<24 | 0xa<<20 | 0xb<<8 | 0x4<<4 + case AFMULSF: + return o | 0xe<<24 | 0xa<<20 | 0xa<<8 | 0x4<<4 + case AFNMULAD: + return o | 0xe<<24 | 0x9<<20 | 0xb<<8 | 0x4<<4 + case AFNMULAF: + return o | 0xe<<24 | 0x9<<20 | 0xa<<8 | 0x4<<4 + case AFNMULSD: + return o | 0xe<<24 | 0x9<<20 | 0xb<<8 + case AFNMULSF: + return o | 0xe<<24 | 0x9<<20 | 0xa<<8 + case ADIVD: + return o | 0xe<<24 | 0x8<<20 | 0xb<<8 | 0<<4 + case ADIVF: + return o | 0xe<<24 | 0x8<<20 | 0xa<<8 | 0<<4 + case ASQRTD: + return o | 0xe<<24 | 0xb<<20 | 1<<16 | 0xb<<8 | 0xc<<4 + case ASQRTF: + return o | 0xe<<24 | 0xb<<20 | 1<<16 | 0xa<<8 | 0xc<<4 + case AABSD: + return o | 0xe<<24 | 0xb<<20 | 0<<16 | 0xb<<8 | 0xc<<4 + case AABSF: + return o | 0xe<<24 | 0xb<<20 | 0<<16 | 0xa<<8 | 0xc<<4 + case ANEGD: + return o | 0xe<<24 | 0xb<<20 | 1<<16 | 0xb<<8 | 0x4<<4 + case ANEGF: + return o | 0xe<<24 | 0xb<<20 | 1<<16 | 0xa<<8 | 0x4<<4 + case ACMPD: + return o | 0xe<<24 | 0xb<<20 | 4<<16 | 0xb<<8 | 0xc<<4 + case ACMPF: + return o | 0xe<<24 | 0xb<<20 | 4<<16 | 0xa<<8 | 0xc<<4 + + case AMOVF: + return o | 0xe<<24 | 0xb<<20 | 0<<16 | 0xa<<8 | 4<<4 + case AMOVD: + return o | 0xe<<24 | 0xb<<20 | 0<<16 | 0xb<<8 | 4<<4 + + case AMOVDF: + return o | 0xe<<24 | 0xb<<20 | 7<<16 | 0xa<<8 | 0xc<<4 | 1<<8 // dtof + case AMOVFD: + return o | 0xe<<24 | 0xb<<20 | 7<<16 | 0xa<<8 | 0xc<<4 | 0<<8 // dtof + + case AMOVWF: + if sc&C_UBIT == 0 { + o |= 1 << 7 /* signed */ + } + return o | 0xe<<24 | 0xb<<20 | 8<<16 | 0xa<<8 | 4<<4 | 0<<18 | 0<<8 // toint, double + + case AMOVWD: + if sc&C_UBIT == 0 { + o |= 1 << 7 /* signed */ + } + return o | 0xe<<24 | 0xb<<20 | 8<<16 | 0xa<<8 | 4<<4 | 0<<18 | 1<<8 // toint, double + + case AMOVFW: + if sc&C_UBIT == 0 { + o |= 1 << 16 /* signed */ + } + return o | 0xe<<24 | 0xb<<20 | 8<<16 | 0xa<<8 | 4<<4 | 1<<18 | 0<<8 | 1<<7 // toint, double, trunc + + case AMOVDW: + if sc&C_UBIT == 0 { + o |= 1 << 16 /* signed */ + } + return o | 0xe<<24 | 0xb<<20 | 8<<16 | 0xa<<8 | 4<<4 | 1<<18 | 1<<8 | 1<<7 // toint, double, trunc + + case -AMOVWF: // copy WtoF + return o | 0xe<<24 | 0x0<<20 | 0xb<<8 | 1<<4 + + case -AMOVFW: // copy FtoW + return o | 0xe<<24 | 0x1<<20 | 0xb<<8 | 1<<4 + + case -ACMP: // cmp imm + return o | 0x3<<24 | 0x5<<20 + + case ABFX: + return o | 0x3d<<21 | 0x5<<4 + + case ABFXU: + return o | 0x3f<<21 | 0x5<<4 + + case ABFC: + return o | 0x3e<<21 | 0x1f + + case ABFI: + return o | 0x3e<<21 | 0x1<<4 + + case AXTAB: + return o | 0x6a<<20 | 0x7<<4 + + case AXTAH: + return o | 0x6b<<20 | 0x7<<4 + + case AXTABU: + return o | 0x6e<<20 | 0x7<<4 + + case AXTAHU: + return o | 0x6f<<20 | 0x7<<4 + + // CLZ doesn't support .nil + case ACLZ: + return o&(0xf<<28) | 0x16f<<16 | 0xf1<<4 + + case AREV: + return o&(0xf<<28) | 0x6bf<<16 | 0xf3<<4 + + case AREV16: + return o&(0xf<<28) | 0x6bf<<16 | 0xfb<<4 + + case AREVSH: + return o&(0xf<<28) | 0x6ff<<16 | 0xfb<<4 + + case ARBIT: + return o&(0xf<<28) | 0x6ff<<16 | 0xf3<<4 + + case AMULWT: + return o&(0xf<<28) | 0x12<<20 | 0xe<<4 + + case AMULWB: + return o&(0xf<<28) | 0x12<<20 | 0xa<<4 + + case AMULBB: + return o&(0xf<<28) | 0x16<<20 | 0x8<<4 + + case AMULAWT: + return o&(0xf<<28) | 0x12<<20 | 0xc<<4 + + case AMULAWB: + return o&(0xf<<28) | 0x12<<20 | 0x8<<4 + + case AMULABB: + return o&(0xf<<28) | 0x10<<20 | 0x8<<4 + + case ABL: // BLX REG + return o&(0xf<<28) | 0x12fff3<<4 + } + + c.ctxt.Diag("%v: bad rrr %d", p, a) + return 0 +} + +func (c *ctxt5) opbra(p *obj.Prog, a obj.As, sc int) uint32 { + sc &= C_SCOND + sc ^= C_SCOND_XOR + if a == ABL || a == obj.ADUFFZERO || a == obj.ADUFFCOPY { + return uint32(sc)<<28 | 0x5<<25 | 0x1<<24 + } + if sc != 0xe { + c.ctxt.Diag("%v: .COND on bcond instruction", p) + } + switch a { + case ABEQ: + return 0x0<<28 | 0x5<<25 + case ABNE: + return 0x1<<28 | 0x5<<25 + case ABCS: + return 0x2<<28 | 0x5<<25 + case ABHS: + return 0x2<<28 | 0x5<<25 + case ABCC: + return 0x3<<28 | 0x5<<25 + case ABLO: + return 0x3<<28 | 0x5<<25 + case ABMI: + return 0x4<<28 | 0x5<<25 + case ABPL: + return 0x5<<28 | 0x5<<25 + case ABVS: + return 0x6<<28 | 0x5<<25 + case ABVC: + return 0x7<<28 | 0x5<<25 + case ABHI: + return 0x8<<28 | 0x5<<25 + case ABLS: + return 0x9<<28 | 0x5<<25 + case ABGE: + return 0xa<<28 | 0x5<<25 + case ABLT: + return 0xb<<28 | 0x5<<25 + case ABGT: + return 0xc<<28 | 0x5<<25 + case ABLE: + return 0xd<<28 | 0x5<<25 + case AB: + return 0xe<<28 | 0x5<<25 + } + + c.ctxt.Diag("%v: bad bra %v", p, a) + return 0 +} + +func (c *ctxt5) olr(v int32, b int, r int, sc int) uint32 { + o := ((uint32(sc) & C_SCOND) ^ C_SCOND_XOR) << 28 + if sc&C_PBIT == 0 { + o |= 1 << 24 + } + if sc&C_UBIT == 0 { + o |= 1 << 23 + } + if sc&C_WBIT != 0 { + o |= 1 << 21 + } + o |= 1<<26 | 1<<20 + if v < 0 { + if sc&C_UBIT != 0 { + c.ctxt.Diag(".U on neg offset") + } + v = -v + o ^= 1 << 23 + } + + if v >= 1<<12 || v < 0 { + c.ctxt.Diag("literal span too large: %d (R%d)\n%v", v, b, c.printp) + } + o |= uint32(v) + o |= (uint32(b) & 15) << 16 + o |= (uint32(r) & 15) << 12 + return o +} + +func (c *ctxt5) olhr(v int32, b int, r int, sc int) uint32 { + o := ((uint32(sc) & C_SCOND) ^ C_SCOND_XOR) << 28 + if sc&C_PBIT == 0 { + o |= 1 << 24 + } + if sc&C_WBIT != 0 { + o |= 1 << 21 + } + o |= 1<<23 | 1<<20 | 0xb<<4 + if v < 0 { + v = -v + o ^= 1 << 23 + } + + if v >= 1<<8 || v < 0 { + c.ctxt.Diag("literal span too large: %d (R%d)\n%v", v, b, c.printp) + } + o |= uint32(v)&0xf | (uint32(v)>>4)<<8 | 1<<22 + o |= (uint32(b) & 15) << 16 + o |= (uint32(r) & 15) << 12 + return o +} + +func (c *ctxt5) osr(a obj.As, r int, v int32, b int, sc int) uint32 { + o := c.olr(v, b, r, sc) ^ (1 << 20) + if a != AMOVW { + o |= 1 << 22 + } + return o +} + +func (c *ctxt5) oshr(r int, v int32, b int, sc int) uint32 { + o := c.olhr(v, b, r, sc) ^ (1 << 20) + return o +} + +func (c *ctxt5) osrr(r int, i int, b int, sc int) uint32 { + return c.olr(int32(i), b, r, sc) ^ (1<<25 | 1<<20) +} + +func (c *ctxt5) oshrr(r int, i int, b int, sc int) uint32 { + return c.olhr(int32(i), b, r, sc) ^ (1<<22 | 1<<20) +} + +func (c *ctxt5) olrr(i int, b int, r int, sc int) uint32 { + return c.olr(int32(i), b, r, sc) ^ (1 << 25) +} + +func (c *ctxt5) olhrr(i int, b int, r int, sc int) uint32 { + return c.olhr(int32(i), b, r, sc) ^ (1 << 22) +} + +func (c *ctxt5) ofsr(a obj.As, r int, v int32, b int, sc int, p *obj.Prog) uint32 { + o := ((uint32(sc) & C_SCOND) ^ C_SCOND_XOR) << 28 + if sc&C_PBIT == 0 { + o |= 1 << 24 + } + if sc&C_WBIT != 0 { + o |= 1 << 21 + } + o |= 6<<25 | 1<<24 | 1<<23 | 10<<8 + if v < 0 { + v = -v + o ^= 1 << 23 + } + + if v&3 != 0 { + c.ctxt.Diag("odd offset for floating point op: %d\n%v", v, p) + } else if v >= 1<<10 || v < 0 { + c.ctxt.Diag("literal span too large: %d\n%v", v, p) + } + o |= (uint32(v) >> 2) & 0xFF + o |= (uint32(b) & 15) << 16 + o |= (uint32(r) & 15) << 12 + + switch a { + default: + c.ctxt.Diag("bad fst %v", a) + fallthrough + + case AMOVD: + o |= 1 << 8 + fallthrough + + case AMOVF: + break + } + + return o +} + +// MOVW $"lower 16-bit", Reg +func (c *ctxt5) omvs(p *obj.Prog, a *obj.Addr, dr int) uint32 { + o1 := ((uint32(p.Scond) & C_SCOND) ^ C_SCOND_XOR) << 28 + o1 |= 0x30 << 20 + o1 |= (uint32(dr) & 15) << 12 + o1 |= uint32(a.Offset) & 0x0fff + o1 |= (uint32(a.Offset) & 0xf000) << 4 + return o1 +} + +// MVN $C_NCON, Reg -> MOVW $C_RCON, Reg +func (c *ctxt5) omvr(p *obj.Prog, a *obj.Addr, dr int) uint32 { + o1 := c.oprrr(p, AMOVW, int(p.Scond)) + o1 |= (uint32(dr) & 15) << 12 + v := immrot(^uint32(a.Offset)) + if v == 0 { + c.ctxt.Diag("%v: missing literal", p) + return 0 + } + o1 |= uint32(v) + return o1 +} + +func (c *ctxt5) omvl(p *obj.Prog, a *obj.Addr, dr int) uint32 { + var o1 uint32 + if p.Pool == nil { + c.aclass(a) + v := immrot(^uint32(c.instoffset)) + if v == 0 { + c.ctxt.Diag("%v: missing literal", p) + return 0 + } + + o1 = c.oprrr(p, AMVN, int(p.Scond)&C_SCOND) + o1 |= uint32(v) + o1 |= (uint32(dr) & 15) << 12 + } else { + v := int32(p.Pool.Pc - p.Pc - 8) + o1 = c.olr(v, REGPC, dr, int(p.Scond)&C_SCOND) + } + + return o1 +} + +func (c *ctxt5) chipzero5(e float64) int { + // We use GOARM=7 to gate the use of VFPv3 vmov (imm) instructions. + if objabi.GOARM < 7 || math.Float64bits(e) != 0 { + return -1 + } + return 0 +} + +func (c *ctxt5) chipfloat5(e float64) int { + // We use GOARM=7 to gate the use of VFPv3 vmov (imm) instructions. + if objabi.GOARM < 7 { + return -1 + } + + ei := math.Float64bits(e) + l := uint32(ei) + h := uint32(ei >> 32) + + if l != 0 || h&0xffff != 0 { + return -1 + } + h1 := h & 0x7fc00000 + if h1 != 0x40000000 && h1 != 0x3fc00000 { + return -1 + } + n := 0 + + // sign bit (a) + if h&0x80000000 != 0 { + n |= 1 << 7 + } + + // exp sign bit (b) + if h1 == 0x3fc00000 { + n |= 1 << 6 + } + + // rest of exp and mantissa (cd-efgh) + n |= int((h >> 16) & 0x3f) + + //print("match %.8lux %.8lux %d\n", l, h, n); + return n +} + +func nocache(p *obj.Prog) { + p.Optab = 0 + p.From.Class = 0 + if p.GetFrom3() != nil { + p.GetFrom3().Class = 0 + } + p.To.Class = 0 +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/list5.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/list5.go new file mode 100644 index 00000000..30e03001 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm/list5.go @@ -0,0 +1,124 @@ +// Inferno utils/5c/list.c +// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/5c/list.c +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package arm + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "fmt" +) + +func init() { + obj.RegisterRegister(obj.RBaseARM, MAXREG, rconv) + obj.RegisterOpcode(obj.ABaseARM, Anames) + obj.RegisterRegisterList(obj.RegListARMLo, obj.RegListARMHi, rlconv) + obj.RegisterOpSuffix("arm", obj.CConvARM) +} + +func rconv(r int) string { + if r == 0 { + return "NONE" + } + if r == REGG { + // Special case. + return "g" + } + if REG_R0 <= r && r <= REG_R15 { + return fmt.Sprintf("R%d", r-REG_R0) + } + if REG_F0 <= r && r <= REG_F15 { + return fmt.Sprintf("F%d", r-REG_F0) + } + + switch r { + case REG_FPSR: + return "FPSR" + + case REG_FPCR: + return "FPCR" + + case REG_CPSR: + return "CPSR" + + case REG_SPSR: + return "SPSR" + + case REG_MB_SY: + return "MB_SY" + case REG_MB_ST: + return "MB_ST" + case REG_MB_ISH: + return "MB_ISH" + case REG_MB_ISHST: + return "MB_ISHST" + case REG_MB_NSH: + return "MB_NSH" + case REG_MB_NSHST: + return "MB_NSHST" + case REG_MB_OSH: + return "MB_OSH" + case REG_MB_OSHST: + return "MB_OSHST" + } + + return fmt.Sprintf("Rgok(%d)", r-obj.RBaseARM) +} + +func DRconv(a int) string { + s := "C_??" + if a >= C_NONE && a <= C_NCLASS { + s = cnames5[a] + } + var fp string + fp += s + return fp +} + +func rlconv(list int64) string { + str := "" + for i := 0; i < 16; i++ { + if list&(1<, C13, C0, 3 specially. + case AMRC: + if p.To.Offset&0xffff0fff == 0xee1d0f70 { + // Because the instruction might be rewritten to a BL which returns in R0 + // the register must be zero. + if p.To.Offset&0xf000 != 0 { + ctxt.Diag("%v: TLS MRC instruction must write to R0 as it might get translated into a BL instruction", p.Line()) + } + + if objabi.GOARM < 7 { + // Replace it with BL runtime.read_tls_fallback(SB) for ARM CPUs that lack the tls extension. + if progedit_tlsfallback == nil { + progedit_tlsfallback = ctxt.Lookup("runtime.read_tls_fallback") + } + + // MOVW LR, R11 + p.As = AMOVW + + p.From.Type = obj.TYPE_REG + p.From.Reg = REGLINK + p.To.Type = obj.TYPE_REG + p.To.Reg = REGTMP + + // BL runtime.read_tls_fallback(SB) + p = obj.Appendp(p, newprog) + + p.As = ABL + p.To.Type = obj.TYPE_BRANCH + p.To.Sym = progedit_tlsfallback + p.To.Offset = 0 + + // MOVW R11, LR + p = obj.Appendp(p, newprog) + + p.As = AMOVW + p.From.Type = obj.TYPE_REG + p.From.Reg = REGTMP + p.To.Type = obj.TYPE_REG + p.To.Reg = REGLINK + break + } + } + + // Otherwise, MRC/MCR instructions need no further treatment. + p.As = AWORD + } + + // Rewrite float constants to values stored in memory. + switch p.As { + case AMOVF: + if p.From.Type == obj.TYPE_FCONST && c.chipfloat5(p.From.Val.(float64)) < 0 && (c.chipzero5(p.From.Val.(float64)) < 0 || p.Scond&C_SCOND != C_SCOND_NONE) { + f32 := float32(p.From.Val.(float64)) + p.From.Type = obj.TYPE_MEM + p.From.Sym = ctxt.Float32Sym(f32) + p.From.Name = obj.NAME_EXTERN + p.From.Offset = 0 + } + + case AMOVD: + if p.From.Type == obj.TYPE_FCONST && c.chipfloat5(p.From.Val.(float64)) < 0 && (c.chipzero5(p.From.Val.(float64)) < 0 || p.Scond&C_SCOND != C_SCOND_NONE) { + p.From.Type = obj.TYPE_MEM + p.From.Sym = ctxt.Float64Sym(p.From.Val.(float64)) + p.From.Name = obj.NAME_EXTERN + p.From.Offset = 0 + } + } + + if ctxt.Flag_dynlink { + c.rewriteToUseGot(p) + } +} + +// Rewrite p, if necessary, to access global data via the global offset table. +func (c *ctxt5) rewriteToUseGot(p *obj.Prog) { + if p.As == obj.ADUFFCOPY || p.As == obj.ADUFFZERO { + // ADUFFxxx $offset + // becomes + // MOVW runtime.duffxxx@GOT, R9 + // ADD $offset, R9 + // CALL (R9) + var sym *obj.LSym + if p.As == obj.ADUFFZERO { + sym = c.ctxt.Lookup("runtime.duffzero") + } else { + sym = c.ctxt.Lookup("runtime.duffcopy") + } + offset := p.To.Offset + p.As = AMOVW + p.From.Type = obj.TYPE_MEM + p.From.Name = obj.NAME_GOTREF + p.From.Sym = sym + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R9 + p.To.Name = obj.NAME_NONE + p.To.Offset = 0 + p.To.Sym = nil + p1 := obj.Appendp(p, c.newprog) + p1.As = AADD + p1.From.Type = obj.TYPE_CONST + p1.From.Offset = offset + p1.To.Type = obj.TYPE_REG + p1.To.Reg = REG_R9 + p2 := obj.Appendp(p1, c.newprog) + p2.As = obj.ACALL + p2.To.Type = obj.TYPE_MEM + p2.To.Reg = REG_R9 + return + } + + // We only care about global data: NAME_EXTERN means a global + // symbol in the Go sense, and p.Sym.Local is true for a few + // internally defined symbols. + if p.From.Type == obj.TYPE_ADDR && p.From.Name == obj.NAME_EXTERN && !p.From.Sym.Local() { + // MOVW $sym, Rx becomes MOVW sym@GOT, Rx + // MOVW $sym+, Rx becomes MOVW sym@GOT, Rx; ADD , Rx + if p.As != AMOVW { + c.ctxt.Diag("do not know how to handle TYPE_ADDR in %v with -dynlink", p) + } + if p.To.Type != obj.TYPE_REG { + c.ctxt.Diag("do not know how to handle LEAQ-type insn to non-register in %v with -dynlink", p) + } + p.From.Type = obj.TYPE_MEM + p.From.Name = obj.NAME_GOTREF + if p.From.Offset != 0 { + q := obj.Appendp(p, c.newprog) + q.As = AADD + q.From.Type = obj.TYPE_CONST + q.From.Offset = p.From.Offset + q.To = p.To + p.From.Offset = 0 + } + } + if p.GetFrom3() != nil && p.GetFrom3().Name == obj.NAME_EXTERN { + c.ctxt.Diag("don't know how to handle %v with -dynlink", p) + } + var source *obj.Addr + // MOVx sym, Ry becomes MOVW sym@GOT, R9; MOVx (R9), Ry + // MOVx Ry, sym becomes MOVW sym@GOT, R9; MOVx Ry, (R9) + // An addition may be inserted between the two MOVs if there is an offset. + if p.From.Name == obj.NAME_EXTERN && !p.From.Sym.Local() { + if p.To.Name == obj.NAME_EXTERN && !p.To.Sym.Local() { + c.ctxt.Diag("cannot handle NAME_EXTERN on both sides in %v with -dynlink", p) + } + source = &p.From + } else if p.To.Name == obj.NAME_EXTERN && !p.To.Sym.Local() { + source = &p.To + } else { + return + } + if p.As == obj.ATEXT || p.As == obj.AFUNCDATA || p.As == obj.ACALL || p.As == obj.ARET || p.As == obj.AJMP { + return + } + if source.Sym.Type == objabi.STLSBSS { + return + } + if source.Type != obj.TYPE_MEM { + c.ctxt.Diag("don't know how to handle %v with -dynlink", p) + } + p1 := obj.Appendp(p, c.newprog) + p2 := obj.Appendp(p1, c.newprog) + + p1.As = AMOVW + p1.From.Type = obj.TYPE_MEM + p1.From.Sym = source.Sym + p1.From.Name = obj.NAME_GOTREF + p1.To.Type = obj.TYPE_REG + p1.To.Reg = REG_R9 + + p2.As = p.As + p2.From = p.From + p2.To = p.To + if p.From.Name == obj.NAME_EXTERN { + p2.From.Reg = REG_R9 + p2.From.Name = obj.NAME_NONE + p2.From.Sym = nil + } else if p.To.Name == obj.NAME_EXTERN { + p2.To.Reg = REG_R9 + p2.To.Name = obj.NAME_NONE + p2.To.Sym = nil + } else { + return + } + obj.Nopout(p) +} + +// Prog.mark +const ( + FOLL = 1 << 0 + LABEL = 1 << 1 + LEAF = 1 << 2 +) + +func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { + autosize := int32(0) + + if cursym.Func.Text == nil || cursym.Func.Text.Link == nil { + return + } + + c := ctxt5{ctxt: ctxt, cursym: cursym, newprog: newprog} + + p := c.cursym.Func.Text + autoffset := int32(p.To.Offset) + if autoffset == -4 { + // Historical way to mark NOFRAME. + p.From.Sym.Set(obj.AttrNoFrame, true) + autoffset = 0 + } + if autoffset < 0 || autoffset%4 != 0 { + c.ctxt.Diag("frame size %d not 0 or a positive multiple of 4", autoffset) + } + if p.From.Sym.NoFrame() { + if autoffset != 0 { + c.ctxt.Diag("NOFRAME functions must have a frame size of 0, not %d", autoffset) + } + } + + cursym.Func.Locals = autoffset + cursym.Func.Args = p.To.Val.(int32) + + /* + * find leaf subroutines + */ + for p := cursym.Func.Text; p != nil; p = p.Link { + switch p.As { + case obj.ATEXT: + p.Mark |= LEAF + + case ADIV, ADIVU, AMOD, AMODU: + cursym.Func.Text.Mark &^= LEAF + + case ABL, + ABX, + obj.ADUFFZERO, + obj.ADUFFCOPY: + cursym.Func.Text.Mark &^= LEAF + } + } + + var q2 *obj.Prog + for p := cursym.Func.Text; p != nil; p = p.Link { + o := p.As + switch o { + case obj.ATEXT: + autosize = autoffset + + if p.Mark&LEAF != 0 && autosize == 0 { + // A leaf function with no locals has no frame. + p.From.Sym.Set(obj.AttrNoFrame, true) + } + + if !p.From.Sym.NoFrame() { + // If there is a stack frame at all, it includes + // space to save the LR. + autosize += 4 + } + + if autosize == 0 && cursym.Func.Text.Mark&LEAF == 0 { + // A very few functions that do not return to their caller + // are not identified as leaves but still have no frame. + if ctxt.Debugvlog { + ctxt.Logf("save suppressed in: %s\n", cursym.Name) + } + + cursym.Func.Text.Mark |= LEAF + } + + // FP offsets need an updated p.To.Offset. + p.To.Offset = int64(autosize) - 4 + + if cursym.Func.Text.Mark&LEAF != 0 { + cursym.Set(obj.AttrLeaf, true) + if p.From.Sym.NoFrame() { + break + } + } + + if !p.From.Sym.NoSplit() { + p = c.stacksplit(p, autosize) // emit split check + } + + // MOVW.W R14,$-autosize(SP) + p = obj.Appendp(p, c.newprog) + + p.As = AMOVW + p.Scond |= C_WBIT + p.From.Type = obj.TYPE_REG + p.From.Reg = REGLINK + p.To.Type = obj.TYPE_MEM + p.To.Offset = int64(-autosize) + p.To.Reg = REGSP + p.Spadj = autosize + + if cursym.Func.Text.From.Sym.Wrapper() { + // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame + // + // MOVW g_panic(g), R1 + // CMP $0, R1 + // B.NE checkargp + // end: + // NOP + // ... function ... + // checkargp: + // MOVW panic_argp(R1), R2 + // ADD $(autosize+4), R13, R3 + // CMP R2, R3 + // B.NE end + // ADD $4, R13, R4 + // MOVW R4, panic_argp(R1) + // B end + // + // The NOP is needed to give the jumps somewhere to land. + // It is a liblink NOP, not an ARM NOP: it encodes to 0 instruction bytes. + + p = obj.Appendp(p, newprog) + p.As = AMOVW + p.From.Type = obj.TYPE_MEM + p.From.Reg = REGG + p.From.Offset = 4 * int64(ctxt.Arch.PtrSize) // G.panic + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R1 + + p = obj.Appendp(p, newprog) + p.As = ACMP + p.From.Type = obj.TYPE_CONST + p.From.Offset = 0 + p.Reg = REG_R1 + + // B.NE checkargp + bne := obj.Appendp(p, newprog) + bne.As = ABNE + bne.To.Type = obj.TYPE_BRANCH + + // end: NOP + end := obj.Appendp(bne, newprog) + end.As = obj.ANOP + + // find end of function + var last *obj.Prog + for last = end; last.Link != nil; last = last.Link { + } + + // MOVW panic_argp(R1), R2 + mov := obj.Appendp(last, newprog) + mov.As = AMOVW + mov.From.Type = obj.TYPE_MEM + mov.From.Reg = REG_R1 + mov.From.Offset = 0 // Panic.argp + mov.To.Type = obj.TYPE_REG + mov.To.Reg = REG_R2 + + // B.NE branch target is MOVW above + bne.To.SetTarget(mov) + + // ADD $(autosize+4), R13, R3 + p = obj.Appendp(mov, newprog) + p.As = AADD + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(autosize) + 4 + p.Reg = REG_R13 + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R3 + + // CMP R2, R3 + p = obj.Appendp(p, newprog) + p.As = ACMP + p.From.Type = obj.TYPE_REG + p.From.Reg = REG_R2 + p.Reg = REG_R3 + + // B.NE end + p = obj.Appendp(p, newprog) + p.As = ABNE + p.To.Type = obj.TYPE_BRANCH + p.To.SetTarget(end) + + // ADD $4, R13, R4 + p = obj.Appendp(p, newprog) + p.As = AADD + p.From.Type = obj.TYPE_CONST + p.From.Offset = 4 + p.Reg = REG_R13 + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R4 + + // MOVW R4, panic_argp(R1) + p = obj.Appendp(p, newprog) + p.As = AMOVW + p.From.Type = obj.TYPE_REG + p.From.Reg = REG_R4 + p.To.Type = obj.TYPE_MEM + p.To.Reg = REG_R1 + p.To.Offset = 0 // Panic.argp + + // B end + p = obj.Appendp(p, newprog) + p.As = AB + p.To.Type = obj.TYPE_BRANCH + p.To.SetTarget(end) + + // reset for subsequent passes + p = end + } + + case obj.ARET: + nocache(p) + if cursym.Func.Text.Mark&LEAF != 0 { + if autosize == 0 { + p.As = AB + p.From = obj.Addr{} + if p.To.Sym != nil { // retjmp + p.To.Type = obj.TYPE_BRANCH + } else { + p.To.Type = obj.TYPE_MEM + p.To.Offset = 0 + p.To.Reg = REGLINK + } + + break + } + } + + p.As = AMOVW + p.Scond |= C_PBIT + p.From.Type = obj.TYPE_MEM + p.From.Offset = int64(autosize) + p.From.Reg = REGSP + p.To.Type = obj.TYPE_REG + p.To.Reg = REGPC + + // If there are instructions following + // this ARET, they come from a branch + // with the same stackframe, so no spadj. + if p.To.Sym != nil { // retjmp + p.To.Reg = REGLINK + q2 = obj.Appendp(p, newprog) + q2.As = AB + q2.To.Type = obj.TYPE_BRANCH + q2.To.Sym = p.To.Sym + p.To.Sym = nil + p = q2 + } + + case AADD: + if p.From.Type == obj.TYPE_CONST && p.From.Reg == 0 && p.To.Type == obj.TYPE_REG && p.To.Reg == REGSP { + p.Spadj = int32(-p.From.Offset) + } + + case ASUB: + if p.From.Type == obj.TYPE_CONST && p.From.Reg == 0 && p.To.Type == obj.TYPE_REG && p.To.Reg == REGSP { + p.Spadj = int32(p.From.Offset) + } + + case ADIV, ADIVU, AMOD, AMODU: + if cursym.Func.Text.From.Sym.NoSplit() { + ctxt.Diag("cannot divide in NOSPLIT function") + } + const debugdivmod = false + if debugdivmod { + break + } + if p.From.Type != obj.TYPE_REG { + break + } + if p.To.Type != obj.TYPE_REG { + break + } + + // Make copy because we overwrite p below. + q1 := *p + if q1.Reg == REGTMP || q1.Reg == 0 && q1.To.Reg == REGTMP { + ctxt.Diag("div already using REGTMP: %v", p) + } + + /* MOV m(g),REGTMP */ + p.As = AMOVW + p.Pos = q1.Pos + p.From.Type = obj.TYPE_MEM + p.From.Reg = REGG + p.From.Offset = 6 * 4 // offset of g.m + p.Reg = 0 + p.To.Type = obj.TYPE_REG + p.To.Reg = REGTMP + + /* MOV a,m_divmod(REGTMP) */ + p = obj.Appendp(p, newprog) + p.As = AMOVW + p.Pos = q1.Pos + p.From.Type = obj.TYPE_REG + p.From.Reg = q1.From.Reg + p.To.Type = obj.TYPE_MEM + p.To.Reg = REGTMP + p.To.Offset = 8 * 4 // offset of m.divmod + + /* MOV b, R8 */ + p = obj.Appendp(p, newprog) + p.As = AMOVW + p.Pos = q1.Pos + p.From.Type = obj.TYPE_REG + p.From.Reg = q1.Reg + if q1.Reg == 0 { + p.From.Reg = q1.To.Reg + } + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R8 + p.To.Offset = 0 + + /* CALL appropriate */ + p = obj.Appendp(p, newprog) + p.As = ABL + p.Pos = q1.Pos + p.To.Type = obj.TYPE_BRANCH + switch o { + case ADIV: + p.To.Sym = symdiv + case ADIVU: + p.To.Sym = symdivu + case AMOD: + p.To.Sym = symmod + case AMODU: + p.To.Sym = symmodu + } + + /* MOV REGTMP, b */ + p = obj.Appendp(p, newprog) + p.As = AMOVW + p.Pos = q1.Pos + p.From.Type = obj.TYPE_REG + p.From.Reg = REGTMP + p.From.Offset = 0 + p.To.Type = obj.TYPE_REG + p.To.Reg = q1.To.Reg + + case AMOVW: + if (p.Scond&C_WBIT != 0) && p.To.Type == obj.TYPE_MEM && p.To.Reg == REGSP { + p.Spadj = int32(-p.To.Offset) + } + if (p.Scond&C_PBIT != 0) && p.From.Type == obj.TYPE_MEM && p.From.Reg == REGSP && p.To.Reg != REGPC { + p.Spadj = int32(-p.From.Offset) + } + if p.From.Type == obj.TYPE_ADDR && p.From.Reg == REGSP && p.To.Type == obj.TYPE_REG && p.To.Reg == REGSP { + p.Spadj = int32(-p.From.Offset) + } + + case obj.AGETCALLERPC: + if cursym.Leaf() { + /* MOVW LR, Rd */ + p.As = AMOVW + p.From.Type = obj.TYPE_REG + p.From.Reg = REGLINK + } else { + /* MOVW (RSP), Rd */ + p.As = AMOVW + p.From.Type = obj.TYPE_MEM + p.From.Reg = REGSP + } + } + } +} + +func (c *ctxt5) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { + // MOVW g_stackguard(g), R1 + p = obj.Appendp(p, c.newprog) + + p.As = AMOVW + p.From.Type = obj.TYPE_MEM + p.From.Reg = REGG + p.From.Offset = 2 * int64(c.ctxt.Arch.PtrSize) // G.stackguard0 + if c.cursym.CFunc() { + p.From.Offset = 3 * int64(c.ctxt.Arch.PtrSize) // G.stackguard1 + } + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R1 + + // Mark the stack bound check and morestack call async nonpreemptible. + // If we get preempted here, when resumed the preemption request is + // cleared, but we'll still call morestack, which will double the stack + // unnecessarily. See issue #35470. + p = c.ctxt.StartUnsafePoint(p, c.newprog) + + if framesize <= objabi.StackSmall { + // small stack: SP < stackguard + // CMP stackguard, SP + p = obj.Appendp(p, c.newprog) + + p.As = ACMP + p.From.Type = obj.TYPE_REG + p.From.Reg = REG_R1 + p.Reg = REGSP + } else if framesize <= objabi.StackBig { + // large stack: SP-framesize < stackguard-StackSmall + // MOVW $-(framesize-StackSmall)(SP), R2 + // CMP stackguard, R2 + p = obj.Appendp(p, c.newprog) + + p.As = AMOVW + p.From.Type = obj.TYPE_ADDR + p.From.Reg = REGSP + p.From.Offset = -(int64(framesize) - objabi.StackSmall) + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R2 + + p = obj.Appendp(p, c.newprog) + p.As = ACMP + p.From.Type = obj.TYPE_REG + p.From.Reg = REG_R1 + p.Reg = REG_R2 + } else { + // Such a large stack we need to protect against wraparound + // if SP is close to zero. + // SP-stackguard+StackGuard < framesize + (StackGuard-StackSmall) + // The +StackGuard on both sides is required to keep the left side positive: + // SP is allowed to be slightly below stackguard. See stack.h. + // CMP $StackPreempt, R1 + // MOVW.NE $StackGuard(SP), R2 + // SUB.NE R1, R2 + // MOVW.NE $(framesize+(StackGuard-StackSmall)), R3 + // CMP.NE R3, R2 + p = obj.Appendp(p, c.newprog) + + p.As = ACMP + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(uint32(objabi.StackPreempt & (1<<32 - 1))) + p.Reg = REG_R1 + + p = obj.Appendp(p, c.newprog) + p.As = AMOVW + p.From.Type = obj.TYPE_ADDR + p.From.Reg = REGSP + p.From.Offset = int64(objabi.StackGuard) + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R2 + p.Scond = C_SCOND_NE + + p = obj.Appendp(p, c.newprog) + p.As = ASUB + p.From.Type = obj.TYPE_REG + p.From.Reg = REG_R1 + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R2 + p.Scond = C_SCOND_NE + + p = obj.Appendp(p, c.newprog) + p.As = AMOVW + p.From.Type = obj.TYPE_ADDR + p.From.Offset = int64(framesize) + (int64(objabi.StackGuard) - objabi.StackSmall) + p.To.Type = obj.TYPE_REG + p.To.Reg = REG_R3 + p.Scond = C_SCOND_NE + + p = obj.Appendp(p, c.newprog) + p.As = ACMP + p.From.Type = obj.TYPE_REG + p.From.Reg = REG_R3 + p.Reg = REG_R2 + p.Scond = C_SCOND_NE + } + + // BLS call-to-morestack + bls := obj.Appendp(p, c.newprog) + bls.As = ABLS + bls.To.Type = obj.TYPE_BRANCH + + end := c.ctxt.EndUnsafePoint(bls, c.newprog, -1) + + var last *obj.Prog + for last = c.cursym.Func.Text; last.Link != nil; last = last.Link { + } + + // Now we are at the end of the function, but logically + // we are still in function prologue. We need to fix the + // SP data and PCDATA. + spfix := obj.Appendp(last, c.newprog) + spfix.As = obj.ANOP + spfix.Spadj = -framesize + + pcdata := c.ctxt.EmitEntryStackMap(c.cursym, spfix, c.newprog) + pcdata = c.ctxt.StartUnsafePoint(pcdata, c.newprog) + + // MOVW LR, R3 + movw := obj.Appendp(pcdata, c.newprog) + movw.As = AMOVW + movw.From.Type = obj.TYPE_REG + movw.From.Reg = REGLINK + movw.To.Type = obj.TYPE_REG + movw.To.Reg = REG_R3 + + bls.To.SetTarget(movw) + + // BL runtime.morestack + call := obj.Appendp(movw, c.newprog) + call.As = obj.ACALL + call.To.Type = obj.TYPE_BRANCH + morestack := "runtime.morestack" + switch { + case c.cursym.CFunc(): + morestack = "runtime.morestackc" + case !c.cursym.Func.Text.From.Sym.NeedCtxt(): + morestack = "runtime.morestack_noctxt" + } + call.To.Sym = c.ctxt.Lookup(morestack) + + pcdata = c.ctxt.EndUnsafePoint(call, c.newprog, -1) + + // B start + b := obj.Appendp(pcdata, c.newprog) + b.As = obj.AJMP + b.To.Type = obj.TYPE_BRANCH + b.To.SetTarget(c.cursym.Func.Text.Link) + b.Spadj = +framesize + + return end +} + +var unaryDst = map[obj.As]bool{ + ASWI: true, + AWORD: true, +} + +var Linkarm = obj.LinkArch{ + Arch: sys.ArchARM, + Init: buildop, + Preprocess: preprocess, + Assemble: span5, + Progedit: progedit, + UnaryDst: unaryDst, + DWARFRegisters: ARMDWARFRegisters, +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/a.out.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/a.out.go new file mode 100644 index 00000000..04c084ea --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/a.out.go @@ -0,0 +1,1033 @@ +// cmd/7c/7.out.h from Vita Nuova. +// https://code.google.com/p/ken-cc/source/browse/src/cmd/7c/7.out.h +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package arm64 + +import "github.com/twitchyliquid64/golang-asm/obj" + +const ( + NSNAME = 8 + NSYM = 50 + NREG = 32 /* number of general registers */ + NFREG = 32 /* number of floating point registers */ +) + +// General purpose registers, kept in the low bits of Prog.Reg. +const ( + // integer + REG_R0 = obj.RBaseARM64 + iota + REG_R1 + REG_R2 + REG_R3 + REG_R4 + REG_R5 + REG_R6 + REG_R7 + REG_R8 + REG_R9 + REG_R10 + REG_R11 + REG_R12 + REG_R13 + REG_R14 + REG_R15 + REG_R16 + REG_R17 + REG_R18 + REG_R19 + REG_R20 + REG_R21 + REG_R22 + REG_R23 + REG_R24 + REG_R25 + REG_R26 + REG_R27 + REG_R28 + REG_R29 + REG_R30 + REG_R31 + + // scalar floating point + REG_F0 + REG_F1 + REG_F2 + REG_F3 + REG_F4 + REG_F5 + REG_F6 + REG_F7 + REG_F8 + REG_F9 + REG_F10 + REG_F11 + REG_F12 + REG_F13 + REG_F14 + REG_F15 + REG_F16 + REG_F17 + REG_F18 + REG_F19 + REG_F20 + REG_F21 + REG_F22 + REG_F23 + REG_F24 + REG_F25 + REG_F26 + REG_F27 + REG_F28 + REG_F29 + REG_F30 + REG_F31 + + // SIMD + REG_V0 + REG_V1 + REG_V2 + REG_V3 + REG_V4 + REG_V5 + REG_V6 + REG_V7 + REG_V8 + REG_V9 + REG_V10 + REG_V11 + REG_V12 + REG_V13 + REG_V14 + REG_V15 + REG_V16 + REG_V17 + REG_V18 + REG_V19 + REG_V20 + REG_V21 + REG_V22 + REG_V23 + REG_V24 + REG_V25 + REG_V26 + REG_V27 + REG_V28 + REG_V29 + REG_V30 + REG_V31 + + // The EQ in + // CSET EQ, R0 + // is encoded as TYPE_REG, even though it's not really a register. + COND_EQ + COND_NE + COND_HS + COND_LO + COND_MI + COND_PL + COND_VS + COND_VC + COND_HI + COND_LS + COND_GE + COND_LT + COND_GT + COND_LE + COND_AL + COND_NV + + REG_RSP = REG_V31 + 32 // to differentiate ZR/SP, REG_RSP&0x1f = 31 +) + +// bits 0-4 indicates register: Vn +// bits 5-8 indicates arrangement: +const ( + REG_ARNG = obj.RBaseARM64 + 1<<10 + iota<<9 // Vn. + REG_ELEM // Vn.[index] + REG_ELEM_END +) + +// Not registers, but flags that can be combined with regular register +// constants to indicate extended register conversion. When checking, +// you should subtract obj.RBaseARM64 first. From this difference, bit 11 +// indicates extended register, bits 8-10 select the conversion mode. +// REG_LSL is the index shift specifier, bit 9 indicates shifted offset register. +const REG_LSL = obj.RBaseARM64 + 1<<9 +const REG_EXT = obj.RBaseARM64 + 1<<11 + +const ( + REG_UXTB = REG_EXT + iota<<8 + REG_UXTH + REG_UXTW + REG_UXTX + REG_SXTB + REG_SXTH + REG_SXTW + REG_SXTX +) + +// Special registers, after subtracting obj.RBaseARM64, bit 12 indicates +// a special register and the low bits select the register. +// SYSREG_END is the last item in the automatically generated system register +// declaration, and it is defined in the sysRegEnc.go file. +const ( + REG_SPECIAL = obj.RBaseARM64 + 1<<12 + REG_DAIFSet = SYSREG_END + iota + REG_DAIFClr + REG_PLDL1KEEP + REG_PLDL1STRM + REG_PLDL2KEEP + REG_PLDL2STRM + REG_PLDL3KEEP + REG_PLDL3STRM + REG_PLIL1KEEP + REG_PLIL1STRM + REG_PLIL2KEEP + REG_PLIL2STRM + REG_PLIL3KEEP + REG_PLIL3STRM + REG_PSTL1KEEP + REG_PSTL1STRM + REG_PSTL2KEEP + REG_PSTL2STRM + REG_PSTL3KEEP + REG_PSTL3STRM +) + +// Register assignments: +// +// compiler allocates R0 up as temps +// compiler allocates register variables R7-R25 +// compiler allocates external registers R26 down +// +// compiler allocates register variables F7-F26 +// compiler allocates external registers F26 down +const ( + REGMIN = REG_R7 // register variables allocated from here to REGMAX + REGRT1 = REG_R16 // ARM64 IP0, external linker may use as a scrach register in trampoline + REGRT2 = REG_R17 // ARM64 IP1, external linker may use as a scrach register in trampoline + REGPR = REG_R18 // ARM64 platform register, unused in the Go toolchain + REGMAX = REG_R25 + + REGCTXT = REG_R26 // environment for closures + REGTMP = REG_R27 // reserved for liblink + REGG = REG_R28 // G + REGFP = REG_R29 // frame pointer, unused in the Go toolchain + REGLINK = REG_R30 + + // ARM64 uses R31 as both stack pointer and zero register, + // depending on the instruction. To differentiate RSP from ZR, + // we use a different numeric value for REGZERO and REGSP. + REGZERO = REG_R31 + REGSP = REG_RSP + + FREGRET = REG_F0 + FREGMIN = REG_F7 // first register variable + FREGMAX = REG_F26 // last register variable for 7g only + FREGEXT = REG_F26 // first external register +) + +// http://infocenter.arm.com/help/topic/com.arm.doc.ecm0665627/abi_sve_aadwarf_100985_0000_00_en.pdf +var ARM64DWARFRegisters = map[int16]int16{ + REG_R0: 0, + REG_R1: 1, + REG_R2: 2, + REG_R3: 3, + REG_R4: 4, + REG_R5: 5, + REG_R6: 6, + REG_R7: 7, + REG_R8: 8, + REG_R9: 9, + REG_R10: 10, + REG_R11: 11, + REG_R12: 12, + REG_R13: 13, + REG_R14: 14, + REG_R15: 15, + REG_R16: 16, + REG_R17: 17, + REG_R18: 18, + REG_R19: 19, + REG_R20: 20, + REG_R21: 21, + REG_R22: 22, + REG_R23: 23, + REG_R24: 24, + REG_R25: 25, + REG_R26: 26, + REG_R27: 27, + REG_R28: 28, + REG_R29: 29, + REG_R30: 30, + + // floating point + REG_F0: 64, + REG_F1: 65, + REG_F2: 66, + REG_F3: 67, + REG_F4: 68, + REG_F5: 69, + REG_F6: 70, + REG_F7: 71, + REG_F8: 72, + REG_F9: 73, + REG_F10: 74, + REG_F11: 75, + REG_F12: 76, + REG_F13: 77, + REG_F14: 78, + REG_F15: 79, + REG_F16: 80, + REG_F17: 81, + REG_F18: 82, + REG_F19: 83, + REG_F20: 84, + REG_F21: 85, + REG_F22: 86, + REG_F23: 87, + REG_F24: 88, + REG_F25: 89, + REG_F26: 90, + REG_F27: 91, + REG_F28: 92, + REG_F29: 93, + REG_F30: 94, + REG_F31: 95, + + // SIMD + REG_V0: 64, + REG_V1: 65, + REG_V2: 66, + REG_V3: 67, + REG_V4: 68, + REG_V5: 69, + REG_V6: 70, + REG_V7: 71, + REG_V8: 72, + REG_V9: 73, + REG_V10: 74, + REG_V11: 75, + REG_V12: 76, + REG_V13: 77, + REG_V14: 78, + REG_V15: 79, + REG_V16: 80, + REG_V17: 81, + REG_V18: 82, + REG_V19: 83, + REG_V20: 84, + REG_V21: 85, + REG_V22: 86, + REG_V23: 87, + REG_V24: 88, + REG_V25: 89, + REG_V26: 90, + REG_V27: 91, + REG_V28: 92, + REG_V29: 93, + REG_V30: 94, + REG_V31: 95, +} + +const ( + BIG = 2048 - 8 +) + +const ( + /* mark flags */ + LABEL = 1 << iota + LEAF + FLOAT + BRANCH + LOAD + FCMP + SYNC + LIST + FOLL + NOSCHED +) + +const ( + // optab is sorted based on the order of these constants + // and the first match is chosen. + // The more specific class needs to come earlier. + C_NONE = iota + C_REG // R0..R30 + C_RSP // R0..R30, RSP + C_FREG // F0..F31 + C_VREG // V0..V31 + C_PAIR // (Rn, Rm) + C_SHIFT // Rn<<2 + C_EXTREG // Rn.UXTB[<<3] + C_SPR // REG_NZCV + C_COND // EQ, NE, etc + C_ARNG // Vn. + C_ELEM // Vn.[index] + C_LIST // [V1, V2, V3] + + C_ZCON // $0 or ZR + C_ABCON0 // could be C_ADDCON0 or C_BITCON + C_ADDCON0 // 12-bit unsigned, unshifted + C_ABCON // could be C_ADDCON or C_BITCON + C_AMCON // could be C_ADDCON or C_MOVCON + C_ADDCON // 12-bit unsigned, shifted left by 0 or 12 + C_MBCON // could be C_MOVCON or C_BITCON + C_MOVCON // generated by a 16-bit constant, optionally inverted and/or shifted by multiple of 16 + C_BITCON // bitfield and logical immediate masks + C_ADDCON2 // 24-bit constant + C_LCON // 32-bit constant + C_MOVCON2 // a constant that can be loaded with one MOVZ/MOVN and one MOVK + C_MOVCON3 // a constant that can be loaded with one MOVZ/MOVN and two MOVKs + C_VCON // 64-bit constant + C_FCON // floating-point constant + C_VCONADDR // 64-bit memory address + + C_AACON // ADDCON offset in auto constant $a(FP) + C_AACON2 // 24-bit offset in auto constant $a(FP) + C_LACON // 32-bit offset in auto constant $a(FP) + C_AECON // ADDCON offset in extern constant $e(SB) + + // TODO(aram): only one branch class should be enough + C_SBRA // for TYPE_BRANCH + C_LBRA + + C_ZAUTO // 0(RSP) + C_NSAUTO_8 // -256 <= x < 0, 0 mod 8 + C_NSAUTO_4 // -256 <= x < 0, 0 mod 4 + C_NSAUTO // -256 <= x < 0 + C_NPAUTO // -512 <= x < 0, 0 mod 8 + C_NAUTO4K // -4095 <= x < 0 + C_PSAUTO_8 // 0 to 255, 0 mod 8 + C_PSAUTO_4 // 0 to 255, 0 mod 4 + C_PSAUTO // 0 to 255 + C_PPAUTO // 0 to 504, 0 mod 8 + C_UAUTO4K_8 // 0 to 4095, 0 mod 8 + C_UAUTO4K_4 // 0 to 4095, 0 mod 4 + C_UAUTO4K_2 // 0 to 4095, 0 mod 2 + C_UAUTO4K // 0 to 4095 + C_UAUTO8K_8 // 0 to 8190, 0 mod 8 + C_UAUTO8K_4 // 0 to 8190, 0 mod 4 + C_UAUTO8K // 0 to 8190, 0 mod 2 + C_UAUTO16K_8 // 0 to 16380, 0 mod 8 + C_UAUTO16K // 0 to 16380, 0 mod 4 + C_UAUTO32K // 0 to 32760, 0 mod 8 + C_LAUTO // any other 32-bit constant + + C_SEXT1 // 0 to 4095, direct + C_SEXT2 // 0 to 8190 + C_SEXT4 // 0 to 16380 + C_SEXT8 // 0 to 32760 + C_SEXT16 // 0 to 65520 + C_LEXT + + C_ZOREG // 0(R) + C_NSOREG_8 // must mirror C_NSAUTO_8, etc + C_NSOREG_4 + C_NSOREG + C_NPOREG + C_NOREG4K + C_PSOREG_8 + C_PSOREG_4 + C_PSOREG + C_PPOREG + C_UOREG4K_8 + C_UOREG4K_4 + C_UOREG4K_2 + C_UOREG4K + C_UOREG8K_8 + C_UOREG8K_4 + C_UOREG8K + C_UOREG16K_8 + C_UOREG16K + C_UOREG32K + C_LOREG + + C_ADDR // TODO(aram): explain difference from C_VCONADDR + + // The GOT slot for a symbol in -dynlink mode. + C_GOTADDR + + // TLS "var" in local exec mode: will become a constant offset from + // thread local base that is ultimately chosen by the program linker. + C_TLS_LE + + // TLS "var" in initial exec mode: will become a memory address (chosen + // by the program linker) that the dynamic linker will fill with the + // offset from the thread local base. + C_TLS_IE + + C_ROFF // register offset (including register extended) + + C_GOK + C_TEXTSIZE + C_NCLASS // must be last +) + +const ( + C_XPRE = 1 << 6 // match arm.C_WBIT, so Prog.String know how to print it + C_XPOST = 1 << 5 // match arm.C_PBIT, so Prog.String know how to print it +) + +//go:generate go run ../stringer.go -i $GOFILE -o anames.go -p arm64 + +const ( + AADC = obj.ABaseARM64 + obj.A_ARCHSPECIFIC + iota + AADCS + AADCSW + AADCW + AADD + AADDS + AADDSW + AADDW + AADR + AADRP + AAND + AANDS + AANDSW + AANDW + AASR + AASRW + AAT + ABFI + ABFIW + ABFM + ABFMW + ABFXIL + ABFXILW + ABIC + ABICS + ABICSW + ABICW + ABRK + ACBNZ + ACBNZW + ACBZ + ACBZW + ACCMN + ACCMNW + ACCMP + ACCMPW + ACINC + ACINCW + ACINV + ACINVW + ACLREX + ACLS + ACLSW + ACLZ + ACLZW + ACMN + ACMNW + ACMP + ACMPW + ACNEG + ACNEGW + ACRC32B + ACRC32CB + ACRC32CH + ACRC32CW + ACRC32CX + ACRC32H + ACRC32W + ACRC32X + ACSEL + ACSELW + ACSET + ACSETM + ACSETMW + ACSETW + ACSINC + ACSINCW + ACSINV + ACSINVW + ACSNEG + ACSNEGW + ADC + ADCPS1 + ADCPS2 + ADCPS3 + ADMB + ADRPS + ADSB + AEON + AEONW + AEOR + AEORW + AERET + AEXTR + AEXTRW + AHINT + AHLT + AHVC + AIC + AISB + ALDADDAB + ALDADDAD + ALDADDAH + ALDADDAW + ALDADDALB + ALDADDALD + ALDADDALH + ALDADDALW + ALDADDB + ALDADDD + ALDADDH + ALDADDW + ALDADDLB + ALDADDLD + ALDADDLH + ALDADDLW + ALDANDAB + ALDANDAD + ALDANDAH + ALDANDAW + ALDANDALB + ALDANDALD + ALDANDALH + ALDANDALW + ALDANDB + ALDANDD + ALDANDH + ALDANDW + ALDANDLB + ALDANDLD + ALDANDLH + ALDANDLW + ALDAR + ALDARB + ALDARH + ALDARW + ALDAXP + ALDAXPW + ALDAXR + ALDAXRB + ALDAXRH + ALDAXRW + ALDEORAB + ALDEORAD + ALDEORAH + ALDEORAW + ALDEORALB + ALDEORALD + ALDEORALH + ALDEORALW + ALDEORB + ALDEORD + ALDEORH + ALDEORW + ALDEORLB + ALDEORLD + ALDEORLH + ALDEORLW + ALDORAB + ALDORAD + ALDORAH + ALDORAW + ALDORALB + ALDORALD + ALDORALH + ALDORALW + ALDORB + ALDORD + ALDORH + ALDORW + ALDORLB + ALDORLD + ALDORLH + ALDORLW + ALDP + ALDPW + ALDPSW + ALDXR + ALDXRB + ALDXRH + ALDXRW + ALDXP + ALDXPW + ALSL + ALSLW + ALSR + ALSRW + AMADD + AMADDW + AMNEG + AMNEGW + AMOVK + AMOVKW + AMOVN + AMOVNW + AMOVZ + AMOVZW + AMRS + AMSR + AMSUB + AMSUBW + AMUL + AMULW + AMVN + AMVNW + ANEG + ANEGS + ANEGSW + ANEGW + ANGC + ANGCS + ANGCSW + ANGCW + ANOOP + AORN + AORNW + AORR + AORRW + APRFM + APRFUM + ARBIT + ARBITW + AREM + AREMW + AREV + AREV16 + AREV16W + AREV32 + AREVW + AROR + ARORW + ASBC + ASBCS + ASBCSW + ASBCW + ASBFIZ + ASBFIZW + ASBFM + ASBFMW + ASBFX + ASBFXW + ASDIV + ASDIVW + ASEV + ASEVL + ASMADDL + ASMC + ASMNEGL + ASMSUBL + ASMULH + ASMULL + ASTXR + ASTXRB + ASTXRH + ASTXP + ASTXPW + ASTXRW + ASTLP + ASTLPW + ASTLR + ASTLRB + ASTLRH + ASTLRW + ASTLXP + ASTLXPW + ASTLXR + ASTLXRB + ASTLXRH + ASTLXRW + ASTP + ASTPW + ASUB + ASUBS + ASUBSW + ASUBW + ASVC + ASXTB + ASXTBW + ASXTH + ASXTHW + ASXTW + ASYS + ASYSL + ATBNZ + ATBZ + ATLBI + ATST + ATSTW + AUBFIZ + AUBFIZW + AUBFM + AUBFMW + AUBFX + AUBFXW + AUDIV + AUDIVW + AUMADDL + AUMNEGL + AUMSUBL + AUMULH + AUMULL + AUREM + AUREMW + AUXTB + AUXTH + AUXTW + AUXTBW + AUXTHW + AWFE + AWFI + AYIELD + AMOVB + AMOVBU + AMOVH + AMOVHU + AMOVW + AMOVWU + AMOVD + AMOVNP + AMOVNPW + AMOVP + AMOVPD + AMOVPQ + AMOVPS + AMOVPSW + AMOVPW + ASWPAD + ASWPAW + ASWPAH + ASWPAB + ASWPALD + ASWPALW + ASWPALH + ASWPALB + ASWPD + ASWPW + ASWPH + ASWPB + ASWPLD + ASWPLW + ASWPLH + ASWPLB + ABEQ + ABNE + ABCS + ABHS + ABCC + ABLO + ABMI + ABPL + ABVS + ABVC + ABHI + ABLS + ABGE + ABLT + ABGT + ABLE + AFABSD + AFABSS + AFADDD + AFADDS + AFCCMPD + AFCCMPED + AFCCMPS + AFCCMPES + AFCMPD + AFCMPED + AFCMPES + AFCMPS + AFCVTSD + AFCVTDS + AFCVTZSD + AFCVTZSDW + AFCVTZSS + AFCVTZSSW + AFCVTZUD + AFCVTZUDW + AFCVTZUS + AFCVTZUSW + AFDIVD + AFDIVS + AFLDPD + AFLDPS + AFMOVD + AFMOVS + AFMOVQ + AFMULD + AFMULS + AFNEGD + AFNEGS + AFSQRTD + AFSQRTS + AFSTPD + AFSTPS + AFSUBD + AFSUBS + ASCVTFD + ASCVTFS + ASCVTFWD + ASCVTFWS + AUCVTFD + AUCVTFS + AUCVTFWD + AUCVTFWS + AWORD + ADWORD + AFCSELS + AFCSELD + AFMAXS + AFMINS + AFMAXD + AFMIND + AFMAXNMS + AFMAXNMD + AFNMULS + AFNMULD + AFRINTNS + AFRINTND + AFRINTPS + AFRINTPD + AFRINTMS + AFRINTMD + AFRINTZS + AFRINTZD + AFRINTAS + AFRINTAD + AFRINTXS + AFRINTXD + AFRINTIS + AFRINTID + AFMADDS + AFMADDD + AFMSUBS + AFMSUBD + AFNMADDS + AFNMADDD + AFNMSUBS + AFNMSUBD + AFMINNMS + AFMINNMD + AFCVTDH + AFCVTHS + AFCVTHD + AFCVTSH + AAESD + AAESE + AAESIMC + AAESMC + ASHA1C + ASHA1H + ASHA1M + ASHA1P + ASHA1SU0 + ASHA1SU1 + ASHA256H + ASHA256H2 + ASHA256SU0 + ASHA256SU1 + ASHA512H + ASHA512H2 + ASHA512SU0 + ASHA512SU1 + AVADD + AVADDP + AVAND + AVBIF + AVCMEQ + AVCNT + AVEOR + AVMOV + AVLD1 + AVLD2 + AVLD3 + AVLD4 + AVLD1R + AVLD2R + AVLD3R + AVLD4R + AVORR + AVREV16 + AVREV32 + AVREV64 + AVST1 + AVST2 + AVST3 + AVST4 + AVDUP + AVADDV + AVMOVI + AVUADDLV + AVSUB + AVFMLA + AVFMLS + AVPMULL + AVPMULL2 + AVEXT + AVRBIT + AVUSHR + AVUSHLL + AVUSHLL2 + AVUXTL + AVUXTL2 + AVUZP1 + AVUZP2 + AVSHL + AVSRI + AVBSL + AVBIT + AVTBL + AVZIP1 + AVZIP2 + AVCMTST + ALAST + AB = obj.AJMP + ABL = obj.ACALL +) + +const ( + // shift types + SHIFT_LL = 0 << 22 + SHIFT_LR = 1 << 22 + SHIFT_AR = 2 << 22 +) + +// Arrangement for ARM64 SIMD instructions +const ( + // arrangement types + ARNG_8B = iota + ARNG_16B + ARNG_1D + ARNG_4H + ARNG_8H + ARNG_2S + ARNG_4S + ARNG_2D + ARNG_1Q + ARNG_B + ARNG_H + ARNG_S + ARNG_D +) diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/anames.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/anames.go new file mode 100644 index 00000000..0ce620a9 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/anames.go @@ -0,0 +1,512 @@ +// Code generated by stringer -i a.out.go -o anames.go -p arm64; DO NOT EDIT. + +package arm64 + +import "github.com/twitchyliquid64/golang-asm/obj" + +var Anames = []string{ + obj.A_ARCHSPECIFIC: "ADC", + "ADCS", + "ADCSW", + "ADCW", + "ADD", + "ADDS", + "ADDSW", + "ADDW", + "ADR", + "ADRP", + "AND", + "ANDS", + "ANDSW", + "ANDW", + "ASR", + "ASRW", + "AT", + "BFI", + "BFIW", + "BFM", + "BFMW", + "BFXIL", + "BFXILW", + "BIC", + "BICS", + "BICSW", + "BICW", + "BRK", + "CBNZ", + "CBNZW", + "CBZ", + "CBZW", + "CCMN", + "CCMNW", + "CCMP", + "CCMPW", + "CINC", + "CINCW", + "CINV", + "CINVW", + "CLREX", + "CLS", + "CLSW", + "CLZ", + "CLZW", + "CMN", + "CMNW", + "CMP", + "CMPW", + "CNEG", + "CNEGW", + "CRC32B", + "CRC32CB", + "CRC32CH", + "CRC32CW", + "CRC32CX", + "CRC32H", + "CRC32W", + "CRC32X", + "CSEL", + "CSELW", + "CSET", + "CSETM", + "CSETMW", + "CSETW", + "CSINC", + "CSINCW", + "CSINV", + "CSINVW", + "CSNEG", + "CSNEGW", + "DC", + "DCPS1", + "DCPS2", + "DCPS3", + "DMB", + "DRPS", + "DSB", + "EON", + "EONW", + "EOR", + "EORW", + "ERET", + "EXTR", + "EXTRW", + "HINT", + "HLT", + "HVC", + "IC", + "ISB", + "LDADDAB", + "LDADDAD", + "LDADDAH", + "LDADDAW", + "LDADDALB", + "LDADDALD", + "LDADDALH", + "LDADDALW", + "LDADDB", + "LDADDD", + "LDADDH", + "LDADDW", + "LDADDLB", + "LDADDLD", + "LDADDLH", + "LDADDLW", + "LDANDAB", + "LDANDAD", + "LDANDAH", + "LDANDAW", + "LDANDALB", + "LDANDALD", + "LDANDALH", + "LDANDALW", + "LDANDB", + "LDANDD", + "LDANDH", + "LDANDW", + "LDANDLB", + "LDANDLD", + "LDANDLH", + "LDANDLW", + "LDAR", + "LDARB", + "LDARH", + "LDARW", + "LDAXP", + "LDAXPW", + "LDAXR", + "LDAXRB", + "LDAXRH", + "LDAXRW", + "LDEORAB", + "LDEORAD", + "LDEORAH", + "LDEORAW", + "LDEORALB", + "LDEORALD", + "LDEORALH", + "LDEORALW", + "LDEORB", + "LDEORD", + "LDEORH", + "LDEORW", + "LDEORLB", + "LDEORLD", + "LDEORLH", + "LDEORLW", + "LDORAB", + "LDORAD", + "LDORAH", + "LDORAW", + "LDORALB", + "LDORALD", + "LDORALH", + "LDORALW", + "LDORB", + "LDORD", + "LDORH", + "LDORW", + "LDORLB", + "LDORLD", + "LDORLH", + "LDORLW", + "LDP", + "LDPW", + "LDPSW", + "LDXR", + "LDXRB", + "LDXRH", + "LDXRW", + "LDXP", + "LDXPW", + "LSL", + "LSLW", + "LSR", + "LSRW", + "MADD", + "MADDW", + "MNEG", + "MNEGW", + "MOVK", + "MOVKW", + "MOVN", + "MOVNW", + "MOVZ", + "MOVZW", + "MRS", + "MSR", + "MSUB", + "MSUBW", + "MUL", + "MULW", + "MVN", + "MVNW", + "NEG", + "NEGS", + "NEGSW", + "NEGW", + "NGC", + "NGCS", + "NGCSW", + "NGCW", + "NOOP", + "ORN", + "ORNW", + "ORR", + "ORRW", + "PRFM", + "PRFUM", + "RBIT", + "RBITW", + "REM", + "REMW", + "REV", + "REV16", + "REV16W", + "REV32", + "REVW", + "ROR", + "RORW", + "SBC", + "SBCS", + "SBCSW", + "SBCW", + "SBFIZ", + "SBFIZW", + "SBFM", + "SBFMW", + "SBFX", + "SBFXW", + "SDIV", + "SDIVW", + "SEV", + "SEVL", + "SMADDL", + "SMC", + "SMNEGL", + "SMSUBL", + "SMULH", + "SMULL", + "STXR", + "STXRB", + "STXRH", + "STXP", + "STXPW", + "STXRW", + "STLP", + "STLPW", + "STLR", + "STLRB", + "STLRH", + "STLRW", + "STLXP", + "STLXPW", + "STLXR", + "STLXRB", + "STLXRH", + "STLXRW", + "STP", + "STPW", + "SUB", + "SUBS", + "SUBSW", + "SUBW", + "SVC", + "SXTB", + "SXTBW", + "SXTH", + "SXTHW", + "SXTW", + "SYS", + "SYSL", + "TBNZ", + "TBZ", + "TLBI", + "TST", + "TSTW", + "UBFIZ", + "UBFIZW", + "UBFM", + "UBFMW", + "UBFX", + "UBFXW", + "UDIV", + "UDIVW", + "UMADDL", + "UMNEGL", + "UMSUBL", + "UMULH", + "UMULL", + "UREM", + "UREMW", + "UXTB", + "UXTH", + "UXTW", + "UXTBW", + "UXTHW", + "WFE", + "WFI", + "YIELD", + "MOVB", + "MOVBU", + "MOVH", + "MOVHU", + "MOVW", + "MOVWU", + "MOVD", + "MOVNP", + "MOVNPW", + "MOVP", + "MOVPD", + "MOVPQ", + "MOVPS", + "MOVPSW", + "MOVPW", + "SWPAD", + "SWPAW", + "SWPAH", + "SWPAB", + "SWPALD", + "SWPALW", + "SWPALH", + "SWPALB", + "SWPD", + "SWPW", + "SWPH", + "SWPB", + "SWPLD", + "SWPLW", + "SWPLH", + "SWPLB", + "BEQ", + "BNE", + "BCS", + "BHS", + "BCC", + "BLO", + "BMI", + "BPL", + "BVS", + "BVC", + "BHI", + "BLS", + "BGE", + "BLT", + "BGT", + "BLE", + "FABSD", + "FABSS", + "FADDD", + "FADDS", + "FCCMPD", + "FCCMPED", + "FCCMPS", + "FCCMPES", + "FCMPD", + "FCMPED", + "FCMPES", + "FCMPS", + "FCVTSD", + "FCVTDS", + "FCVTZSD", + "FCVTZSDW", + "FCVTZSS", + "FCVTZSSW", + "FCVTZUD", + "FCVTZUDW", + "FCVTZUS", + "FCVTZUSW", + "FDIVD", + "FDIVS", + "FLDPD", + "FLDPS", + "FMOVD", + "FMOVS", + "FMOVQ", + "FMULD", + "FMULS", + "FNEGD", + "FNEGS", + "FSQRTD", + "FSQRTS", + "FSTPD", + "FSTPS", + "FSUBD", + "FSUBS", + "SCVTFD", + "SCVTFS", + "SCVTFWD", + "SCVTFWS", + "UCVTFD", + "UCVTFS", + "UCVTFWD", + "UCVTFWS", + "WORD", + "DWORD", + "FCSELS", + "FCSELD", + "FMAXS", + "FMINS", + "FMAXD", + "FMIND", + "FMAXNMS", + "FMAXNMD", + "FNMULS", + "FNMULD", + "FRINTNS", + "FRINTND", + "FRINTPS", + "FRINTPD", + "FRINTMS", + "FRINTMD", + "FRINTZS", + "FRINTZD", + "FRINTAS", + "FRINTAD", + "FRINTXS", + "FRINTXD", + "FRINTIS", + "FRINTID", + "FMADDS", + "FMADDD", + "FMSUBS", + "FMSUBD", + "FNMADDS", + "FNMADDD", + "FNMSUBS", + "FNMSUBD", + "FMINNMS", + "FMINNMD", + "FCVTDH", + "FCVTHS", + "FCVTHD", + "FCVTSH", + "AESD", + "AESE", + "AESIMC", + "AESMC", + "SHA1C", + "SHA1H", + "SHA1M", + "SHA1P", + "SHA1SU0", + "SHA1SU1", + "SHA256H", + "SHA256H2", + "SHA256SU0", + "SHA256SU1", + "SHA512H", + "SHA512H2", + "SHA512SU0", + "SHA512SU1", + "VADD", + "VADDP", + "VAND", + "VBIF", + "VCMEQ", + "VCNT", + "VEOR", + "VMOV", + "VLD1", + "VLD2", + "VLD3", + "VLD4", + "VLD1R", + "VLD2R", + "VLD3R", + "VLD4R", + "VORR", + "VREV16", + "VREV32", + "VREV64", + "VST1", + "VST2", + "VST3", + "VST4", + "VDUP", + "VADDV", + "VMOVI", + "VUADDLV", + "VSUB", + "VFMLA", + "VFMLS", + "VPMULL", + "VPMULL2", + "VEXT", + "VRBIT", + "VUSHR", + "VUSHLL", + "VUSHLL2", + "VUXTL", + "VUXTL2", + "VUZP1", + "VUZP2", + "VSHL", + "VSRI", + "VBSL", + "VBIT", + "VTBL", + "VZIP1", + "VZIP2", + "VCMTST", + "LAST", +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/anames7.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/anames7.go new file mode 100644 index 00000000..96c9f788 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/anames7.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package arm64 + +// This order should be strictly consistent to that in a.out.go +var cnames7 = []string{ + "NONE", + "REG", + "RSP", + "FREG", + "VREG", + "PAIR", + "SHIFT", + "EXTREG", + "SPR", + "COND", + "ARNG", + "ELEM", + "LIST", + "ZCON", + "ABCON0", + "ADDCON0", + "ABCON", + "AMCON", + "ADDCON", + "MBCON", + "MOVCON", + "BITCON", + "ADDCON2", + "LCON", + "MOVCON2", + "MOVCON3", + "VCON", + "FCON", + "VCONADDR", + "AACON", + "AACON2", + "LACON", + "AECON", + "SBRA", + "LBRA", + "ZAUTO", + "NSAUTO_8", + "NSAUTO_4", + "NSAUTO", + "NPAUTO", + "NAUTO4K", + "PSAUTO_8", + "PSAUTO_4", + "PSAUTO", + "PPAUTO", + "UAUTO4K_8", + "UAUTO4K_4", + "UAUTO4K_2", + "UAUTO4K", + "UAUTO8K_8", + "UAUTO8K_4", + "UAUTO8K", + "UAUTO16K_8", + "UAUTO16K", + "UAUTO32K", + "LAUTO", + "SEXT1", + "SEXT2", + "SEXT4", + "SEXT8", + "SEXT16", + "LEXT", + "ZOREG", + "NSOREG_8", + "NSOREG_4", + "NSOREG", + "NPOREG", + "NOREG4K", + "PSOREG_8", + "PSOREG_4", + "PSOREG", + "PPOREG", + "UOREG4K_8", + "UOREG4K_4", + "UOREG4K_2", + "UOREG4K", + "UOREG8K_8", + "UOREG8K_4", + "UOREG8K", + "UOREG16K_8", + "UOREG16K", + "UOREG32K", + "LOREG", + "ADDR", + "GOTADDR", + "TLS_LE", + "TLS_IE", + "ROFF", + "GOK", + "TEXTSIZE", + "NCLASS", +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/asm7.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/asm7.go new file mode 100644 index 00000000..2bbb64b9 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/asm7.go @@ -0,0 +1,7140 @@ +// cmd/7l/asm.c, cmd/7l/asmout.c, cmd/7l/optab.c, cmd/7l/span.c, cmd/ld/sub.c, cmd/ld/mod.c, from Vita Nuova. +// https://code.google.com/p/ken-cc/source/browse/ +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package arm64 + +import ( + "github.com/twitchyliquid64/golang-asm/obj" + "github.com/twitchyliquid64/golang-asm/objabi" + "fmt" + "log" + "math" + "sort" +) + +// ctxt7 holds state while assembling a single function. +// Each function gets a fresh ctxt7. +// This allows for multiple functions to be safely concurrently assembled. +type ctxt7 struct { + ctxt *obj.Link + newprog obj.ProgAlloc + cursym *obj.LSym + blitrl *obj.Prog + elitrl *obj.Prog + autosize int32 + extrasize int32 + instoffset int64 + pc int64 + pool struct { + start uint32 + size uint32 + } +} + +const ( + funcAlign = 16 +) + +const ( + REGFROM = 1 +) + +type Optab struct { + as obj.As + a1 uint8 + a2 uint8 + a3 uint8 + a4 uint8 + type_ int8 + size int8 + param int16 + flag int8 + scond uint16 +} + +func IsAtomicInstruction(as obj.As) bool { + _, ok := atomicInstructions[as] + return ok +} + +// known field values of an instruction. +var atomicInstructions = map[obj.As]uint32{ + ALDADDAD: 3<<30 | 0x1c5<<21 | 0x00<<10, + ALDADDAW: 2<<30 | 0x1c5<<21 | 0x00<<10, + ALDADDAH: 1<<30 | 0x1c5<<21 | 0x00<<10, + ALDADDAB: 0<<30 | 0x1c5<<21 | 0x00<<10, + ALDADDALD: 3<<30 | 0x1c7<<21 | 0x00<<10, + ALDADDALW: 2<<30 | 0x1c7<<21 | 0x00<<10, + ALDADDALH: 1<<30 | 0x1c7<<21 | 0x00<<10, + ALDADDALB: 0<<30 | 0x1c7<<21 | 0x00<<10, + ALDADDD: 3<<30 | 0x1c1<<21 | 0x00<<10, + ALDADDW: 2<<30 | 0x1c1<<21 | 0x00<<10, + ALDADDH: 1<<30 | 0x1c1<<21 | 0x00<<10, + ALDADDB: 0<<30 | 0x1c1<<21 | 0x00<<10, + ALDADDLD: 3<<30 | 0x1c3<<21 | 0x00<<10, + ALDADDLW: 2<<30 | 0x1c3<<21 | 0x00<<10, + ALDADDLH: 1<<30 | 0x1c3<<21 | 0x00<<10, + ALDADDLB: 0<<30 | 0x1c3<<21 | 0x00<<10, + ALDANDAD: 3<<30 | 0x1c5<<21 | 0x04<<10, + ALDANDAW: 2<<30 | 0x1c5<<21 | 0x04<<10, + ALDANDAH: 1<<30 | 0x1c5<<21 | 0x04<<10, + ALDANDAB: 0<<30 | 0x1c5<<21 | 0x04<<10, + ALDANDALD: 3<<30 | 0x1c7<<21 | 0x04<<10, + ALDANDALW: 2<<30 | 0x1c7<<21 | 0x04<<10, + ALDANDALH: 1<<30 | 0x1c7<<21 | 0x04<<10, + ALDANDALB: 0<<30 | 0x1c7<<21 | 0x04<<10, + ALDANDD: 3<<30 | 0x1c1<<21 | 0x04<<10, + ALDANDW: 2<<30 | 0x1c1<<21 | 0x04<<10, + ALDANDH: 1<<30 | 0x1c1<<21 | 0x04<<10, + ALDANDB: 0<<30 | 0x1c1<<21 | 0x04<<10, + ALDANDLD: 3<<30 | 0x1c3<<21 | 0x04<<10, + ALDANDLW: 2<<30 | 0x1c3<<21 | 0x04<<10, + ALDANDLH: 1<<30 | 0x1c3<<21 | 0x04<<10, + ALDANDLB: 0<<30 | 0x1c3<<21 | 0x04<<10, + ALDEORAD: 3<<30 | 0x1c5<<21 | 0x08<<10, + ALDEORAW: 2<<30 | 0x1c5<<21 | 0x08<<10, + ALDEORAH: 1<<30 | 0x1c5<<21 | 0x08<<10, + ALDEORAB: 0<<30 | 0x1c5<<21 | 0x08<<10, + ALDEORALD: 3<<30 | 0x1c7<<21 | 0x08<<10, + ALDEORALW: 2<<30 | 0x1c7<<21 | 0x08<<10, + ALDEORALH: 1<<30 | 0x1c7<<21 | 0x08<<10, + ALDEORALB: 0<<30 | 0x1c7<<21 | 0x08<<10, + ALDEORD: 3<<30 | 0x1c1<<21 | 0x08<<10, + ALDEORW: 2<<30 | 0x1c1<<21 | 0x08<<10, + ALDEORH: 1<<30 | 0x1c1<<21 | 0x08<<10, + ALDEORB: 0<<30 | 0x1c1<<21 | 0x08<<10, + ALDEORLD: 3<<30 | 0x1c3<<21 | 0x08<<10, + ALDEORLW: 2<<30 | 0x1c3<<21 | 0x08<<10, + ALDEORLH: 1<<30 | 0x1c3<<21 | 0x08<<10, + ALDEORLB: 0<<30 | 0x1c3<<21 | 0x08<<10, + ALDORAD: 3<<30 | 0x1c5<<21 | 0x0c<<10, + ALDORAW: 2<<30 | 0x1c5<<21 | 0x0c<<10, + ALDORAH: 1<<30 | 0x1c5<<21 | 0x0c<<10, + ALDORAB: 0<<30 | 0x1c5<<21 | 0x0c<<10, + ALDORALD: 3<<30 | 0x1c7<<21 | 0x0c<<10, + ALDORALW: 2<<30 | 0x1c7<<21 | 0x0c<<10, + ALDORALH: 1<<30 | 0x1c7<<21 | 0x0c<<10, + ALDORALB: 0<<30 | 0x1c7<<21 | 0x0c<<10, + ALDORD: 3<<30 | 0x1c1<<21 | 0x0c<<10, + ALDORW: 2<<30 | 0x1c1<<21 | 0x0c<<10, + ALDORH: 1<<30 | 0x1c1<<21 | 0x0c<<10, + ALDORB: 0<<30 | 0x1c1<<21 | 0x0c<<10, + ALDORLD: 3<<30 | 0x1c3<<21 | 0x0c<<10, + ALDORLW: 2<<30 | 0x1c3<<21 | 0x0c<<10, + ALDORLH: 1<<30 | 0x1c3<<21 | 0x0c<<10, + ALDORLB: 0<<30 | 0x1c3<<21 | 0x0c<<10, + ASWPAD: 3<<30 | 0x1c5<<21 | 0x20<<10, + ASWPAW: 2<<30 | 0x1c5<<21 | 0x20<<10, + ASWPAH: 1<<30 | 0x1c5<<21 | 0x20<<10, + ASWPAB: 0<<30 | 0x1c5<<21 | 0x20<<10, + ASWPALD: 3<<30 | 0x1c7<<21 | 0x20<<10, + ASWPALW: 2<<30 | 0x1c7<<21 | 0x20<<10, + ASWPALH: 1<<30 | 0x1c7<<21 | 0x20<<10, + ASWPALB: 0<<30 | 0x1c7<<21 | 0x20<<10, + ASWPD: 3<<30 | 0x1c1<<21 | 0x20<<10, + ASWPW: 2<<30 | 0x1c1<<21 | 0x20<<10, + ASWPH: 1<<30 | 0x1c1<<21 | 0x20<<10, + ASWPB: 0<<30 | 0x1c1<<21 | 0x20<<10, + ASWPLD: 3<<30 | 0x1c3<<21 | 0x20<<10, + ASWPLW: 2<<30 | 0x1c3<<21 | 0x20<<10, + ASWPLH: 1<<30 | 0x1c3<<21 | 0x20<<10, + ASWPLB: 0<<30 | 0x1c3<<21 | 0x20<<10, +} + +var oprange [ALAST & obj.AMask][]Optab + +var xcmp [C_NCLASS][C_NCLASS]bool + +const ( + S32 = 0 << 31 + S64 = 1 << 31 + Sbit = 1 << 29 + LSL0_32 = 2 << 13 + LSL0_64 = 3 << 13 +) + +func OPDP2(x uint32) uint32 { + return 0<<30 | 0<<29 | 0xd6<<21 | x<<10 +} + +func OPDP3(sf uint32, op54 uint32, op31 uint32, o0 uint32) uint32 { + return sf<<31 | op54<<29 | 0x1B<<24 | op31<<21 | o0<<15 +} + +func OPBcc(x uint32) uint32 { + return 0x2A<<25 | 0<<24 | 0<<4 | x&15 +} + +func OPBLR(x uint32) uint32 { + /* x=0, JMP; 1, CALL; 2, RET */ + return 0x6B<<25 | 0<<23 | x<<21 | 0x1F<<16 | 0<<10 +} + +func SYSOP(l uint32, op0 uint32, op1 uint32, crn uint32, crm uint32, op2 uint32, rt uint32) uint32 { + return 0x354<<22 | l<<21 | op0<<19 | op1<<16 | crn&15<<12 | crm&15<<8 | op2<<5 | rt +} + +func SYSHINT(x uint32) uint32 { + return SYSOP(0, 0, 3, 2, 0, x, 0x1F) +} + +func LDSTR12U(sz uint32, v uint32, opc uint32) uint32 { + return sz<<30 | 7<<27 | v<<26 | 1<<24 | opc<<22 +} + +func LDSTR9S(sz uint32, v uint32, opc uint32) uint32 { + return sz<<30 | 7<<27 | v<<26 | 0<<24 | opc<<22 +} + +func LD2STR(o uint32) uint32 { + return o &^ (3 << 22) +} + +func LDSTX(sz uint32, o2 uint32, l uint32, o1 uint32, o0 uint32) uint32 { + return sz<<30 | 0x8<<24 | o2<<23 | l<<22 | o1<<21 | o0<<15 +} + +func FPCMP(m uint32, s uint32, type_ uint32, op uint32, op2 uint32) uint32 { + return m<<31 | s<<29 | 0x1E<<24 | type_<<22 | 1<<21 | op<<14 | 8<<10 | op2 +} + +func FPCCMP(m uint32, s uint32, type_ uint32, op uint32) uint32 { + return m<<31 | s<<29 | 0x1E<<24 | type_<<22 | 1<<21 | 1<<10 | op<<4 +} + +func FPOP1S(m uint32, s uint32, type_ uint32, op uint32) uint32 { + return m<<31 | s<<29 | 0x1E<<24 | type_<<22 | 1<<21 | op<<15 | 0x10<<10 +} + +func FPOP2S(m uint32, s uint32, type_ uint32, op uint32) uint32 { + return m<<31 | s<<29 | 0x1E<<24 | type_<<22 | 1<<21 | op<<12 | 2<<10 +} + +func FPOP3S(m uint32, s uint32, type_ uint32, op uint32, op2 uint32) uint32 { + return m<<31 | s<<29 | 0x1F<<24 | type_<<22 | op<<21 | op2<<15 +} + +func FPCVTI(sf uint32, s uint32, type_ uint32, rmode uint32, op uint32) uint32 { + return sf<<31 | s<<29 | 0x1E<<24 | type_<<22 | 1<<21 | rmode<<19 | op<<16 | 0<<10 +} + +func ADR(p uint32, o uint32, rt uint32) uint32 { + return p<<31 | (o&3)<<29 | 0x10<<24 | ((o>>2)&0x7FFFF)<<5 | rt&31 +} + +func OPBIT(x uint32) uint32 { + return 1<<30 | 0<<29 | 0xD6<<21 | 0<<16 | x<<10 +} + +func MOVCONST(d int64, s int, rt int) uint32 { + return uint32(((d>>uint(s*16))&0xFFFF)<<5) | uint32(s)&3<<21 | uint32(rt&31) +} + +const ( + // Optab.flag + LFROM = 1 << 0 // p.From uses constant pool + LTO = 1 << 1 // p.To uses constant pool + NOTUSETMP = 1 << 2 // p expands to multiple instructions, but does NOT use REGTMP +) + +var optab = []Optab{ + /* struct Optab: + OPCODE, from, prog->reg, from3, to, type,size,param,flag,scond */ + {obj.ATEXT, C_ADDR, C_NONE, C_NONE, C_TEXTSIZE, 0, 0, 0, 0, 0}, + + /* arithmetic operations */ + {AADD, C_REG, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AADD, C_REG, C_NONE, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AADC, C_REG, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AADC, C_REG, C_NONE, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {ANEG, C_REG, C_NONE, C_NONE, C_REG, 25, 4, 0, 0, 0}, + {ANEG, C_NONE, C_NONE, C_NONE, C_REG, 25, 4, 0, 0, 0}, + {ANGC, C_REG, C_NONE, C_NONE, C_REG, 17, 4, 0, 0, 0}, + {ACMP, C_REG, C_REG, C_NONE, C_NONE, 1, 4, 0, 0, 0}, + {AADD, C_ADDCON, C_RSP, C_NONE, C_RSP, 2, 4, 0, 0, 0}, + {AADD, C_ADDCON, C_NONE, C_NONE, C_RSP, 2, 4, 0, 0, 0}, + {ACMP, C_ADDCON, C_RSP, C_NONE, C_NONE, 2, 4, 0, 0, 0}, + {AADD, C_MOVCON, C_RSP, C_NONE, C_RSP, 62, 8, 0, 0, 0}, + {AADD, C_MOVCON, C_NONE, C_NONE, C_RSP, 62, 8, 0, 0, 0}, + {ACMP, C_MOVCON, C_RSP, C_NONE, C_NONE, 62, 8, 0, 0, 0}, + {AADD, C_BITCON, C_RSP, C_NONE, C_RSP, 62, 8, 0, 0, 0}, + {AADD, C_BITCON, C_NONE, C_NONE, C_RSP, 62, 8, 0, 0, 0}, + {ACMP, C_BITCON, C_RSP, C_NONE, C_NONE, 62, 8, 0, 0, 0}, + {AADD, C_ADDCON2, C_RSP, C_NONE, C_RSP, 48, 8, 0, NOTUSETMP, 0}, + {AADD, C_ADDCON2, C_NONE, C_NONE, C_RSP, 48, 8, 0, NOTUSETMP, 0}, + {AADD, C_MOVCON2, C_RSP, C_NONE, C_RSP, 13, 12, 0, 0, 0}, + {AADD, C_MOVCON2, C_NONE, C_NONE, C_RSP, 13, 12, 0, 0, 0}, + {AADD, C_MOVCON3, C_RSP, C_NONE, C_RSP, 13, 16, 0, 0, 0}, + {AADD, C_MOVCON3, C_NONE, C_NONE, C_RSP, 13, 16, 0, 0, 0}, + {AADD, C_VCON, C_RSP, C_NONE, C_RSP, 13, 20, 0, 0, 0}, + {AADD, C_VCON, C_NONE, C_NONE, C_RSP, 13, 20, 0, 0, 0}, + {ACMP, C_MOVCON2, C_REG, C_NONE, C_NONE, 13, 12, 0, 0, 0}, + {ACMP, C_MOVCON3, C_REG, C_NONE, C_NONE, 13, 16, 0, 0, 0}, + {ACMP, C_VCON, C_REG, C_NONE, C_NONE, 13, 20, 0, 0, 0}, + {AADD, C_SHIFT, C_REG, C_NONE, C_REG, 3, 4, 0, 0, 0}, + {AADD, C_SHIFT, C_NONE, C_NONE, C_REG, 3, 4, 0, 0, 0}, + {AMVN, C_SHIFT, C_NONE, C_NONE, C_REG, 3, 4, 0, 0, 0}, + {ACMP, C_SHIFT, C_REG, C_NONE, C_NONE, 3, 4, 0, 0, 0}, + {ANEG, C_SHIFT, C_NONE, C_NONE, C_REG, 26, 4, 0, 0, 0}, + {AADD, C_REG, C_RSP, C_NONE, C_RSP, 27, 4, 0, 0, 0}, + {AADD, C_REG, C_NONE, C_NONE, C_RSP, 27, 4, 0, 0, 0}, + {ACMP, C_REG, C_RSP, C_NONE, C_NONE, 27, 4, 0, 0, 0}, + {AADD, C_EXTREG, C_RSP, C_NONE, C_RSP, 27, 4, 0, 0, 0}, + {AADD, C_EXTREG, C_NONE, C_NONE, C_RSP, 27, 4, 0, 0, 0}, + {AMVN, C_EXTREG, C_NONE, C_NONE, C_RSP, 27, 4, 0, 0, 0}, + {ACMP, C_EXTREG, C_RSP, C_NONE, C_NONE, 27, 4, 0, 0, 0}, + {AADD, C_REG, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AADD, C_REG, C_NONE, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AMUL, C_REG, C_REG, C_NONE, C_REG, 15, 4, 0, 0, 0}, + {AMUL, C_REG, C_NONE, C_NONE, C_REG, 15, 4, 0, 0, 0}, + {AMADD, C_REG, C_REG, C_REG, C_REG, 15, 4, 0, 0, 0}, + {AREM, C_REG, C_REG, C_NONE, C_REG, 16, 8, 0, 0, 0}, + {AREM, C_REG, C_NONE, C_NONE, C_REG, 16, 8, 0, 0, 0}, + {ASDIV, C_REG, C_NONE, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {ASDIV, C_REG, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0}, + + {AFADDS, C_FREG, C_NONE, C_NONE, C_FREG, 54, 4, 0, 0, 0}, + {AFADDS, C_FREG, C_FREG, C_NONE, C_FREG, 54, 4, 0, 0, 0}, + {AFMSUBD, C_FREG, C_FREG, C_FREG, C_FREG, 15, 4, 0, 0, 0}, + {AFCMPS, C_FREG, C_FREG, C_NONE, C_NONE, 56, 4, 0, 0, 0}, + {AFCMPS, C_FCON, C_FREG, C_NONE, C_NONE, 56, 4, 0, 0, 0}, + {AVADDP, C_ARNG, C_ARNG, C_NONE, C_ARNG, 72, 4, 0, 0, 0}, + {AVADD, C_ARNG, C_ARNG, C_NONE, C_ARNG, 72, 4, 0, 0, 0}, + {AVADD, C_VREG, C_VREG, C_NONE, C_VREG, 89, 4, 0, 0, 0}, + {AVADD, C_VREG, C_NONE, C_NONE, C_VREG, 89, 4, 0, 0, 0}, + {AVADDV, C_ARNG, C_NONE, C_NONE, C_VREG, 85, 4, 0, 0, 0}, + + /* logical operations */ + {AAND, C_REG, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AAND, C_REG, C_NONE, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AANDS, C_REG, C_REG, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {AANDS, C_REG, C_NONE, C_NONE, C_REG, 1, 4, 0, 0, 0}, + {ATST, C_REG, C_REG, C_NONE, C_NONE, 1, 4, 0, 0, 0}, + {AAND, C_MBCON, C_REG, C_NONE, C_RSP, 53, 4, 0, 0, 0}, + {AAND, C_MBCON, C_NONE, C_NONE, C_REG, 53, 4, 0, 0, 0}, + {AANDS, C_MBCON, C_REG, C_NONE, C_REG, 53, 4, 0, 0, 0}, + {AANDS, C_MBCON, C_NONE, C_NONE, C_REG, 53, 4, 0, 0, 0}, + {ATST, C_MBCON, C_REG, C_NONE, C_NONE, 53, 4, 0, 0, 0}, + {AAND, C_BITCON, C_REG, C_NONE, C_RSP, 53, 4, 0, 0, 0}, + {AAND, C_BITCON, C_NONE, C_NONE, C_REG, 53, 4, 0, 0, 0}, + {AANDS, C_BITCON, C_REG, C_NONE, C_REG, 53, 4, 0, 0, 0}, + {AANDS, C_BITCON, C_NONE, C_NONE, C_REG, 53, 4, 0, 0, 0}, + {ATST, C_BITCON, C_REG, C_NONE, C_NONE, 53, 4, 0, 0, 0}, + {AAND, C_MOVCON, C_REG, C_NONE, C_REG, 62, 8, 0, 0, 0}, + {AAND, C_MOVCON, C_NONE, C_NONE, C_REG, 62, 8, 0, 0, 0}, + {AANDS, C_MOVCON, C_REG, C_NONE, C_REG, 62, 8, 0, 0, 0}, + {AANDS, C_MOVCON, C_NONE, C_NONE, C_REG, 62, 8, 0, 0, 0}, + {ATST, C_MOVCON, C_REG, C_NONE, C_NONE, 62, 8, 0, 0, 0}, + {AAND, C_MOVCON2, C_REG, C_NONE, C_REG, 28, 12, 0, 0, 0}, + {AAND, C_MOVCON2, C_NONE, C_NONE, C_REG, 28, 12, 0, 0, 0}, + {AAND, C_MOVCON3, C_REG, C_NONE, C_REG, 28, 16, 0, 0, 0}, + {AAND, C_MOVCON3, C_NONE, C_NONE, C_REG, 28, 16, 0, 0, 0}, + {AAND, C_VCON, C_REG, C_NONE, C_REG, 28, 20, 0, 0, 0}, + {AAND, C_VCON, C_NONE, C_NONE, C_REG, 28, 20, 0, 0, 0}, + {AANDS, C_MOVCON2, C_REG, C_NONE, C_REG, 28, 12, 0, 0, 0}, + {AANDS, C_MOVCON2, C_NONE, C_NONE, C_REG, 28, 12, 0, 0, 0}, + {AANDS, C_MOVCON3, C_REG, C_NONE, C_REG, 28, 16, 0, 0, 0}, + {AANDS, C_MOVCON3, C_NONE, C_NONE, C_REG, 28, 16, 0, 0, 0}, + {AANDS, C_VCON, C_REG, C_NONE, C_REG, 28, 20, 0, 0, 0}, + {AANDS, C_VCON, C_NONE, C_NONE, C_REG, 28, 20, 0, 0, 0}, + {ATST, C_MOVCON2, C_REG, C_NONE, C_NONE, 28, 12, 0, 0, 0}, + {ATST, C_MOVCON3, C_REG, C_NONE, C_NONE, 28, 16, 0, 0, 0}, + {ATST, C_VCON, C_REG, C_NONE, C_NONE, 28, 20, 0, 0, 0}, + {AAND, C_SHIFT, C_REG, C_NONE, C_REG, 3, 4, 0, 0, 0}, + {AAND, C_SHIFT, C_NONE, C_NONE, C_REG, 3, 4, 0, 0, 0}, + {AANDS, C_SHIFT, C_REG, C_NONE, C_REG, 3, 4, 0, 0, 0}, + {AANDS, C_SHIFT, C_NONE, C_NONE, C_REG, 3, 4, 0, 0, 0}, + {ATST, C_SHIFT, C_REG, C_NONE, C_NONE, 3, 4, 0, 0, 0}, + {AMOVD, C_RSP, C_NONE, C_NONE, C_RSP, 24, 4, 0, 0, 0}, + {AMVN, C_REG, C_NONE, C_NONE, C_REG, 24, 4, 0, 0, 0}, + {AMOVB, C_REG, C_NONE, C_NONE, C_REG, 45, 4, 0, 0, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_REG, 45, 4, 0, 0, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_REG, 45, 4, 0, 0, 0}, /* also MOVHU */ + {AMOVW, C_REG, C_NONE, C_NONE, C_REG, 45, 4, 0, 0, 0}, /* also MOVWU */ + /* TODO: MVN C_SHIFT */ + + /* MOVs that become MOVK/MOVN/MOVZ/ADD/SUB/OR */ + {AMOVW, C_MOVCON, C_NONE, C_NONE, C_REG, 32, 4, 0, 0, 0}, + {AMOVD, C_MOVCON, C_NONE, C_NONE, C_REG, 32, 4, 0, 0, 0}, + {AMOVW, C_BITCON, C_NONE, C_NONE, C_REG, 32, 4, 0, 0, 0}, + {AMOVD, C_BITCON, C_NONE, C_NONE, C_REG, 32, 4, 0, 0, 0}, + {AMOVW, C_MOVCON2, C_NONE, C_NONE, C_REG, 12, 8, 0, NOTUSETMP, 0}, + {AMOVD, C_MOVCON2, C_NONE, C_NONE, C_REG, 12, 8, 0, NOTUSETMP, 0}, + {AMOVD, C_MOVCON3, C_NONE, C_NONE, C_REG, 12, 12, 0, NOTUSETMP, 0}, + {AMOVD, C_VCON, C_NONE, C_NONE, C_REG, 12, 16, 0, NOTUSETMP, 0}, + + {AMOVK, C_VCON, C_NONE, C_NONE, C_REG, 33, 4, 0, 0, 0}, + {AMOVD, C_AACON, C_NONE, C_NONE, C_RSP, 4, 4, REGFROM, 0, 0}, + {AMOVD, C_AACON2, C_NONE, C_NONE, C_RSP, 4, 8, REGFROM, 0, 0}, + + /* load long effective stack address (load int32 offset and add) */ + {AMOVD, C_LACON, C_NONE, C_NONE, C_RSP, 34, 8, REGSP, LFROM, 0}, + + // Move a large constant to a Vn. + {AFMOVQ, C_VCON, C_NONE, C_NONE, C_VREG, 101, 4, 0, LFROM, 0}, + {AFMOVD, C_VCON, C_NONE, C_NONE, C_VREG, 101, 4, 0, LFROM, 0}, + {AFMOVS, C_LCON, C_NONE, C_NONE, C_VREG, 101, 4, 0, LFROM, 0}, + + /* jump operations */ + {AB, C_NONE, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0}, + {ABL, C_NONE, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0}, + {AB, C_NONE, C_NONE, C_NONE, C_ZOREG, 6, 4, 0, 0, 0}, + {ABL, C_NONE, C_NONE, C_NONE, C_REG, 6, 4, 0, 0, 0}, + {ABL, C_REG, C_NONE, C_NONE, C_REG, 6, 4, 0, 0, 0}, + {ABL, C_NONE, C_NONE, C_NONE, C_ZOREG, 6, 4, 0, 0, 0}, + {obj.ARET, C_NONE, C_NONE, C_NONE, C_REG, 6, 4, 0, 0, 0}, + {obj.ARET, C_NONE, C_NONE, C_NONE, C_ZOREG, 6, 4, 0, 0, 0}, + {ABEQ, C_NONE, C_NONE, C_NONE, C_SBRA, 7, 4, 0, 0, 0}, + {ACBZ, C_REG, C_NONE, C_NONE, C_SBRA, 39, 4, 0, 0, 0}, + {ATBZ, C_VCON, C_REG, C_NONE, C_SBRA, 40, 4, 0, 0, 0}, + {AERET, C_NONE, C_NONE, C_NONE, C_NONE, 41, 4, 0, 0, 0}, + + // get a PC-relative address + {AADRP, C_SBRA, C_NONE, C_NONE, C_REG, 60, 4, 0, 0, 0}, + {AADR, C_SBRA, C_NONE, C_NONE, C_REG, 61, 4, 0, 0, 0}, + + {ACLREX, C_NONE, C_NONE, C_NONE, C_VCON, 38, 4, 0, 0, 0}, + {ACLREX, C_NONE, C_NONE, C_NONE, C_NONE, 38, 4, 0, 0, 0}, + {ABFM, C_VCON, C_REG, C_VCON, C_REG, 42, 4, 0, 0, 0}, + {ABFI, C_VCON, C_REG, C_VCON, C_REG, 43, 4, 0, 0, 0}, + {AEXTR, C_VCON, C_REG, C_REG, C_REG, 44, 4, 0, 0, 0}, + {ASXTB, C_REG, C_NONE, C_NONE, C_REG, 45, 4, 0, 0, 0}, + {ACLS, C_REG, C_NONE, C_NONE, C_REG, 46, 4, 0, 0, 0}, + {ALSL, C_VCON, C_REG, C_NONE, C_REG, 8, 4, 0, 0, 0}, + {ALSL, C_VCON, C_NONE, C_NONE, C_REG, 8, 4, 0, 0, 0}, + {ALSL, C_REG, C_NONE, C_NONE, C_REG, 9, 4, 0, 0, 0}, + {ALSL, C_REG, C_REG, C_NONE, C_REG, 9, 4, 0, 0, 0}, + {ASVC, C_VCON, C_NONE, C_NONE, C_NONE, 10, 4, 0, 0, 0}, + {ASVC, C_NONE, C_NONE, C_NONE, C_NONE, 10, 4, 0, 0, 0}, + {ADWORD, C_NONE, C_NONE, C_NONE, C_VCON, 11, 8, 0, NOTUSETMP, 0}, + {ADWORD, C_NONE, C_NONE, C_NONE, C_LEXT, 11, 8, 0, NOTUSETMP, 0}, + {ADWORD, C_NONE, C_NONE, C_NONE, C_ADDR, 11, 8, 0, NOTUSETMP, 0}, + {ADWORD, C_NONE, C_NONE, C_NONE, C_LACON, 11, 8, 0, NOTUSETMP, 0}, + {AWORD, C_NONE, C_NONE, C_NONE, C_LCON, 14, 4, 0, 0, 0}, + {AWORD, C_NONE, C_NONE, C_NONE, C_LEXT, 14, 4, 0, 0, 0}, + {AWORD, C_NONE, C_NONE, C_NONE, C_ADDR, 14, 4, 0, 0, 0}, + {AMOVW, C_VCONADDR, C_NONE, C_NONE, C_REG, 68, 8, 0, NOTUSETMP, 0}, + {AMOVD, C_VCONADDR, C_NONE, C_NONE, C_REG, 68, 8, 0, NOTUSETMP, 0}, + {AMOVB, C_REG, C_NONE, C_NONE, C_ADDR, 64, 12, 0, 0, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_ADDR, 64, 12, 0, 0, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_ADDR, 64, 12, 0, 0, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_ADDR, 64, 12, 0, 0, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_ADDR, 64, 12, 0, 0, 0}, + {AMOVB, C_ADDR, C_NONE, C_NONE, C_REG, 65, 12, 0, 0, 0}, + {AMOVBU, C_ADDR, C_NONE, C_NONE, C_REG, 65, 12, 0, 0, 0}, + {AMOVH, C_ADDR, C_NONE, C_NONE, C_REG, 65, 12, 0, 0, 0}, + {AMOVW, C_ADDR, C_NONE, C_NONE, C_REG, 65, 12, 0, 0, 0}, + {AMOVD, C_ADDR, C_NONE, C_NONE, C_REG, 65, 12, 0, 0, 0}, + {AMOVD, C_GOTADDR, C_NONE, C_NONE, C_REG, 71, 8, 0, 0, 0}, + {AMOVD, C_TLS_LE, C_NONE, C_NONE, C_REG, 69, 4, 0, 0, 0}, + {AMOVD, C_TLS_IE, C_NONE, C_NONE, C_REG, 70, 8, 0, 0, 0}, + + {AFMOVS, C_FREG, C_NONE, C_NONE, C_ADDR, 64, 12, 0, 0, 0}, + {AFMOVS, C_ADDR, C_NONE, C_NONE, C_FREG, 65, 12, 0, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_ADDR, 64, 12, 0, 0, 0}, + {AFMOVD, C_ADDR, C_NONE, C_NONE, C_FREG, 65, 12, 0, 0, 0}, + {AFMOVS, C_FCON, C_NONE, C_NONE, C_FREG, 55, 4, 0, 0, 0}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_FREG, 54, 4, 0, 0, 0}, + {AFMOVD, C_FCON, C_NONE, C_NONE, C_FREG, 55, 4, 0, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_FREG, 54, 4, 0, 0, 0}, + {AFMOVS, C_REG, C_NONE, C_NONE, C_FREG, 29, 4, 0, 0, 0}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_REG, 29, 4, 0, 0, 0}, + {AFMOVD, C_REG, C_NONE, C_NONE, C_FREG, 29, 4, 0, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_REG, 29, 4, 0, 0, 0}, + {AFCVTZSD, C_FREG, C_NONE, C_NONE, C_REG, 29, 4, 0, 0, 0}, + {ASCVTFD, C_REG, C_NONE, C_NONE, C_FREG, 29, 4, 0, 0, 0}, + {AFCVTSD, C_FREG, C_NONE, C_NONE, C_FREG, 29, 4, 0, 0, 0}, + {AVMOV, C_ELEM, C_NONE, C_NONE, C_REG, 73, 4, 0, 0, 0}, + {AVMOV, C_ELEM, C_NONE, C_NONE, C_ELEM, 92, 4, 0, 0, 0}, + {AVMOV, C_ELEM, C_NONE, C_NONE, C_VREG, 80, 4, 0, 0, 0}, + {AVMOV, C_REG, C_NONE, C_NONE, C_ARNG, 82, 4, 0, 0, 0}, + {AVMOV, C_REG, C_NONE, C_NONE, C_ELEM, 78, 4, 0, 0, 0}, + {AVMOV, C_ARNG, C_NONE, C_NONE, C_ARNG, 83, 4, 0, 0, 0}, + {AVDUP, C_ELEM, C_NONE, C_NONE, C_ARNG, 79, 4, 0, 0, 0}, + {AVMOVI, C_ADDCON, C_NONE, C_NONE, C_ARNG, 86, 4, 0, 0, 0}, + {AVFMLA, C_ARNG, C_ARNG, C_NONE, C_ARNG, 72, 4, 0, 0, 0}, + {AVEXT, C_VCON, C_ARNG, C_ARNG, C_ARNG, 94, 4, 0, 0, 0}, + {AVTBL, C_ARNG, C_NONE, C_LIST, C_ARNG, 100, 4, 0, 0, 0}, + {AVUSHR, C_VCON, C_ARNG, C_NONE, C_ARNG, 95, 4, 0, 0, 0}, + {AVZIP1, C_ARNG, C_ARNG, C_NONE, C_ARNG, 72, 4, 0, 0, 0}, + {AVUSHLL, C_VCON, C_ARNG, C_NONE, C_ARNG, 102, 4, 0, 0, 0}, + {AVUXTL, C_ARNG, C_NONE, C_NONE, C_ARNG, 102, 4, 0, 0, 0}, + + /* conditional operations */ + {ACSEL, C_COND, C_REG, C_REG, C_REG, 18, 4, 0, 0, 0}, + {ACINC, C_COND, C_REG, C_NONE, C_REG, 18, 4, 0, 0, 0}, + {ACSET, C_COND, C_NONE, C_NONE, C_REG, 18, 4, 0, 0, 0}, + {AFCSELD, C_COND, C_FREG, C_FREG, C_FREG, 18, 4, 0, 0, 0}, + {ACCMN, C_COND, C_REG, C_REG, C_VCON, 19, 4, 0, 0, 0}, + {ACCMN, C_COND, C_REG, C_VCON, C_VCON, 19, 4, 0, 0, 0}, + {AFCCMPS, C_COND, C_FREG, C_FREG, C_VCON, 57, 4, 0, 0, 0}, + + /* scaled 12-bit unsigned displacement store */ + {AMOVB, C_REG, C_NONE, C_NONE, C_UAUTO4K, 20, 4, REGSP, 0, 0}, + {AMOVB, C_REG, C_NONE, C_NONE, C_UOREG4K, 20, 4, 0, 0, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_UAUTO4K, 20, 4, REGSP, 0, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_UOREG4K, 20, 4, 0, 0, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_UAUTO8K, 20, 4, REGSP, 0, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_UOREG8K, 20, 4, 0, 0, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_UAUTO16K, 20, 4, REGSP, 0, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_UOREG16K, 20, 4, 0, 0, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_UAUTO32K, 20, 4, REGSP, 0, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_UOREG32K, 20, 4, 0, 0, 0}, + + {AFMOVS, C_FREG, C_NONE, C_NONE, C_UAUTO16K, 20, 4, REGSP, 0, 0}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_UOREG16K, 20, 4, 0, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_UAUTO32K, 20, 4, REGSP, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_UOREG32K, 20, 4, 0, 0, 0}, + + /* unscaled 9-bit signed displacement store */ + {AMOVB, C_REG, C_NONE, C_NONE, C_NSAUTO, 20, 4, REGSP, 0, 0}, + {AMOVB, C_REG, C_NONE, C_NONE, C_NSOREG, 20, 4, 0, 0, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_NSAUTO, 20, 4, REGSP, 0, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_NSOREG, 20, 4, 0, 0, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_NSAUTO, 20, 4, REGSP, 0, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_NSOREG, 20, 4, 0, 0, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_NSAUTO, 20, 4, REGSP, 0, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_NSOREG, 20, 4, 0, 0, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_NSAUTO, 20, 4, REGSP, 0, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_NSOREG, 20, 4, 0, 0, 0}, + + {AFMOVS, C_FREG, C_NONE, C_NONE, C_NSAUTO, 20, 4, REGSP, 0, 0}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_NSOREG, 20, 4, 0, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_NSAUTO, 20, 4, REGSP, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_NSOREG, 20, 4, 0, 0, 0}, + + /* scaled 12-bit unsigned displacement load */ + {AMOVB, C_UAUTO4K, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVB, C_UOREG4K, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVBU, C_UAUTO4K, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVBU, C_UOREG4K, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVH, C_UAUTO8K, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVH, C_UOREG8K, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVW, C_UAUTO16K, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVW, C_UOREG16K, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVD, C_UAUTO32K, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVD, C_UOREG32K, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + + {AFMOVS, C_UAUTO16K, C_NONE, C_NONE, C_FREG, 21, 4, REGSP, 0, 0}, + {AFMOVS, C_UOREG16K, C_NONE, C_NONE, C_FREG, 21, 4, 0, 0, 0}, + {AFMOVD, C_UAUTO32K, C_NONE, C_NONE, C_FREG, 21, 4, REGSP, 0, 0}, + {AFMOVD, C_UOREG32K, C_NONE, C_NONE, C_FREG, 21, 4, 0, 0, 0}, + + /* unscaled 9-bit signed displacement load */ + {AMOVB, C_NSAUTO, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVB, C_NSOREG, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVBU, C_NSAUTO, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVBU, C_NSOREG, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVH, C_NSAUTO, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVH, C_NSOREG, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVW, C_NSAUTO, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVW, C_NSOREG, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + {AMOVD, C_NSAUTO, C_NONE, C_NONE, C_REG, 21, 4, REGSP, 0, 0}, + {AMOVD, C_NSOREG, C_NONE, C_NONE, C_REG, 21, 4, 0, 0, 0}, + + {AFMOVS, C_NSAUTO, C_NONE, C_NONE, C_FREG, 21, 4, REGSP, 0, 0}, + {AFMOVS, C_NSOREG, C_NONE, C_NONE, C_FREG, 21, 4, 0, 0, 0}, + {AFMOVD, C_NSAUTO, C_NONE, C_NONE, C_FREG, 21, 4, REGSP, 0, 0}, + {AFMOVD, C_NSOREG, C_NONE, C_NONE, C_FREG, 21, 4, 0, 0, 0}, + + /* long displacement store */ + {AMOVB, C_REG, C_NONE, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0}, + {AMOVB, C_REG, C_NONE, C_NONE, C_LOREG, 30, 8, 0, LTO, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_LOREG, 30, 8, 0, LTO, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_LOREG, 30, 8, 0, LTO, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_LOREG, 30, 8, 0, LTO, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_LOREG, 30, 8, 0, LTO, 0}, + + {AFMOVS, C_FREG, C_NONE, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_LOREG, 30, 8, 0, LTO, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_LAUTO, 30, 8, REGSP, LTO, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_LOREG, 30, 8, 0, LTO, 0}, + + /* long displacement load */ + {AMOVB, C_LAUTO, C_NONE, C_NONE, C_REG, 31, 8, REGSP, LFROM, 0}, + {AMOVB, C_LOREG, C_NONE, C_NONE, C_REG, 31, 8, 0, LFROM, 0}, + {AMOVBU, C_LAUTO, C_NONE, C_NONE, C_REG, 31, 8, REGSP, LFROM, 0}, + {AMOVBU, C_LOREG, C_NONE, C_NONE, C_REG, 31, 8, 0, LFROM, 0}, + {AMOVH, C_LAUTO, C_NONE, C_NONE, C_REG, 31, 8, REGSP, LFROM, 0}, + {AMOVH, C_LOREG, C_NONE, C_NONE, C_REG, 31, 8, 0, LFROM, 0}, + {AMOVW, C_LAUTO, C_NONE, C_NONE, C_REG, 31, 8, REGSP, LFROM, 0}, + {AMOVW, C_LOREG, C_NONE, C_NONE, C_REG, 31, 8, 0, LFROM, 0}, + {AMOVD, C_LAUTO, C_NONE, C_NONE, C_REG, 31, 8, REGSP, LFROM, 0}, + {AMOVD, C_LOREG, C_NONE, C_NONE, C_REG, 31, 8, 0, LFROM, 0}, + + {AFMOVS, C_LAUTO, C_NONE, C_NONE, C_FREG, 31, 8, REGSP, LFROM, 0}, + {AFMOVS, C_LOREG, C_NONE, C_NONE, C_FREG, 31, 8, 0, LFROM, 0}, + {AFMOVD, C_LAUTO, C_NONE, C_NONE, C_FREG, 31, 8, REGSP, LFROM, 0}, + {AFMOVD, C_LOREG, C_NONE, C_NONE, C_FREG, 31, 8, 0, LFROM, 0}, + + /* pre/post-indexed load (unscaled, signed 9-bit offset) */ + {AMOVD, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPOST}, + {AMOVW, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPOST}, + {AMOVH, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPOST}, + {AMOVB, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPOST}, + {AMOVBU, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPOST}, + {AFMOVS, C_LOREG, C_NONE, C_NONE, C_FREG, 22, 4, 0, 0, C_XPOST}, + {AFMOVD, C_LOREG, C_NONE, C_NONE, C_FREG, 22, 4, 0, 0, C_XPOST}, + + {AMOVD, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPRE}, + {AMOVW, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPRE}, + {AMOVH, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPRE}, + {AMOVB, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPRE}, + {AMOVBU, C_LOREG, C_NONE, C_NONE, C_REG, 22, 4, 0, 0, C_XPRE}, + {AFMOVS, C_LOREG, C_NONE, C_NONE, C_FREG, 22, 4, 0, 0, C_XPRE}, + {AFMOVD, C_LOREG, C_NONE, C_NONE, C_FREG, 22, 4, 0, 0, C_XPRE}, + + /* pre/post-indexed store (unscaled, signed 9-bit offset) */ + {AMOVD, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPOST}, + {AMOVW, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPOST}, + {AMOVH, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPOST}, + {AMOVB, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPOST}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPOST}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPOST}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPOST}, + + {AMOVD, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPRE}, + {AMOVW, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPRE}, + {AMOVH, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPRE}, + {AMOVB, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPRE}, + {AMOVBU, C_REG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPRE}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPRE}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_LOREG, 23, 4, 0, 0, C_XPRE}, + + /* load with shifted or extended register offset */ + {AMOVD, C_ROFF, C_NONE, C_NONE, C_REG, 98, 4, 0, 0, 0}, + {AMOVW, C_ROFF, C_NONE, C_NONE, C_REG, 98, 4, 0, 0, 0}, + {AMOVH, C_ROFF, C_NONE, C_NONE, C_REG, 98, 4, 0, 0, 0}, + {AMOVB, C_ROFF, C_NONE, C_NONE, C_REG, 98, 4, 0, 0, 0}, + {AMOVBU, C_ROFF, C_NONE, C_NONE, C_REG, 98, 4, 0, 0, 0}, + {AFMOVS, C_ROFF, C_NONE, C_NONE, C_FREG, 98, 4, 0, 0, 0}, + {AFMOVD, C_ROFF, C_NONE, C_NONE, C_FREG, 98, 4, 0, 0, 0}, + + /* store with extended register offset */ + {AMOVD, C_REG, C_NONE, C_NONE, C_ROFF, 99, 4, 0, 0, 0}, + {AMOVW, C_REG, C_NONE, C_NONE, C_ROFF, 99, 4, 0, 0, 0}, + {AMOVH, C_REG, C_NONE, C_NONE, C_ROFF, 99, 4, 0, 0, 0}, + {AMOVB, C_REG, C_NONE, C_NONE, C_ROFF, 99, 4, 0, 0, 0}, + {AFMOVS, C_FREG, C_NONE, C_NONE, C_ROFF, 99, 4, 0, 0, 0}, + {AFMOVD, C_FREG, C_NONE, C_NONE, C_ROFF, 99, 4, 0, 0, 0}, + + /* pre/post-indexed/signed-offset load/store register pair + (unscaled, signed 10-bit quad-aligned and long offset) */ + {ALDP, C_NPAUTO, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, 0}, + {ALDP, C_NPAUTO, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPRE}, + {ALDP, C_NPAUTO, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPOST}, + {ALDP, C_PPAUTO, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, 0}, + {ALDP, C_PPAUTO, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPRE}, + {ALDP, C_PPAUTO, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPOST}, + {ALDP, C_UAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, 0}, + {ALDP, C_UAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPRE}, + {ALDP, C_UAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPOST}, + {ALDP, C_NAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, 0}, + {ALDP, C_NAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPRE}, + {ALDP, C_NAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPOST}, + {ALDP, C_LAUTO, C_NONE, C_NONE, C_PAIR, 75, 12, REGSP, LFROM, 0}, + {ALDP, C_LAUTO, C_NONE, C_NONE, C_PAIR, 75, 12, REGSP, LFROM, C_XPRE}, + {ALDP, C_LAUTO, C_NONE, C_NONE, C_PAIR, 75, 12, REGSP, LFROM, C_XPOST}, + {ALDP, C_NPOREG, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, 0}, + {ALDP, C_NPOREG, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPRE}, + {ALDP, C_NPOREG, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPOST}, + {ALDP, C_PPOREG, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, 0}, + {ALDP, C_PPOREG, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPRE}, + {ALDP, C_PPOREG, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPOST}, + {ALDP, C_UOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, 0}, + {ALDP, C_UOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPRE}, + {ALDP, C_UOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPOST}, + {ALDP, C_NOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, 0}, + {ALDP, C_NOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPRE}, + {ALDP, C_NOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPOST}, + {ALDP, C_LOREG, C_NONE, C_NONE, C_PAIR, 75, 12, 0, LFROM, 0}, + {ALDP, C_LOREG, C_NONE, C_NONE, C_PAIR, 75, 12, 0, LFROM, C_XPRE}, + {ALDP, C_LOREG, C_NONE, C_NONE, C_PAIR, 75, 12, 0, LFROM, C_XPOST}, + {ALDP, C_ADDR, C_NONE, C_NONE, C_PAIR, 88, 12, 0, 0, 0}, + + {ASTP, C_PAIR, C_NONE, C_NONE, C_NPAUTO, 67, 4, REGSP, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NPAUTO, 67, 4, REGSP, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NPAUTO, 67, 4, REGSP, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_PPAUTO, 67, 4, REGSP, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_PPAUTO, 67, 4, REGSP, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_PPAUTO, 67, 4, REGSP, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_UAUTO4K, 76, 8, REGSP, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_UAUTO4K, 76, 8, REGSP, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_UAUTO4K, 76, 8, REGSP, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NAUTO4K, 76, 12, REGSP, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NAUTO4K, 76, 12, REGSP, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NAUTO4K, 76, 12, REGSP, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_LAUTO, 77, 12, REGSP, LTO, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_LAUTO, 77, 12, REGSP, LTO, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_LAUTO, 77, 12, REGSP, LTO, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NPOREG, 67, 4, 0, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NPOREG, 67, 4, 0, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NPOREG, 67, 4, 0, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_PPOREG, 67, 4, 0, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_PPOREG, 67, 4, 0, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_PPOREG, 67, 4, 0, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_UOREG4K, 76, 8, 0, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_UOREG4K, 76, 8, 0, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_UOREG4K, 76, 8, 0, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NOREG4K, 76, 8, 0, 0, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NOREG4K, 76, 8, 0, 0, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_NOREG4K, 76, 8, 0, 0, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_LOREG, 77, 12, 0, LTO, 0}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_LOREG, 77, 12, 0, LTO, C_XPRE}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_LOREG, 77, 12, 0, LTO, C_XPOST}, + {ASTP, C_PAIR, C_NONE, C_NONE, C_ADDR, 87, 12, 0, 0, 0}, + + // differ from LDP/STP for C_NSAUTO_4/C_PSAUTO_4/C_NSOREG_4/C_PSOREG_4 + {ALDPW, C_NSAUTO_4, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, 0}, + {ALDPW, C_NSAUTO_4, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPRE}, + {ALDPW, C_NSAUTO_4, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPOST}, + {ALDPW, C_PSAUTO_4, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, 0}, + {ALDPW, C_PSAUTO_4, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPRE}, + {ALDPW, C_PSAUTO_4, C_NONE, C_NONE, C_PAIR, 66, 4, REGSP, 0, C_XPOST}, + {ALDPW, C_UAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, 0}, + {ALDPW, C_UAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPRE}, + {ALDPW, C_UAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPOST}, + {ALDPW, C_NAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, 0}, + {ALDPW, C_NAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPRE}, + {ALDPW, C_NAUTO4K, C_NONE, C_NONE, C_PAIR, 74, 8, REGSP, 0, C_XPOST}, + {ALDPW, C_LAUTO, C_NONE, C_NONE, C_PAIR, 75, 12, REGSP, LFROM, 0}, + {ALDPW, C_LAUTO, C_NONE, C_NONE, C_PAIR, 75, 12, REGSP, LFROM, C_XPRE}, + {ALDPW, C_LAUTO, C_NONE, C_NONE, C_PAIR, 75, 12, REGSP, LFROM, C_XPOST}, + {ALDPW, C_NSOREG_4, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, 0}, + {ALDPW, C_NSOREG_4, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPRE}, + {ALDPW, C_NSOREG_4, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPOST}, + {ALDPW, C_PSOREG_4, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, 0}, + {ALDPW, C_PSOREG_4, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPRE}, + {ALDPW, C_PSOREG_4, C_NONE, C_NONE, C_PAIR, 66, 4, 0, 0, C_XPOST}, + {ALDPW, C_UOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, 0}, + {ALDPW, C_UOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPRE}, + {ALDPW, C_UOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPOST}, + {ALDPW, C_NOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, 0}, + {ALDPW, C_NOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPRE}, + {ALDPW, C_NOREG4K, C_NONE, C_NONE, C_PAIR, 74, 8, 0, 0, C_XPOST}, + {ALDPW, C_LOREG, C_NONE, C_NONE, C_PAIR, 75, 12, 0, LFROM, 0}, + {ALDPW, C_LOREG, C_NONE, C_NONE, C_PAIR, 75, 12, 0, LFROM, C_XPRE}, + {ALDPW, C_LOREG, C_NONE, C_NONE, C_PAIR, 75, 12, 0, LFROM, C_XPOST}, + {ALDPW, C_ADDR, C_NONE, C_NONE, C_PAIR, 88, 12, 0, 0, 0}, + + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NSAUTO_4, 67, 4, REGSP, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NSAUTO_4, 67, 4, REGSP, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NSAUTO_4, 67, 4, REGSP, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_PSAUTO_4, 67, 4, REGSP, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_PSAUTO_4, 67, 4, REGSP, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_PSAUTO_4, 67, 4, REGSP, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_UAUTO4K, 76, 8, REGSP, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_UAUTO4K, 76, 8, REGSP, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_UAUTO4K, 76, 8, REGSP, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NAUTO4K, 76, 12, REGSP, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NAUTO4K, 76, 12, REGSP, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NAUTO4K, 76, 12, REGSP, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_LAUTO, 77, 12, REGSP, LTO, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_LAUTO, 77, 12, REGSP, LTO, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_LAUTO, 77, 12, REGSP, LTO, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NSOREG_4, 67, 4, 0, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NSOREG_4, 67, 4, 0, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NSOREG_4, 67, 4, 0, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_PSOREG_4, 67, 4, 0, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_PSOREG_4, 67, 4, 0, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_PSOREG_4, 67, 4, 0, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_UOREG4K, 76, 8, 0, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_UOREG4K, 76, 8, 0, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_UOREG4K, 76, 8, 0, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NOREG4K, 76, 8, 0, 0, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NOREG4K, 76, 8, 0, 0, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_NOREG4K, 76, 8, 0, 0, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_LOREG, 77, 12, 0, LTO, 0}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_LOREG, 77, 12, 0, LTO, C_XPRE}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_LOREG, 77, 12, 0, LTO, C_XPOST}, + {ASTPW, C_PAIR, C_NONE, C_NONE, C_ADDR, 87, 12, 0, 0, 0}, + + {ASWPD, C_REG, C_NONE, C_NONE, C_ZOREG, 47, 4, 0, 0, 0}, // RegTo2=C_REG + {ASWPD, C_REG, C_NONE, C_NONE, C_ZAUTO, 47, 4, REGSP, 0, 0}, // RegTo2=C_REG + {ALDAR, C_ZOREG, C_NONE, C_NONE, C_REG, 58, 4, 0, 0, 0}, + {ALDXR, C_ZOREG, C_NONE, C_NONE, C_REG, 58, 4, 0, 0, 0}, + {ALDAXR, C_ZOREG, C_NONE, C_NONE, C_REG, 58, 4, 0, 0, 0}, + {ALDXP, C_ZOREG, C_NONE, C_NONE, C_PAIR, 58, 4, 0, 0, 0}, + {ASTLR, C_REG, C_NONE, C_NONE, C_ZOREG, 59, 4, 0, 0, 0}, // RegTo2=C_NONE + {ASTXR, C_REG, C_NONE, C_NONE, C_ZOREG, 59, 4, 0, 0, 0}, // RegTo2=C_REG + {ASTLXR, C_REG, C_NONE, C_NONE, C_ZOREG, 59, 4, 0, 0, 0}, // RegTo2=C_REG + {ASTXP, C_PAIR, C_NONE, C_NONE, C_ZOREG, 59, 4, 0, 0, 0}, + + /* VLD[1-4]/VST[1-4] */ + {AVLD1, C_ZOREG, C_NONE, C_NONE, C_LIST, 81, 4, 0, 0, 0}, + {AVLD1, C_LOREG, C_NONE, C_NONE, C_LIST, 81, 4, 0, 0, C_XPOST}, + {AVLD1, C_ROFF, C_NONE, C_NONE, C_LIST, 81, 4, 0, 0, C_XPOST}, + {AVLD1R, C_ZOREG, C_NONE, C_NONE, C_LIST, 81, 4, 0, 0, 0}, + {AVLD1R, C_LOREG, C_NONE, C_NONE, C_LIST, 81, 4, 0, 0, C_XPOST}, + {AVLD1R, C_ROFF, C_NONE, C_NONE, C_LIST, 81, 4, 0, 0, C_XPOST}, + {AVLD1, C_LOREG, C_NONE, C_NONE, C_ELEM, 97, 4, 0, 0, C_XPOST}, + {AVLD1, C_ROFF, C_NONE, C_NONE, C_ELEM, 97, 4, 0, 0, C_XPOST}, + {AVLD1, C_LOREG, C_NONE, C_NONE, C_ELEM, 97, 4, 0, 0, 0}, + {AVST1, C_LIST, C_NONE, C_NONE, C_ZOREG, 84, 4, 0, 0, 0}, + {AVST1, C_LIST, C_NONE, C_NONE, C_LOREG, 84, 4, 0, 0, C_XPOST}, + {AVST1, C_LIST, C_NONE, C_NONE, C_ROFF, 84, 4, 0, 0, C_XPOST}, + {AVST2, C_LIST, C_NONE, C_NONE, C_ZOREG, 84, 4, 0, 0, 0}, + {AVST2, C_LIST, C_NONE, C_NONE, C_LOREG, 84, 4, 0, 0, C_XPOST}, + {AVST2, C_LIST, C_NONE, C_NONE, C_ROFF, 84, 4, 0, 0, C_XPOST}, + {AVST3, C_LIST, C_NONE, C_NONE, C_ZOREG, 84, 4, 0, 0, 0}, + {AVST3, C_LIST, C_NONE, C_NONE, C_LOREG, 84, 4, 0, 0, C_XPOST}, + {AVST3, C_LIST, C_NONE, C_NONE, C_ROFF, 84, 4, 0, 0, C_XPOST}, + {AVST4, C_LIST, C_NONE, C_NONE, C_ZOREG, 84, 4, 0, 0, 0}, + {AVST4, C_LIST, C_NONE, C_NONE, C_LOREG, 84, 4, 0, 0, C_XPOST}, + {AVST4, C_LIST, C_NONE, C_NONE, C_ROFF, 84, 4, 0, 0, C_XPOST}, + {AVST1, C_ELEM, C_NONE, C_NONE, C_LOREG, 96, 4, 0, 0, C_XPOST}, + {AVST1, C_ELEM, C_NONE, C_NONE, C_ROFF, 96, 4, 0, 0, C_XPOST}, + {AVST1, C_ELEM, C_NONE, C_NONE, C_LOREG, 96, 4, 0, 0, 0}, + + /* special */ + {AMOVD, C_SPR, C_NONE, C_NONE, C_REG, 35, 4, 0, 0, 0}, + {AMRS, C_SPR, C_NONE, C_NONE, C_REG, 35, 4, 0, 0, 0}, + {AMOVD, C_REG, C_NONE, C_NONE, C_SPR, 36, 4, 0, 0, 0}, + {AMSR, C_REG, C_NONE, C_NONE, C_SPR, 36, 4, 0, 0, 0}, + {AMOVD, C_VCON, C_NONE, C_NONE, C_SPR, 37, 4, 0, 0, 0}, + {AMSR, C_VCON, C_NONE, C_NONE, C_SPR, 37, 4, 0, 0, 0}, + {APRFM, C_UOREG32K, C_NONE, C_NONE, C_SPR, 91, 4, 0, 0, 0}, + {APRFM, C_UOREG32K, C_NONE, C_NONE, C_LCON, 91, 4, 0, 0, 0}, + {ADMB, C_VCON, C_NONE, C_NONE, C_NONE, 51, 4, 0, 0, 0}, + {AHINT, C_VCON, C_NONE, C_NONE, C_NONE, 52, 4, 0, 0, 0}, + {ASYS, C_VCON, C_NONE, C_NONE, C_NONE, 50, 4, 0, 0, 0}, + {ASYS, C_VCON, C_REG, C_NONE, C_NONE, 50, 4, 0, 0, 0}, + {ASYSL, C_VCON, C_NONE, C_NONE, C_REG, 50, 4, 0, 0, 0}, + + /* encryption instructions */ + {AAESD, C_VREG, C_NONE, C_NONE, C_VREG, 29, 4, 0, 0, 0}, // for compatibility with old code + {AAESD, C_ARNG, C_NONE, C_NONE, C_ARNG, 29, 4, 0, 0, 0}, // recommend using the new one for better readability + {ASHA1C, C_VREG, C_REG, C_NONE, C_VREG, 1, 4, 0, 0, 0}, + {ASHA1C, C_ARNG, C_VREG, C_NONE, C_VREG, 1, 4, 0, 0, 0}, + {ASHA1H, C_VREG, C_NONE, C_NONE, C_VREG, 29, 4, 0, 0, 0}, + {ASHA1SU0, C_ARNG, C_ARNG, C_NONE, C_ARNG, 1, 4, 0, 0, 0}, + {ASHA256H, C_ARNG, C_VREG, C_NONE, C_VREG, 1, 4, 0, 0, 0}, + {AVREV32, C_ARNG, C_NONE, C_NONE, C_ARNG, 83, 4, 0, 0, 0}, + {AVPMULL, C_ARNG, C_ARNG, C_NONE, C_ARNG, 93, 4, 0, 0, 0}, + + {obj.AUNDEF, C_NONE, C_NONE, C_NONE, C_NONE, 90, 4, 0, 0, 0}, + {obj.APCDATA, C_VCON, C_NONE, C_NONE, C_VCON, 0, 0, 0, 0, 0}, + {obj.AFUNCDATA, C_VCON, C_NONE, C_NONE, C_ADDR, 0, 0, 0, 0, 0}, + {obj.ANOP, C_NONE, C_NONE, C_NONE, C_NONE, 0, 0, 0, 0, 0}, + {obj.ANOP, C_LCON, C_NONE, C_NONE, C_NONE, 0, 0, 0, 0, 0}, // nop variants, see #40689 + {obj.ANOP, C_REG, C_NONE, C_NONE, C_NONE, 0, 0, 0, 0, 0}, + {obj.ANOP, C_VREG, C_NONE, C_NONE, C_NONE, 0, 0, 0, 0, 0}, + {obj.ADUFFZERO, C_NONE, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0}, // same as AB/ABL + {obj.ADUFFCOPY, C_NONE, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0}, // same as AB/ABL + {obj.APCALIGN, C_LCON, C_NONE, C_NONE, C_NONE, 0, 0, 0, 0, 0}, // align code + + {obj.AXXX, C_NONE, C_NONE, C_NONE, C_NONE, 0, 4, 0, 0, 0}, +} + +/* + * valid pstate field values, and value to use in instruction + */ +var pstatefield = []struct { + reg int16 + enc uint32 +}{ + {REG_SPSel, 0<<16 | 4<<12 | 5<<5}, + {REG_DAIFSet, 3<<16 | 4<<12 | 6<<5}, + {REG_DAIFClr, 3<<16 | 4<<12 | 7<<5}, +} + +var prfopfield = []struct { + reg int16 + enc uint32 +}{ + {REG_PLDL1KEEP, 0}, + {REG_PLDL1STRM, 1}, + {REG_PLDL2KEEP, 2}, + {REG_PLDL2STRM, 3}, + {REG_PLDL3KEEP, 4}, + {REG_PLDL3STRM, 5}, + {REG_PLIL1KEEP, 8}, + {REG_PLIL1STRM, 9}, + {REG_PLIL2KEEP, 10}, + {REG_PLIL2STRM, 11}, + {REG_PLIL3KEEP, 12}, + {REG_PLIL3STRM, 13}, + {REG_PSTL1KEEP, 16}, + {REG_PSTL1STRM, 17}, + {REG_PSTL2KEEP, 18}, + {REG_PSTL2STRM, 19}, + {REG_PSTL3KEEP, 20}, + {REG_PSTL3STRM, 21}, +} + +// Used for padinng NOOP instruction +const OP_NOOP = 0xd503201f + +// align code to a certain length by padding bytes. +func pcAlignPadLength(pc int64, alignedValue int64, ctxt *obj.Link) int { + if !((alignedValue&(alignedValue-1) == 0) && 8 <= alignedValue && alignedValue <= 2048) { + ctxt.Diag("alignment value of an instruction must be a power of two and in the range [8, 2048], got %d\n", alignedValue) + } + return int(-pc & (alignedValue - 1)) +} + +func span7(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { + if ctxt.Retpoline { + ctxt.Diag("-spectre=ret not supported on arm64") + ctxt.Retpoline = false // don't keep printing + } + + p := cursym.Func.Text + if p == nil || p.Link == nil { // handle external functions and ELF section symbols + return + } + + if oprange[AAND&obj.AMask] == nil { + ctxt.Diag("arm64 ops not initialized, call arm64.buildop first") + } + + c := ctxt7{ctxt: ctxt, newprog: newprog, cursym: cursym, autosize: int32(p.To.Offset & 0xffffffff), extrasize: int32(p.To.Offset >> 32)} + p.To.Offset &= 0xffffffff // extrasize is no longer needed + + bflag := 1 + pc := int64(0) + p.Pc = pc + var m int + var o *Optab + for p = p.Link; p != nil; p = p.Link { + if p.As == ADWORD && (pc&7) != 0 { + pc += 4 + } + p.Pc = pc + o = c.oplook(p) + m = int(o.size) + if m == 0 { + switch p.As { + case obj.APCALIGN: + alignedValue := p.From.Offset + m = pcAlignPadLength(pc, alignedValue, ctxt) + // Update the current text symbol alignment value. + if int32(alignedValue) > cursym.Func.Align { + cursym.Func.Align = int32(alignedValue) + } + break + case obj.ANOP, obj.AFUNCDATA, obj.APCDATA: + continue + default: + c.ctxt.Diag("zero-width instruction\n%v", p) + } + } + switch o.flag & (LFROM | LTO) { + case LFROM: + c.addpool(p, &p.From) + + case LTO: + c.addpool(p, &p.To) + break + } + + if p.As == AB || p.As == obj.ARET || p.As == AERET { /* TODO: other unconditional operations */ + c.checkpool(p, 0) + } + pc += int64(m) + if c.blitrl != nil { + c.checkpool(p, 1) + } + } + + c.cursym.Size = pc + + /* + * if any procedure is large enough to + * generate a large SBRA branch, then + * generate extra passes putting branches + * around jmps to fix. this is rare. + */ + for bflag != 0 { + bflag = 0 + pc = 0 + for p = c.cursym.Func.Text.Link; p != nil; p = p.Link { + if p.As == ADWORD && (pc&7) != 0 { + pc += 4 + } + p.Pc = pc + o = c.oplook(p) + + /* very large branches */ + if (o.type_ == 7 || o.type_ == 39 || o.type_ == 40) && p.To.Target() != nil { // 7: BEQ and like, 39: CBZ and like, 40: TBZ and like + otxt := p.To.Target().Pc - pc + var toofar bool + switch o.type_ { + case 7, 39: // branch instruction encodes 19 bits + toofar = otxt <= -(1<<20)+10 || otxt >= (1<<20)-10 + case 40: // branch instruction encodes 14 bits + toofar = otxt <= -(1<<15)+10 || otxt >= (1<<15)-10 + } + if toofar { + q := c.newprog() + q.Link = p.Link + p.Link = q + q.As = AB + q.To.Type = obj.TYPE_BRANCH + q.To.SetTarget(p.To.Target()) + p.To.SetTarget(q) + q = c.newprog() + q.Link = p.Link + p.Link = q + q.As = AB + q.To.Type = obj.TYPE_BRANCH + q.To.SetTarget(q.Link.Link) + bflag = 1 + } + } + m = int(o.size) + + if m == 0 { + switch p.As { + case obj.APCALIGN: + alignedValue := p.From.Offset + m = pcAlignPadLength(pc, alignedValue, ctxt) + break + case obj.ANOP, obj.AFUNCDATA, obj.APCDATA: + continue + default: + c.ctxt.Diag("zero-width instruction\n%v", p) + } + } + + pc += int64(m) + } + } + + pc += -pc & (funcAlign - 1) + c.cursym.Size = pc + + /* + * lay out the code, emitting code and data relocations. + */ + c.cursym.Grow(c.cursym.Size) + bp := c.cursym.P + psz := int32(0) + var i int + var out [6]uint32 + for p := c.cursym.Func.Text.Link; p != nil; p = p.Link { + c.pc = p.Pc + o = c.oplook(p) + + // need to align DWORDs on 8-byte boundary. The ISA doesn't + // require it, but the various 64-bit loads we generate assume it. + if o.as == ADWORD && psz%8 != 0 { + bp[3] = 0 + bp[2] = bp[3] + bp[1] = bp[2] + bp[0] = bp[1] + bp = bp[4:] + psz += 4 + } + + if int(o.size) > 4*len(out) { + log.Fatalf("out array in span7 is too small, need at least %d for %v", o.size/4, p) + } + if p.As == obj.APCALIGN { + alignedValue := p.From.Offset + v := pcAlignPadLength(p.Pc, alignedValue, c.ctxt) + for i = 0; i < int(v/4); i++ { + // emit ANOOP instruction by the padding size + c.ctxt.Arch.ByteOrder.PutUint32(bp, OP_NOOP) + bp = bp[4:] + psz += 4 + } + } else { + c.asmout(p, o, out[:]) + for i = 0; i < int(o.size/4); i++ { + c.ctxt.Arch.ByteOrder.PutUint32(bp, out[i]) + bp = bp[4:] + psz += 4 + } + } + } + + // Mark nonpreemptible instruction sequences. + // We use REGTMP as a scratch register during call injection, + // so instruction sequences that use REGTMP are unsafe to + // preempt asynchronously. + obj.MarkUnsafePoints(c.ctxt, c.cursym.Func.Text, c.newprog, c.isUnsafePoint, c.isRestartable) +} + +// isUnsafePoint returns whether p is an unsafe point. +func (c *ctxt7) isUnsafePoint(p *obj.Prog) bool { + // If p explicitly uses REGTMP, it's unsafe to preempt, because the + // preemption sequence clobbers REGTMP. + return p.From.Reg == REGTMP || p.To.Reg == REGTMP || p.Reg == REGTMP +} + +// isRestartable returns whether p is a multi-instruction sequence that, +// if preempted, can be restarted. +func (c *ctxt7) isRestartable(p *obj.Prog) bool { + if c.isUnsafePoint(p) { + return false + } + // If p is a multi-instruction sequence with uses REGTMP inserted by + // the assembler in order to materialize a large constant/offset, we + // can restart p (at the start of the instruction sequence), recompute + // the content of REGTMP, upon async preemption. Currently, all cases + // of assembler-inserted REGTMP fall into this category. + // If p doesn't use REGTMP, it can be simply preempted, so we don't + // mark it. + o := c.oplook(p) + return o.size > 4 && o.flag&NOTUSETMP == 0 +} + +/* + * when the first reference to the literal pool threatens + * to go out of range of a 1Mb PC-relative offset + * drop the pool now, and branch round it. + */ +func (c *ctxt7) checkpool(p *obj.Prog, skip int) { + if c.pool.size >= 0xffff0 || !ispcdisp(int32(p.Pc+4+int64(c.pool.size)-int64(c.pool.start)+8)) { + c.flushpool(p, skip) + } else if p.Link == nil { + c.flushpool(p, 2) + } +} + +func (c *ctxt7) flushpool(p *obj.Prog, skip int) { + if c.blitrl != nil { + if skip != 0 { + if c.ctxt.Debugvlog && skip == 1 { + fmt.Printf("note: flush literal pool at %#x: len=%d ref=%x\n", uint64(p.Pc+4), c.pool.size, c.pool.start) + } + q := c.newprog() + q.As = AB + q.To.Type = obj.TYPE_BRANCH + q.To.SetTarget(p.Link) + q.Link = c.blitrl + q.Pos = p.Pos + c.blitrl = q + } else if p.Pc+int64(c.pool.size)-int64(c.pool.start) < maxPCDisp { + return + } + + // The line number for constant pool entries doesn't really matter. + // We set it to the line number of the preceding instruction so that + // there are no deltas to encode in the pc-line tables. + for q := c.blitrl; q != nil; q = q.Link { + q.Pos = p.Pos + } + + c.elitrl.Link = p.Link + p.Link = c.blitrl + + c.blitrl = nil /* BUG: should refer back to values until out-of-range */ + c.elitrl = nil + c.pool.size = 0 + c.pool.start = 0 + } +} + +/* + * MOVD foo(SB), R is actually + * MOVD addr, REGTMP + * MOVD REGTMP, R + * where addr is the address of the DWORD containing the address of foo. + * + * TODO: hash + */ +func (c *ctxt7) addpool(p *obj.Prog, a *obj.Addr) { + cls := c.aclass(a) + lit := c.instoffset + t := c.newprog() + t.As = AWORD + sz := 4 + + if a.Type == obj.TYPE_CONST { + if lit != int64(int32(lit)) && uint64(lit) != uint64(uint32(lit)) { + // out of range -0x80000000 ~ 0xffffffff, must store 64-bit + t.As = ADWORD + sz = 8 + } // else store 32-bit + } else if p.As == AMOVD && a.Type != obj.TYPE_MEM || cls == C_ADDR || cls == C_VCON || lit != int64(int32(lit)) || uint64(lit) != uint64(uint32(lit)) { + // conservative: don't know if we want signed or unsigned extension. + // in case of ambiguity, store 64-bit + t.As = ADWORD + sz = 8 + } + + switch cls { + // TODO(aram): remove. + default: + if a.Name != obj.NAME_EXTERN { + fmt.Printf("addpool: %v in %v shouldn't go to default case\n", DRconv(cls), p) + } + + t.To.Offset = a.Offset + t.To.Sym = a.Sym + t.To.Type = a.Type + t.To.Name = a.Name + + /* This is here because MOV uint12<<12, R is disabled in optab. + Because of this, we need to load the constant from memory. */ + case C_ADDCON: + fallthrough + + case C_ZAUTO, + C_PSAUTO, + C_PSAUTO_8, + C_PSAUTO_4, + C_PPAUTO, + C_UAUTO4K_8, + C_UAUTO4K_4, + C_UAUTO4K_2, + C_UAUTO4K, + C_UAUTO8K_8, + C_UAUTO8K_4, + C_UAUTO8K, + C_UAUTO16K_8, + C_UAUTO16K, + C_UAUTO32K, + C_NSAUTO_8, + C_NSAUTO_4, + C_NSAUTO, + C_NPAUTO, + C_NAUTO4K, + C_LAUTO, + C_PPOREG, + C_PSOREG, + C_PSOREG_4, + C_PSOREG_8, + C_UOREG4K_8, + C_UOREG4K_4, + C_UOREG4K_2, + C_UOREG4K, + C_UOREG8K_8, + C_UOREG8K_4, + C_UOREG8K, + C_UOREG16K_8, + C_UOREG16K, + C_UOREG32K, + C_NSOREG_8, + C_NSOREG_4, + C_NSOREG, + C_NPOREG, + C_NOREG4K, + C_LOREG, + C_LACON, + C_ADDCON2, + C_LCON, + C_VCON: + if a.Name == obj.NAME_EXTERN { + fmt.Printf("addpool: %v in %v needs reloc\n", DRconv(cls), p) + } + + t.To.Type = obj.TYPE_CONST + t.To.Offset = lit + break + } + + for q := c.blitrl; q != nil; q = q.Link { /* could hash on t.t0.offset */ + if q.To == t.To { + p.Pool = q + return + } + } + + q := c.newprog() + *q = *t + q.Pc = int64(c.pool.size) + if c.blitrl == nil { + c.blitrl = q + c.pool.start = uint32(p.Pc) + } else { + c.elitrl.Link = q + } + c.elitrl = q + c.pool.size = -c.pool.size & (funcAlign - 1) + c.pool.size += uint32(sz) + p.Pool = q +} + +func (c *ctxt7) regoff(a *obj.Addr) uint32 { + c.instoffset = 0 + c.aclass(a) + return uint32(c.instoffset) +} + +func isSTLXRop(op obj.As) bool { + switch op { + case ASTLXR, ASTLXRW, ASTLXRB, ASTLXRH, + ASTXR, ASTXRW, ASTXRB, ASTXRH: + return true + } + return false +} + +func isSTXPop(op obj.As) bool { + switch op { + case ASTXP, ASTLXP, ASTXPW, ASTLXPW: + return true + } + return false +} + +func isANDop(op obj.As) bool { + switch op { + case AAND, AORR, AEOR, AANDS, ATST, + ABIC, AEON, AORN, ABICS: + return true + } + return false +} + +func isANDWop(op obj.As) bool { + switch op { + case AANDW, AORRW, AEORW, AANDSW, ATSTW, + ABICW, AEONW, AORNW, ABICSW: + return true + } + return false +} + +func isADDop(op obj.As) bool { + switch op { + case AADD, AADDS, ASUB, ASUBS, ACMN, ACMP: + return true + } + return false +} + +func isADDWop(op obj.As) bool { + switch op { + case AADDW, AADDSW, ASUBW, ASUBSW, ACMNW, ACMPW: + return true + } + return false +} + +func isRegShiftOrExt(a *obj.Addr) bool { + return (a.Index-obj.RBaseARM64)®_EXT != 0 || (a.Index-obj.RBaseARM64)®_LSL != 0 +} + +// Maximum PC-relative displacement. +// The actual limit is ±2²⁰, but we are conservative +// to avoid needing to recompute the literal pool flush points +// as span-dependent jumps are enlarged. +const maxPCDisp = 512 * 1024 + +// ispcdisp reports whether v is a valid PC-relative displacement. +func ispcdisp(v int32) bool { + return -maxPCDisp < v && v < maxPCDisp && v&3 == 0 +} + +func isaddcon(v int64) bool { + /* uimm12 or uimm24? */ + if v < 0 { + return false + } + if (v & 0xFFF) == 0 { + v >>= 12 + } + return v <= 0xFFF +} + +func isaddcon2(v int64) bool { + return 0 <= v && v <= 0xFFFFFF +} + +// isbitcon reports whether a constant can be encoded into a logical instruction. +// bitcon has a binary form of repetition of a bit sequence of length 2, 4, 8, 16, 32, or 64, +// which itself is a rotate (w.r.t. the length of the unit) of a sequence of ones. +// special cases: 0 and -1 are not bitcon. +// this function needs to run against virtually all the constants, so it needs to be fast. +// for this reason, bitcon testing and bitcon encoding are separate functions. +func isbitcon(x uint64) bool { + if x == 1<<64-1 || x == 0 { + return false + } + // determine the period and sign-extend a unit to 64 bits + switch { + case x != x>>32|x<<32: + // period is 64 + // nothing to do + case x != x>>16|x<<48: + // period is 32 + x = uint64(int64(int32(x))) + case x != x>>8|x<<56: + // period is 16 + x = uint64(int64(int16(x))) + case x != x>>4|x<<60: + // period is 8 + x = uint64(int64(int8(x))) + default: + // period is 4 or 2, always true + // 0001, 0010, 0100, 1000 -- 0001 rotate + // 0011, 0110, 1100, 1001 -- 0011 rotate + // 0111, 1011, 1101, 1110 -- 0111 rotate + // 0101, 1010 -- 01 rotate, repeat + return true + } + return sequenceOfOnes(x) || sequenceOfOnes(^x) +} + +// sequenceOfOnes tests whether a constant is a sequence of ones in binary, with leading and trailing zeros +func sequenceOfOnes(x uint64) bool { + y := x & -x // lowest set bit of x. x is good iff x+y is a power of 2 + y += x + return (y-1)&y == 0 +} + +// bitconEncode returns the encoding of a bitcon used in logical instructions +// x is known to be a bitcon +// a bitcon is a sequence of n ones at low bits (i.e. 1<>32|x<<32: + period = 64 + case x != x>>16|x<<48: + period = 32 + x = uint64(int64(int32(x))) + case x != x>>8|x<<56: + period = 16 + x = uint64(int64(int16(x))) + case x != x>>4|x<<60: + period = 8 + x = uint64(int64(int8(x))) + case x != x>>2|x<<62: + period = 4 + x = uint64(int64(x<<60) >> 60) + default: + period = 2 + x = uint64(int64(x<<62) >> 62) + } + neg := false + if int64(x) < 0 { + x = ^x + neg = true + } + y := x & -x // lowest set bit of x. + s := log2(y) + n := log2(x+y) - s // x (or ^x) is a sequence of n ones left shifted by s bits + if neg { + // ^x is a sequence of n ones left shifted by s bits + // adjust n, s for x + s = n + s + n = period - n + } + + N := uint32(0) + if mode == 64 && period == 64 { + N = 1 + } + R := (period - s) & (period - 1) & uint32(mode-1) // shift amount of right rotate + S := (n - 1) | 63&^(period<<1-1) // low bits = #ones - 1, high bits encodes period + return N<<22 | R<<16 | S<<10 +} + +func log2(x uint64) uint32 { + if x == 0 { + panic("log2 of 0") + } + n := uint32(0) + if x >= 1<<32 { + x >>= 32 + n += 32 + } + if x >= 1<<16 { + x >>= 16 + n += 16 + } + if x >= 1<<8 { + x >>= 8 + n += 8 + } + if x >= 1<<4 { + x >>= 4 + n += 4 + } + if x >= 1<<2 { + x >>= 2 + n += 2 + } + if x >= 1<<1 { + x >>= 1 + n += 1 + } + return n +} + +func autoclass(l int64) int { + if l == 0 { + return C_ZAUTO + } + + if l < 0 { + if l >= -256 && (l&7) == 0 { + return C_NSAUTO_8 + } + if l >= -256 && (l&3) == 0 { + return C_NSAUTO_4 + } + if l >= -256 { + return C_NSAUTO + } + if l >= -512 && (l&7) == 0 { + return C_NPAUTO + } + if l >= -4095 { + return C_NAUTO4K + } + return C_LAUTO + } + + if l <= 255 { + if (l & 7) == 0 { + return C_PSAUTO_8 + } + if (l & 3) == 0 { + return C_PSAUTO_4 + } + return C_PSAUTO + } + if l <= 504 && l&7 == 0 { + return C_PPAUTO + } + if l <= 4095 { + if l&7 == 0 { + return C_UAUTO4K_8 + } + if l&3 == 0 { + return C_UAUTO4K_4 + } + if l&1 == 0 { + return C_UAUTO4K_2 + } + return C_UAUTO4K + } + if l <= 8190 { + if l&7 == 0 { + return C_UAUTO8K_8 + } + if l&3 == 0 { + return C_UAUTO8K_4 + } + if l&1 == 0 { + return C_UAUTO8K + } + } + if l <= 16380 { + if l&7 == 0 { + return C_UAUTO16K_8 + } + if l&3 == 0 { + return C_UAUTO16K + } + } + if l <= 32760 && (l&7) == 0 { + return C_UAUTO32K + } + return C_LAUTO +} + +func oregclass(l int64) int { + return autoclass(l) - C_ZAUTO + C_ZOREG +} + +/* + * given an offset v and a class c (see above) + * return the offset value to use in the instruction, + * scaled if necessary + */ +func (c *ctxt7) offsetshift(p *obj.Prog, v int64, cls int) int64 { + s := 0 + if cls >= C_SEXT1 && cls <= C_SEXT16 { + s = cls - C_SEXT1 + } else { + switch cls { + case C_UAUTO4K, C_UOREG4K, C_ZOREG: + s = 0 + case C_UAUTO8K, C_UOREG8K: + s = 1 + case C_UAUTO16K, C_UOREG16K: + s = 2 + case C_UAUTO32K, C_UOREG32K: + s = 3 + default: + c.ctxt.Diag("bad class: %v\n%v", DRconv(cls), p) + } + } + vs := v >> uint(s) + if vs<= REG_ARNG && r < REG_ELEM: + return C_ARNG + case r >= REG_ELEM && r < REG_ELEM_END: + return C_ELEM + case r >= REG_UXTB && r < REG_SPECIAL: + return C_EXTREG + case r >= REG_SPECIAL: + return C_SPR + } + return C_GOK +} + +// con32class reclassifies the constant of 32-bit instruction. Because the constant type is 32-bit, +// but saved in Offset which type is int64, con32class treats it as uint32 type and reclassifies it. +func (c *ctxt7) con32class(a *obj.Addr) int { + v := uint32(a.Offset) + if v == 0 { + return C_ZCON + } + if isaddcon(int64(v)) { + if v <= 0xFFF { + if isbitcon(uint64(a.Offset)) { + return C_ABCON0 + } + return C_ADDCON0 + } + if isbitcon(uint64(a.Offset)) { + return C_ABCON + } + if movcon(int64(v)) >= 0 { + return C_AMCON + } + if movcon(int64(^v)) >= 0 { + return C_AMCON + } + return C_ADDCON + } + + t := movcon(int64(v)) + if t >= 0 { + if isbitcon(uint64(a.Offset)) { + return C_MBCON + } + return C_MOVCON + } + + t = movcon(int64(^v)) + if t >= 0 { + if isbitcon(uint64(a.Offset)) { + return C_MBCON + } + return C_MOVCON + } + + if isbitcon(uint64(a.Offset)) { + return C_BITCON + } + + if 0 <= v && v <= 0xffffff { + return C_ADDCON2 + } + return C_LCON +} + +// con64class reclassifies the constant of C_VCON and C_LCON class. +func (c *ctxt7) con64class(a *obj.Addr) int { + zeroCount := 0 + negCount := 0 + for i := uint(0); i < 4; i++ { + immh := uint32(a.Offset >> (i * 16) & 0xffff) + if immh == 0 { + zeroCount++ + } else if immh == 0xffff { + negCount++ + } + } + if zeroCount >= 3 || negCount >= 3 { + return C_MOVCON + } else if zeroCount == 2 || negCount == 2 { + return C_MOVCON2 + } else if zeroCount == 1 || negCount == 1 { + return C_MOVCON3 + } else { + return C_VCON + } +} + +func (c *ctxt7) aclass(a *obj.Addr) int { + switch a.Type { + case obj.TYPE_NONE: + return C_NONE + + case obj.TYPE_REG: + return rclass(a.Reg) + + case obj.TYPE_REGREG: + return C_PAIR + + case obj.TYPE_SHIFT: + return C_SHIFT + + case obj.TYPE_REGLIST: + return C_LIST + + case obj.TYPE_MEM: + // The base register should be an integer register. + if int16(REG_F0) <= a.Reg && a.Reg <= int16(REG_V31) { + break + } + switch a.Name { + case obj.NAME_EXTERN, obj.NAME_STATIC: + if a.Sym == nil { + break + } + c.instoffset = a.Offset + if a.Sym != nil { // use relocation + if a.Sym.Type == objabi.STLSBSS { + if c.ctxt.Flag_shared { + return C_TLS_IE + } else { + return C_TLS_LE + } + } + return C_ADDR + } + return C_LEXT + + case obj.NAME_GOTREF: + return C_GOTADDR + + case obj.NAME_AUTO: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-SP. + a.Reg = obj.REG_NONE + } + // The frame top 8 or 16 bytes are for FP + c.instoffset = int64(c.autosize) + a.Offset - int64(c.extrasize) + return autoclass(c.instoffset) + + case obj.NAME_PARAM: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-FP. + a.Reg = obj.REG_NONE + } + c.instoffset = int64(c.autosize) + a.Offset + 8 + return autoclass(c.instoffset) + + case obj.NAME_NONE: + if a.Index != 0 { + if a.Offset != 0 { + if isRegShiftOrExt(a) { + // extended or shifted register offset, (Rn)(Rm.UXTW<<2) or (Rn)(Rm<<2). + return C_ROFF + } + return C_GOK + } + // register offset, (Rn)(Rm) + return C_ROFF + } + c.instoffset = a.Offset + return oregclass(c.instoffset) + } + return C_GOK + + case obj.TYPE_FCONST: + return C_FCON + + case obj.TYPE_TEXTSIZE: + return C_TEXTSIZE + + case obj.TYPE_CONST, obj.TYPE_ADDR: + switch a.Name { + case obj.NAME_NONE: + c.instoffset = a.Offset + if a.Reg != 0 && a.Reg != REGZERO { + break + } + v := c.instoffset + if v == 0 { + return C_ZCON + } + if isaddcon(v) { + if v <= 0xFFF { + if isbitcon(uint64(v)) { + return C_ABCON0 + } + return C_ADDCON0 + } + if isbitcon(uint64(v)) { + return C_ABCON + } + if movcon(v) >= 0 { + return C_AMCON + } + if movcon(^v) >= 0 { + return C_AMCON + } + return C_ADDCON + } + + t := movcon(v) + if t >= 0 { + if isbitcon(uint64(v)) { + return C_MBCON + } + return C_MOVCON + } + + t = movcon(^v) + if t >= 0 { + if isbitcon(uint64(v)) { + return C_MBCON + } + return C_MOVCON + } + + if isbitcon(uint64(v)) { + return C_BITCON + } + + if 0 <= v && v <= 0xffffff { + return C_ADDCON2 + } + + if uint64(v) == uint64(uint32(v)) || v == int64(int32(v)) { + return C_LCON + } + return C_VCON + + case obj.NAME_EXTERN, obj.NAME_STATIC: + if a.Sym == nil { + return C_GOK + } + if a.Sym.Type == objabi.STLSBSS { + c.ctxt.Diag("taking address of TLS variable is not supported") + } + c.instoffset = a.Offset + return C_VCONADDR + + case obj.NAME_AUTO: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-SP. + a.Reg = obj.REG_NONE + } + // The frame top 8 or 16 bytes are for FP + c.instoffset = int64(c.autosize) + a.Offset - int64(c.extrasize) + + case obj.NAME_PARAM: + if a.Reg == REGSP { + // unset base register for better printing, since + // a.Offset is still relative to pseudo-FP. + a.Reg = obj.REG_NONE + } + c.instoffset = int64(c.autosize) + a.Offset + 8 + default: + return C_GOK + } + cf := c.instoffset + if isaddcon(cf) || isaddcon(-cf) { + return C_AACON + } + if isaddcon2(cf) { + return C_AACON2 + } + + return C_LACON + + case obj.TYPE_BRANCH: + return C_SBRA + } + + return C_GOK +} + +func oclass(a *obj.Addr) int { + return int(a.Class) - 1 +} + +func (c *ctxt7) oplook(p *obj.Prog) *Optab { + a1 := int(p.Optab) + if a1 != 0 { + return &optab[a1-1] + } + a1 = int(p.From.Class) + if a1 == 0 { + a0 := c.aclass(&p.From) + // do not break C_ADDCON2 when S bit is set + if (p.As == AADDS || p.As == AADDSW || p.As == ASUBS || p.As == ASUBSW) && a0 == C_ADDCON2 { + a0 = C_LCON + } + a1 = a0 + 1 + p.From.Class = int8(a1) + // more specific classification of 32-bit integers + if p.From.Type == obj.TYPE_CONST && p.From.Name == obj.NAME_NONE { + if p.As == AMOVW || isADDWop(p.As) { + ra0 := c.con32class(&p.From) + // do not break C_ADDCON2 when S bit is set + if (p.As == AADDSW || p.As == ASUBSW) && ra0 == C_ADDCON2 { + ra0 = C_LCON + } + a1 = ra0 + 1 + p.From.Class = int8(a1) + } + if isANDWop(p.As) && a0 != C_BITCON { + // For 32-bit logical instruction with constant, + // the BITCON test is special in that it looks at + // the 64-bit which has the high 32-bit as a copy + // of the low 32-bit. We have handled that and + // don't pass it to con32class. + a1 = c.con32class(&p.From) + 1 + p.From.Class = int8(a1) + } + if ((p.As == AMOVD) || isANDop(p.As) || isADDop(p.As)) && (a0 == C_LCON || a0 == C_VCON) { + a1 = c.con64class(&p.From) + 1 + p.From.Class = int8(a1) + } + } + } + + a1-- + a3 := C_NONE + 1 + if p.GetFrom3() != nil { + a3 = int(p.GetFrom3().Class) + if a3 == 0 { + a3 = c.aclass(p.GetFrom3()) + 1 + p.GetFrom3().Class = int8(a3) + } + } + + a3-- + a4 := int(p.To.Class) + if a4 == 0 { + a4 = c.aclass(&p.To) + 1 + p.To.Class = int8(a4) + } + + a4-- + a2 := C_NONE + if p.Reg != 0 { + a2 = rclass(p.Reg) + } + + if false { + fmt.Printf("oplook %v %d %d %d %d\n", p.As, a1, a2, a3, a4) + fmt.Printf("\t\t%d %d\n", p.From.Type, p.To.Type) + } + + ops := oprange[p.As&obj.AMask] + c1 := &xcmp[a1] + c2 := &xcmp[a2] + c3 := &xcmp[a3] + c4 := &xcmp[a4] + c5 := &xcmp[p.Scond>>5] + for i := range ops { + op := &ops[i] + if (int(op.a2) == a2 || c2[op.a2]) && c5[op.scond>>5] && c1[op.a1] && c3[op.a3] && c4[op.a4] { + p.Optab = uint16(cap(optab) - cap(ops) + i + 1) + return op + } + } + + c.ctxt.Diag("illegal combination: %v %v %v %v %v, %d %d", p, DRconv(a1), DRconv(a2), DRconv(a3), DRconv(a4), p.From.Type, p.To.Type) + // Turn illegal instruction into an UNDEF, avoid crashing in asmout + return &Optab{obj.AUNDEF, C_NONE, C_NONE, C_NONE, C_NONE, 90, 4, 0, 0, 0} +} + +func cmp(a int, b int) bool { + if a == b { + return true + } + switch a { + case C_RSP: + if b == C_REG { + return true + } + + case C_REG: + if b == C_ZCON { + return true + } + + case C_ADDCON0: + if b == C_ZCON || b == C_ABCON0 { + return true + } + + case C_ADDCON: + if b == C_ZCON || b == C_ABCON0 || b == C_ADDCON0 || b == C_ABCON || b == C_AMCON { + return true + } + + case C_BITCON: + if b == C_ABCON0 || b == C_ABCON || b == C_MBCON { + return true + } + + case C_MOVCON: + if b == C_MBCON || b == C_ZCON || b == C_ADDCON0 || b == C_AMCON { + return true + } + + case C_ADDCON2: + if b == C_ZCON || b == C_ADDCON || b == C_ADDCON0 { + return true + } + + case C_LCON: + if b == C_ZCON || b == C_BITCON || b == C_ADDCON || b == C_ADDCON0 || b == C_ABCON || b == C_ABCON0 || b == C_MBCON || b == C_MOVCON || b == C_ADDCON2 || b == C_AMCON { + return true + } + + case C_MOVCON2: + return cmp(C_LCON, b) + + case C_VCON: + return cmp(C_LCON, b) + + case C_LACON: + if b == C_AACON || b == C_AACON2 { + return true + } + + case C_SEXT2: + if b == C_SEXT1 { + return true + } + + case C_SEXT4: + if b == C_SEXT1 || b == C_SEXT2 { + return true + } + + case C_SEXT8: + if b >= C_SEXT1 && b <= C_SEXT4 { + return true + } + + case C_SEXT16: + if b >= C_SEXT1 && b <= C_SEXT8 { + return true + } + + case C_LEXT: + if b >= C_SEXT1 && b <= C_SEXT16 { + return true + } + + case C_NSAUTO_4: + if b == C_NSAUTO_8 { + return true + } + + case C_NSAUTO: + switch b { + case C_NSAUTO_4, C_NSAUTO_8: + return true + } + + case C_NPAUTO: + switch b { + case C_NSAUTO_8: + return true + } + + case C_NAUTO4K: + switch b { + case C_NSAUTO_8, C_NSAUTO_4, C_NSAUTO, C_NPAUTO: + return true + } + + case C_PSAUTO_8: + if b == C_ZAUTO { + return true + } + + case C_PSAUTO_4: + switch b { + case C_ZAUTO, C_PSAUTO_8: + return true + } + + case C_PSAUTO: + switch b { + case C_ZAUTO, C_PSAUTO_8, C_PSAUTO_4: + return true + } + + case C_PPAUTO: + switch b { + case C_ZAUTO, C_PSAUTO_8: + return true + } + + case C_UAUTO4K: + switch b { + case C_ZAUTO, C_PSAUTO, C_PSAUTO_4, C_PSAUTO_8, + C_PPAUTO, C_UAUTO4K_2, C_UAUTO4K_4, C_UAUTO4K_8: + return true + } + + case C_UAUTO8K: + switch b { + case C_ZAUTO, C_PSAUTO, C_PSAUTO_4, C_PSAUTO_8, C_PPAUTO, + C_UAUTO4K_2, C_UAUTO4K_4, C_UAUTO4K_8, C_UAUTO8K_4, C_UAUTO8K_8: + return true + } + + case C_UAUTO16K: + switch b { + case C_ZAUTO, C_PSAUTO, C_PSAUTO_4, C_PSAUTO_8, C_PPAUTO, + C_UAUTO4K_4, C_UAUTO4K_8, C_UAUTO8K_4, C_UAUTO8K_8, C_UAUTO16K_8: + return true + } + + case C_UAUTO32K: + switch b { + case C_ZAUTO, C_PSAUTO, C_PSAUTO_4, C_PSAUTO_8, + C_PPAUTO, C_UAUTO4K_8, C_UAUTO8K_8, C_UAUTO16K_8: + return true + } + + case C_LAUTO: + switch b { + case C_ZAUTO, C_NSAUTO, C_NSAUTO_4, C_NSAUTO_8, C_NPAUTO, + C_NAUTO4K, C_PSAUTO, C_PSAUTO_4, C_PSAUTO_8, C_PPAUTO, + C_UAUTO4K, C_UAUTO4K_2, C_UAUTO4K_4, C_UAUTO4K_8, + C_UAUTO8K, C_UAUTO8K_4, C_UAUTO8K_8, + C_UAUTO16K, C_UAUTO16K_8, + C_UAUTO32K: + return true + } + + case C_NSOREG_4: + if b == C_NSOREG_8 { + return true + } + + case C_NSOREG: + switch b { + case C_NSOREG_4, C_NSOREG_8: + return true + } + + case C_NPOREG: + switch b { + case C_NSOREG_8: + return true + } + + case C_NOREG4K: + switch b { + case C_NSOREG_8, C_NSOREG_4, C_NSOREG, C_NPOREG: + return true + } + + case C_PSOREG_4: + switch b { + case C_ZOREG, C_PSOREG_8: + return true + } + + case C_PSOREG: + switch b { + case C_ZOREG, C_PSOREG_8, C_PSOREG_4: + return true + } + + case C_PPOREG: + switch b { + case C_ZOREG, C_PSOREG_8: + return true + } + + case C_UOREG4K: + switch b { + case C_ZOREG, C_PSOREG_4, C_PSOREG_8, C_PSOREG, + C_PPOREG, C_UOREG4K_2, C_UOREG4K_4, C_UOREG4K_8: + return true + } + + case C_UOREG8K: + switch b { + case C_ZOREG, C_PSOREG_4, C_PSOREG_8, C_PSOREG, + C_PPOREG, C_UOREG4K_2, C_UOREG4K_4, C_UOREG4K_8, + C_UOREG8K_4, C_UOREG8K_8: + return true + } + + case C_UOREG16K: + switch b { + case C_ZOREG, C_PSOREG_4, C_PSOREG_8, C_PSOREG, + C_PPOREG, C_UOREG4K_4, C_UOREG4K_8, C_UOREG8K_4, + C_UOREG8K_8, C_UOREG16K_8: + return true + } + + case C_UOREG32K: + switch b { + case C_ZOREG, C_PSOREG_4, C_PSOREG_8, C_PSOREG, + C_PPOREG, C_UOREG4K_8, C_UOREG8K_8, C_UOREG16K_8: + return true + } + + case C_LOREG: + switch b { + case C_ZOREG, C_NSOREG, C_NSOREG_4, C_NSOREG_8, C_NPOREG, + C_NOREG4K, C_PSOREG_4, C_PSOREG_8, C_PSOREG, C_PPOREG, + C_UOREG4K, C_UOREG4K_2, C_UOREG4K_4, C_UOREG4K_8, + C_UOREG8K, C_UOREG8K_4, C_UOREG8K_8, + C_UOREG16K, C_UOREG16K_8, + C_UOREG32K: + return true + } + + case C_LBRA: + if b == C_SBRA { + return true + } + } + + return false +} + +type ocmp []Optab + +func (x ocmp) Len() int { + return len(x) +} + +func (x ocmp) Swap(i, j int) { + x[i], x[j] = x[j], x[i] +} + +func (x ocmp) Less(i, j int) bool { + p1 := &x[i] + p2 := &x[j] + if p1.as != p2.as { + return p1.as < p2.as + } + if p1.a1 != p2.a1 { + return p1.a1 < p2.a1 + } + if p1.a2 != p2.a2 { + return p1.a2 < p2.a2 + } + if p1.a3 != p2.a3 { + return p1.a3 < p2.a3 + } + if p1.a4 != p2.a4 { + return p1.a4 < p2.a4 + } + if p1.scond != p2.scond { + return p1.scond < p2.scond + } + return false +} + +func oprangeset(a obj.As, t []Optab) { + oprange[a&obj.AMask] = t +} + +func buildop(ctxt *obj.Link) { + if oprange[AAND&obj.AMask] != nil { + // Already initialized; stop now. + // This happens in the cmd/asm tests, + // each of which re-initializes the arch. + return + } + + var n int + for i := 0; i < C_GOK; i++ { + for n = 0; n < C_GOK; n++ { + if cmp(n, i) { + xcmp[i][n] = true + } + } + } + for n = 0; optab[n].as != obj.AXXX; n++ { + } + sort.Sort(ocmp(optab[:n])) + for i := 0; i < n; i++ { + r := optab[i].as + start := i + for optab[i].as == r { + i++ + } + t := optab[start:i] + i-- + oprangeset(r, t) + switch r { + default: + ctxt.Diag("unknown op in build: %v", r) + ctxt.DiagFlush() + log.Fatalf("bad code") + + case AADD: + oprangeset(AADDS, t) + oprangeset(ASUB, t) + oprangeset(ASUBS, t) + oprangeset(AADDW, t) + oprangeset(AADDSW, t) + oprangeset(ASUBW, t) + oprangeset(ASUBSW, t) + + case AAND: /* logical immediate, logical shifted register */ + oprangeset(AANDW, t) + oprangeset(AEOR, t) + oprangeset(AEORW, t) + oprangeset(AORR, t) + oprangeset(AORRW, t) + oprangeset(ABIC, t) + oprangeset(ABICW, t) + oprangeset(AEON, t) + oprangeset(AEONW, t) + oprangeset(AORN, t) + oprangeset(AORNW, t) + + case AANDS: /* logical immediate, logical shifted register, set flags, cannot target RSP */ + oprangeset(AANDSW, t) + oprangeset(ABICS, t) + oprangeset(ABICSW, t) + + case ANEG: + oprangeset(ANEGS, t) + oprangeset(ANEGSW, t) + oprangeset(ANEGW, t) + + case AADC: /* rn=Rd */ + oprangeset(AADCW, t) + + oprangeset(AADCS, t) + oprangeset(AADCSW, t) + oprangeset(ASBC, t) + oprangeset(ASBCW, t) + oprangeset(ASBCS, t) + oprangeset(ASBCSW, t) + + case ANGC: /* rn=REGZERO */ + oprangeset(ANGCW, t) + + oprangeset(ANGCS, t) + oprangeset(ANGCSW, t) + + case ACMP: + oprangeset(ACMPW, t) + oprangeset(ACMN, t) + oprangeset(ACMNW, t) + + case ATST: + oprangeset(ATSTW, t) + + /* register/register, and shifted */ + case AMVN: + oprangeset(AMVNW, t) + + case AMOVK: + oprangeset(AMOVKW, t) + oprangeset(AMOVN, t) + oprangeset(AMOVNW, t) + oprangeset(AMOVZ, t) + oprangeset(AMOVZW, t) + + case ASWPD: + for i := range atomicInstructions { + oprangeset(i, t) + } + + case ABEQ: + oprangeset(ABNE, t) + oprangeset(ABCS, t) + oprangeset(ABHS, t) + oprangeset(ABCC, t) + oprangeset(ABLO, t) + oprangeset(ABMI, t) + oprangeset(ABPL, t) + oprangeset(ABVS, t) + oprangeset(ABVC, t) + oprangeset(ABHI, t) + oprangeset(ABLS, t) + oprangeset(ABGE, t) + oprangeset(ABLT, t) + oprangeset(ABGT, t) + oprangeset(ABLE, t) + + case ALSL: + oprangeset(ALSLW, t) + oprangeset(ALSR, t) + oprangeset(ALSRW, t) + oprangeset(AASR, t) + oprangeset(AASRW, t) + oprangeset(AROR, t) + oprangeset(ARORW, t) + + case ACLS: + oprangeset(ACLSW, t) + oprangeset(ACLZ, t) + oprangeset(ACLZW, t) + oprangeset(ARBIT, t) + oprangeset(ARBITW, t) + oprangeset(AREV, t) + oprangeset(AREVW, t) + oprangeset(AREV16, t) + oprangeset(AREV16W, t) + oprangeset(AREV32, t) + + case ASDIV: + oprangeset(ASDIVW, t) + oprangeset(AUDIV, t) + oprangeset(AUDIVW, t) + oprangeset(ACRC32B, t) + oprangeset(ACRC32CB, t) + oprangeset(ACRC32CH, t) + oprangeset(ACRC32CW, t) + oprangeset(ACRC32CX, t) + oprangeset(ACRC32H, t) + oprangeset(ACRC32W, t) + oprangeset(ACRC32X, t) + + case AMADD: + oprangeset(AMADDW, t) + oprangeset(AMSUB, t) + oprangeset(AMSUBW, t) + oprangeset(ASMADDL, t) + oprangeset(ASMSUBL, t) + oprangeset(AUMADDL, t) + oprangeset(AUMSUBL, t) + + case AREM: + oprangeset(AREMW, t) + oprangeset(AUREM, t) + oprangeset(AUREMW, t) + + case AMUL: + oprangeset(AMULW, t) + oprangeset(AMNEG, t) + oprangeset(AMNEGW, t) + oprangeset(ASMNEGL, t) + oprangeset(ASMULL, t) + oprangeset(ASMULH, t) + oprangeset(AUMNEGL, t) + oprangeset(AUMULH, t) + oprangeset(AUMULL, t) + + case AMOVB: + oprangeset(AMOVBU, t) + + case AMOVH: + oprangeset(AMOVHU, t) + + case AMOVW: + oprangeset(AMOVWU, t) + + case ABFM: + oprangeset(ABFMW, t) + oprangeset(ASBFM, t) + oprangeset(ASBFMW, t) + oprangeset(AUBFM, t) + oprangeset(AUBFMW, t) + + case ABFI: + oprangeset(ABFIW, t) + oprangeset(ABFXIL, t) + oprangeset(ABFXILW, t) + oprangeset(ASBFIZ, t) + oprangeset(ASBFIZW, t) + oprangeset(ASBFX, t) + oprangeset(ASBFXW, t) + oprangeset(AUBFIZ, t) + oprangeset(AUBFIZW, t) + oprangeset(AUBFX, t) + oprangeset(AUBFXW, t) + + case AEXTR: + oprangeset(AEXTRW, t) + + case ASXTB: + oprangeset(ASXTBW, t) + oprangeset(ASXTH, t) + oprangeset(ASXTHW, t) + oprangeset(ASXTW, t) + oprangeset(AUXTB, t) + oprangeset(AUXTH, t) + oprangeset(AUXTW, t) + oprangeset(AUXTBW, t) + oprangeset(AUXTHW, t) + + case ACCMN: + oprangeset(ACCMNW, t) + oprangeset(ACCMP, t) + oprangeset(ACCMPW, t) + + case ACSEL: + oprangeset(ACSELW, t) + oprangeset(ACSINC, t) + oprangeset(ACSINCW, t) + oprangeset(ACSINV, t) + oprangeset(ACSINVW, t) + oprangeset(ACSNEG, t) + oprangeset(ACSNEGW, t) + + case ACINC: + // aliases Rm=Rn, !cond + oprangeset(ACINCW, t) + oprangeset(ACINV, t) + oprangeset(ACINVW, t) + oprangeset(ACNEG, t) + oprangeset(ACNEGW, t) + + // aliases, Rm=Rn=REGZERO, !cond + case ACSET: + oprangeset(ACSETW, t) + + oprangeset(ACSETM, t) + oprangeset(ACSETMW, t) + + case AMOVD, + AMOVBU, + AB, + ABL, + AWORD, + ADWORD, + obj.ARET, + obj.ATEXT: + break + + case ALDP: + oprangeset(AFLDPD, t) + + case ASTP: + oprangeset(AFSTPD, t) + + case ASTPW: + oprangeset(AFSTPS, t) + + case ALDPW: + oprangeset(ALDPSW, t) + oprangeset(AFLDPS, t) + + case AERET: + oprangeset(AWFE, t) + oprangeset(AWFI, t) + oprangeset(AYIELD, t) + oprangeset(ASEV, t) + oprangeset(ASEVL, t) + oprangeset(ANOOP, t) + oprangeset(ADRPS, t) + + case ACBZ: + oprangeset(ACBZW, t) + oprangeset(ACBNZ, t) + oprangeset(ACBNZW, t) + + case ATBZ: + oprangeset(ATBNZ, t) + + case AADR, AADRP: + break + + case ACLREX: + break + + case ASVC: + oprangeset(AHVC, t) + oprangeset(AHLT, t) + oprangeset(ASMC, t) + oprangeset(ABRK, t) + oprangeset(ADCPS1, t) + oprangeset(ADCPS2, t) + oprangeset(ADCPS3, t) + + case AFADDS: + oprangeset(AFADDD, t) + oprangeset(AFSUBS, t) + oprangeset(AFSUBD, t) + oprangeset(AFMULS, t) + oprangeset(AFMULD, t) + oprangeset(AFNMULS, t) + oprangeset(AFNMULD, t) + oprangeset(AFDIVS, t) + oprangeset(AFMAXD, t) + oprangeset(AFMAXS, t) + oprangeset(AFMIND, t) + oprangeset(AFMINS, t) + oprangeset(AFMAXNMD, t) + oprangeset(AFMAXNMS, t) + oprangeset(AFMINNMD, t) + oprangeset(AFMINNMS, t) + oprangeset(AFDIVD, t) + + case AFMSUBD: + oprangeset(AFMSUBS, t) + oprangeset(AFMADDS, t) + oprangeset(AFMADDD, t) + oprangeset(AFNMSUBS, t) + oprangeset(AFNMSUBD, t) + oprangeset(AFNMADDS, t) + oprangeset(AFNMADDD, t) + + case AFCVTSD: + oprangeset(AFCVTDS, t) + oprangeset(AFABSD, t) + oprangeset(AFABSS, t) + oprangeset(AFNEGD, t) + oprangeset(AFNEGS, t) + oprangeset(AFSQRTD, t) + oprangeset(AFSQRTS, t) + oprangeset(AFRINTNS, t) + oprangeset(AFRINTND, t) + oprangeset(AFRINTPS, t) + oprangeset(AFRINTPD, t) + oprangeset(AFRINTMS, t) + oprangeset(AFRINTMD, t) + oprangeset(AFRINTZS, t) + oprangeset(AFRINTZD, t) + oprangeset(AFRINTAS, t) + oprangeset(AFRINTAD, t) + oprangeset(AFRINTXS, t) + oprangeset(AFRINTXD, t) + oprangeset(AFRINTIS, t) + oprangeset(AFRINTID, t) + oprangeset(AFCVTDH, t) + oprangeset(AFCVTHS, t) + oprangeset(AFCVTHD, t) + oprangeset(AFCVTSH, t) + + case AFCMPS: + oprangeset(AFCMPD, t) + oprangeset(AFCMPES, t) + oprangeset(AFCMPED, t) + + case AFCCMPS: + oprangeset(AFCCMPD, t) + oprangeset(AFCCMPES, t) + oprangeset(AFCCMPED, t) + + case AFCSELD: + oprangeset(AFCSELS, t) + + case AFMOVS, AFMOVD, AFMOVQ: + break + + case AFCVTZSD: + oprangeset(AFCVTZSDW, t) + oprangeset(AFCVTZSS, t) + oprangeset(AFCVTZSSW, t) + oprangeset(AFCVTZUD, t) + oprangeset(AFCVTZUDW, t) + oprangeset(AFCVTZUS, t) + oprangeset(AFCVTZUSW, t) + + case ASCVTFD: + oprangeset(ASCVTFS, t) + oprangeset(ASCVTFWD, t) + oprangeset(ASCVTFWS, t) + oprangeset(AUCVTFD, t) + oprangeset(AUCVTFS, t) + oprangeset(AUCVTFWD, t) + oprangeset(AUCVTFWS, t) + + case ASYS: + oprangeset(AAT, t) + oprangeset(ADC, t) + oprangeset(AIC, t) + oprangeset(ATLBI, t) + + case ASYSL, AHINT: + break + + case ADMB: + oprangeset(ADSB, t) + oprangeset(AISB, t) + + case AMRS, AMSR: + break + + case ALDAR: + oprangeset(ALDARW, t) + oprangeset(ALDARB, t) + oprangeset(ALDARH, t) + fallthrough + + case ALDXR: + oprangeset(ALDXRB, t) + oprangeset(ALDXRH, t) + oprangeset(ALDXRW, t) + + case ALDAXR: + oprangeset(ALDAXRB, t) + oprangeset(ALDAXRH, t) + oprangeset(ALDAXRW, t) + + case ALDXP: + oprangeset(ALDXPW, t) + oprangeset(ALDAXP, t) + oprangeset(ALDAXPW, t) + + case ASTLR: + oprangeset(ASTLRB, t) + oprangeset(ASTLRH, t) + oprangeset(ASTLRW, t) + + case ASTXR: + oprangeset(ASTXRB, t) + oprangeset(ASTXRH, t) + oprangeset(ASTXRW, t) + + case ASTLXR: + oprangeset(ASTLXRB, t) + oprangeset(ASTLXRH, t) + oprangeset(ASTLXRW, t) + + case ASTXP: + oprangeset(ASTLXP, t) + oprangeset(ASTLXPW, t) + oprangeset(ASTXPW, t) + + case AVADDP: + oprangeset(AVAND, t) + oprangeset(AVCMEQ, t) + oprangeset(AVORR, t) + oprangeset(AVEOR, t) + oprangeset(AVBSL, t) + oprangeset(AVBIT, t) + oprangeset(AVCMTST, t) + oprangeset(AVUZP1, t) + oprangeset(AVUZP2, t) + oprangeset(AVBIF, t) + + case AVADD: + oprangeset(AVSUB, t) + + case AAESD: + oprangeset(AAESE, t) + oprangeset(AAESMC, t) + oprangeset(AAESIMC, t) + oprangeset(ASHA1SU1, t) + oprangeset(ASHA256SU0, t) + oprangeset(ASHA512SU0, t) + + case ASHA1C: + oprangeset(ASHA1P, t) + oprangeset(ASHA1M, t) + + case ASHA256H: + oprangeset(ASHA256H2, t) + oprangeset(ASHA512H, t) + oprangeset(ASHA512H2, t) + + case ASHA1SU0: + oprangeset(ASHA256SU1, t) + oprangeset(ASHA512SU1, t) + + case AVADDV: + oprangeset(AVUADDLV, t) + + case AVFMLA: + oprangeset(AVFMLS, t) + + case AVPMULL: + oprangeset(AVPMULL2, t) + + case AVUSHR: + oprangeset(AVSHL, t) + oprangeset(AVSRI, t) + + case AVREV32: + oprangeset(AVCNT, t) + oprangeset(AVRBIT, t) + oprangeset(AVREV64, t) + oprangeset(AVREV16, t) + + case AVZIP1: + oprangeset(AVZIP2, t) + + case AVUXTL: + oprangeset(AVUXTL2, t) + + case AVUSHLL: + oprangeset(AVUSHLL2, t) + + case AVLD1R: + oprangeset(AVLD2, t) + oprangeset(AVLD2R, t) + oprangeset(AVLD3, t) + oprangeset(AVLD3R, t) + oprangeset(AVLD4, t) + oprangeset(AVLD4R, t) + + case ASHA1H, + AVCNT, + AVMOV, + AVLD1, + AVST1, + AVST2, + AVST3, + AVST4, + AVTBL, + AVDUP, + AVMOVI, + APRFM, + AVEXT: + break + + case obj.ANOP, + obj.AUNDEF, + obj.AFUNCDATA, + obj.APCALIGN, + obj.APCDATA, + obj.ADUFFZERO, + obj.ADUFFCOPY: + break + } + } +} + +// chipfloat7() checks if the immediate constants available in FMOVS/FMOVD instructions. +// For details of the range of constants available, see +// http://infocenter.arm.com/help/topic/com.arm.doc.dui0473m/dom1359731199385.html. +func (c *ctxt7) chipfloat7(e float64) int { + ei := math.Float64bits(e) + l := uint32(int32(ei)) + h := uint32(int32(ei >> 32)) + + if l != 0 || h&0xffff != 0 { + return -1 + } + h1 := h & 0x7fc00000 + if h1 != 0x40000000 && h1 != 0x3fc00000 { + return -1 + } + n := 0 + + // sign bit (a) + if h&0x80000000 != 0 { + n |= 1 << 7 + } + + // exp sign bit (b) + if h1 == 0x3fc00000 { + n |= 1 << 6 + } + + // rest of exp and mantissa (cd-efgh) + n |= int((h >> 16) & 0x3f) + + //print("match %.8lux %.8lux %d\n", l, h, n); + return n +} + +/* form offset parameter to SYS; special register number */ +func SYSARG5(op0 int, op1 int, Cn int, Cm int, op2 int) int { + return op0<<19 | op1<<16 | Cn<<12 | Cm<<8 | op2<<5 +} + +func SYSARG4(op1 int, Cn int, Cm int, op2 int) int { + return SYSARG5(0, op1, Cn, Cm, op2) +} + +// checkUnpredictable checks if the sourse and transfer registers are the same register. +// ARM64 manual says it is "constrained unpredictable" if the src and dst registers of STP/LDP are same. +func (c *ctxt7) checkUnpredictable(p *obj.Prog, isload bool, wback bool, rn int16, rt1 int16, rt2 int16) { + if wback && rn != REGSP && (rn == rt1 || rn == rt2) { + c.ctxt.Diag("constrained unpredictable behavior: %v", p) + } + if isload && rt1 == rt2 { + c.ctxt.Diag("constrained unpredictable behavior: %v", p) + } +} + +/* checkindex checks if index >= 0 && index <= maxindex */ +func (c *ctxt7) checkindex(p *obj.Prog, index, maxindex int) { + if index < 0 || index > maxindex { + c.ctxt.Diag("register element index out of range 0 to %d: %v", maxindex, p) + } +} + +/* checkoffset checks whether the immediate offset is valid for VLD[1-4].P and VST[1-4].P */ +func (c *ctxt7) checkoffset(p *obj.Prog, as obj.As) { + var offset, list, n, expect int64 + switch as { + case AVLD1, AVLD2, AVLD3, AVLD4, AVLD1R, AVLD2R, AVLD3R, AVLD4R: + offset = p.From.Offset + list = p.To.Offset + case AVST1, AVST2, AVST3, AVST4: + offset = p.To.Offset + list = p.From.Offset + default: + c.ctxt.Diag("invalid operation on op %v", p.As) + } + opcode := (list >> 12) & 15 + q := (list >> 30) & 1 + size := (list >> 10) & 3 + if offset == 0 { + return + } + switch opcode { + case 0x7: + n = 1 // one register + case 0xa: + n = 2 // two registers + case 0x6: + n = 3 // three registers + case 0x2: + n = 4 // four registers + default: + c.ctxt.Diag("invalid register numbers in ARM64 register list: %v", p) + } + + switch as { + case AVLD1R, AVLD2R, AVLD3R, AVLD4R: + if offset != n*(1<> 5) & 7 + switch p.As { + case AMOVB, AMOVBU: + if amount != 0 { + c.ctxt.Diag("invalid index shift amount: %v", p) + } + case AMOVH, AMOVHU: + if amount != 1 && amount != 0 { + c.ctxt.Diag("invalid index shift amount: %v", p) + } + case AMOVW, AMOVWU, AFMOVS: + if amount != 2 && amount != 0 { + c.ctxt.Diag("invalid index shift amount: %v", p) + } + case AMOVD, AFMOVD: + if amount != 3 && amount != 0 { + c.ctxt.Diag("invalid index shift amount: %v", p) + } + default: + panic("invalid operation") + } +} + +func (c *ctxt7) asmout(p *obj.Prog, o *Optab, out []uint32) { + var os [5]uint32 + o1 := uint32(0) + o2 := uint32(0) + o3 := uint32(0) + o4 := uint32(0) + o5 := uint32(0) + if false { /*debug['P']*/ + fmt.Printf("%x: %v\ttype %d\n", uint32(p.Pc), p, o.type_) + } + switch o.type_ { + default: + c.ctxt.Diag("%v: unknown asm %d", p, o.type_) + + case 0: /* pseudo ops */ + break + + case 1: /* op Rm,[Rn],Rd; default Rn=Rd -> op Rm<<0,[Rn,]Rd (shifted register) */ + o1 = c.oprrr(p, p.As) + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + if r == 0 { + r = rt + } + o1 |= (uint32(rf&31) << 16) | (uint32(r&31) << 5) | uint32(rt&31) + + case 2: /* add/sub $(uimm12|uimm24)[,R],R; cmp $(uimm12|uimm24),R */ + o1 = c.opirr(p, p.As) + + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + if (o1 & Sbit) == 0 { + c.ctxt.Diag("ineffective ZR destination\n%v", p) + } + rt = REGZERO + } + + r := int(p.Reg) + if r == 0 { + r = rt + } + v := int32(c.regoff(&p.From)) + o1 = c.oaddi(p, int32(o1), v, r, rt) + + case 3: /* op R<> 10) & 63 + is64bit := o1 & (1 << 31) + if is64bit == 0 && amount >= 32 { + c.ctxt.Diag("shift amount out of range 0 to 31: %v", p) + } + o1 |= uint32(p.From.Offset) /* includes reg, op, etc */ + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + r := int(p.Reg) + if p.As == AMVN || p.As == AMVNW { + r = REGZERO + } else if r == 0 { + r = rt + } + o1 |= (uint32(r&31) << 5) | uint32(rt&31) + + case 4: /* mov $addcon, R; mov $recon, R; mov $racon, R; mov $addcon2, R */ + rt := int(p.To.Reg) + r := int(o.param) + + if r == 0 { + r = REGZERO + } else if r == REGFROM { + r = int(p.From.Reg) + } + if r == 0 { + r = REGSP + } + + v := int32(c.regoff(&p.From)) + var op int32 + if v < 0 { + v = -v + op = int32(c.opirr(p, ASUB)) + } else { + op = int32(c.opirr(p, AADD)) + } + + if int(o.size) == 8 { + o1 = c.oaddi(p, op, v&0xfff000, r, REGTMP) + o2 = c.oaddi(p, op, v&0x000fff, REGTMP, rt) + break + } + + o1 = c.oaddi(p, op, v, r, rt) + + case 5: /* b s; bl s */ + o1 = c.opbra(p, p.As) + + if p.To.Sym == nil { + o1 |= uint32(c.brdist(p, 0, 26, 2)) + break + } + + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 4 + rel.Sym = p.To.Sym + rel.Add = p.To.Offset + rel.Type = objabi.R_CALLARM64 + + case 6: /* b ,O(R); bl ,O(R) */ + o1 = c.opbrr(p, p.As) + + o1 |= uint32(p.To.Reg&31) << 5 + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 0 + rel.Type = objabi.R_CALLIND + + case 7: /* beq s */ + o1 = c.opbra(p, p.As) + + o1 |= uint32(c.brdist(p, 0, 19, 2) << 5) + + case 8: /* lsl $c,[R],R -> ubfm $(W-1)-c,$(-c MOD (W-1)),Rn,Rd */ + rt := int(p.To.Reg) + + rf := int(p.Reg) + if rf == 0 { + rf = rt + } + v := int32(p.From.Offset) + switch p.As { + case AASR: + o1 = c.opbfm(p, ASBFM, int(v), 63, rf, rt) + + case AASRW: + o1 = c.opbfm(p, ASBFMW, int(v), 31, rf, rt) + + case ALSL: + o1 = c.opbfm(p, AUBFM, int((64-v)&63), int(63-v), rf, rt) + + case ALSLW: + o1 = c.opbfm(p, AUBFMW, int((32-v)&31), int(31-v), rf, rt) + + case ALSR: + o1 = c.opbfm(p, AUBFM, int(v), 63, rf, rt) + + case ALSRW: + o1 = c.opbfm(p, AUBFMW, int(v), 31, rf, rt) + + case AROR: + o1 = c.opextr(p, AEXTR, v, rf, rf, rt) + + case ARORW: + o1 = c.opextr(p, AEXTRW, v, rf, rf, rt) + + default: + c.ctxt.Diag("bad shift $con\n%v", p) + break + } + + case 9: /* lsl Rm,[Rn],Rd -> lslv Rm, Rn, Rd */ + o1 = c.oprrr(p, p.As) + + r := int(p.Reg) + if r == 0 { + r = int(p.To.Reg) + } + o1 |= (uint32(p.From.Reg&31) << 16) | (uint32(r&31) << 5) | uint32(p.To.Reg&31) + + case 10: /* brk/hvc/.../svc [$con] */ + o1 = c.opimm(p, p.As) + + if p.From.Type != obj.TYPE_NONE { + o1 |= uint32((p.From.Offset & 0xffff) << 5) + } + + case 11: /* dword */ + c.aclass(&p.To) + + o1 = uint32(c.instoffset) + o2 = uint32(c.instoffset >> 32) + if p.To.Sym != nil { + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.To.Sym + rel.Add = p.To.Offset + rel.Type = objabi.R_ADDR + o2 = 0 + o1 = o2 + } + + case 12: /* movT $vcon, reg */ + // NOTE: this case does not use REGTMP. If it ever does, + // remove the NOTUSETMP flag in optab. + num := c.omovlconst(p.As, p, &p.From, int(p.To.Reg), os[:]) + if num == 0 { + c.ctxt.Diag("invalid constant: %v", p) + } + o1 = os[0] + o2 = os[1] + o3 = os[2] + o4 = os[3] + + case 13: /* addop $vcon, [R], R (64 bit literal); cmp $lcon,R -> addop $lcon,R, ZR */ + o := uint32(0) + num := uint8(0) + cls := oclass(&p.From) + if isADDWop(p.As) { + if !cmp(C_LCON, cls) { + c.ctxt.Diag("illegal combination: %v", p) + } + num = c.omovlconst(AMOVW, p, &p.From, REGTMP, os[:]) + } else { + num = c.omovlconst(AMOVD, p, &p.From, REGTMP, os[:]) + } + if num == 0 { + c.ctxt.Diag("invalid constant: %v", p) + } + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + r := int(p.Reg) + if r == 0 { + r = rt + } + if p.To.Type != obj.TYPE_NONE && (p.To.Reg == REGSP || r == REGSP) { + o = c.opxrrr(p, p.As, false) + o |= REGTMP & 31 << 16 + o |= LSL0_64 + } else { + o = c.oprrr(p, p.As) + o |= REGTMP & 31 << 16 /* shift is 0 */ + } + + o |= uint32(r&31) << 5 + o |= uint32(rt & 31) + + os[num] = o + o1 = os[0] + o2 = os[1] + o3 = os[2] + o4 = os[3] + o5 = os[4] + + case 14: /* word */ + if c.aclass(&p.To) == C_ADDR { + c.ctxt.Diag("address constant needs DWORD\n%v", p) + } + o1 = uint32(c.instoffset) + if p.To.Sym != nil { + // This case happens with words generated + // in the PC stream as part of the literal pool. + rel := obj.Addrel(c.cursym) + + rel.Off = int32(c.pc) + rel.Siz = 4 + rel.Sym = p.To.Sym + rel.Add = p.To.Offset + rel.Type = objabi.R_ADDR + o1 = 0 + } + + case 15: /* mul/mneg/umulh/umull r,[r,]r; madd/msub/fmadd/fmsub/fnmadd/fnmsub Rm,Ra,Rn,Rd */ + o1 = c.oprrr(p, p.As) + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + var r int + var ra int + if p.From3Type() == obj.TYPE_REG { + r = int(p.GetFrom3().Reg) + ra = int(p.Reg) + if ra == 0 { + ra = REGZERO + } + } else { + r = int(p.Reg) + if r == 0 { + r = rt + } + ra = REGZERO + } + + o1 |= (uint32(rf&31) << 16) | (uint32(ra&31) << 10) | (uint32(r&31) << 5) | uint32(rt&31) + + case 16: /* XremY R[,R],R -> XdivY; XmsubY */ + o1 = c.oprrr(p, p.As) + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if r == 0 { + r = rt + } + o1 |= (uint32(rf&31) << 16) | (uint32(r&31) << 5) | REGTMP&31 + o2 = c.oprrr(p, AMSUBW) + o2 |= o1 & (1 << 31) /* same size */ + o2 |= (uint32(rf&31) << 16) | (uint32(r&31) << 10) | (REGTMP & 31 << 5) | uint32(rt&31) + + case 17: /* op Rm,[Rn],Rd; default Rn=ZR */ + o1 = c.oprrr(p, p.As) + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + if r == 0 { + r = REGZERO + } + o1 |= (uint32(rf&31) << 16) | (uint32(r&31) << 5) | uint32(rt&31) + + case 18: /* csel cond,Rn,Rm,Rd; cinc/cinv/cneg cond,Rn,Rd; cset cond,Rd */ + o1 = c.oprrr(p, p.As) + + cond := int(p.From.Reg) + if cond < COND_EQ || cond > COND_NV { + c.ctxt.Diag("invalid condition: %v", p) + } else { + cond -= COND_EQ + } + + r := int(p.Reg) + var rf int + if r != 0 { + if p.From3Type() == obj.TYPE_NONE { + /* CINC/CINV/CNEG */ + rf = r + cond ^= 1 + } else { + rf = int(p.GetFrom3().Reg) /* CSEL */ + } + } else { + /* CSET */ + rf = REGZERO + r = rf + cond ^= 1 + } + + rt := int(p.To.Reg) + o1 |= (uint32(rf&31) << 16) | (uint32(cond&15) << 12) | (uint32(r&31) << 5) | uint32(rt&31) + + case 19: /* CCMN cond, (Rm|uimm5),Rn, uimm4 -> ccmn Rn,Rm,uimm4,cond */ + nzcv := int(p.To.Offset) + + cond := int(p.From.Reg) + if cond < COND_EQ || cond > COND_NV { + c.ctxt.Diag("invalid condition\n%v", p) + } else { + cond -= COND_EQ + } + var rf int + if p.GetFrom3().Type == obj.TYPE_REG { + o1 = c.oprrr(p, p.As) + rf = int(p.GetFrom3().Reg) /* Rm */ + } else { + o1 = c.opirr(p, p.As) + rf = int(p.GetFrom3().Offset & 0x1F) + } + + o1 |= (uint32(rf&31) << 16) | (uint32(cond&15) << 12) | (uint32(p.Reg&31) << 5) | uint32(nzcv) + + case 20: /* movT R,O(R) -> strT */ + v := int32(c.regoff(&p.To)) + sz := int32(1 << uint(movesize(p.As))) + + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + if v < 0 || v%sz != 0 { /* unscaled 9-bit signed */ + o1 = c.olsr9s(p, int32(c.opstr9(p, p.As)), v, r, int(p.From.Reg)) + } else { + v = int32(c.offsetshift(p, int64(v), int(o.a4))) + o1 = c.olsr12u(p, int32(c.opstr12(p, p.As)), v, r, int(p.From.Reg)) + } + + case 21: /* movT O(R),R -> ldrT */ + v := int32(c.regoff(&p.From)) + sz := int32(1 << uint(movesize(p.As))) + + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + if v < 0 || v%sz != 0 { /* unscaled 9-bit signed */ + o1 = c.olsr9s(p, int32(c.opldr9(p, p.As)), v, r, int(p.To.Reg)) + } else { + v = int32(c.offsetshift(p, int64(v), int(o.a1))) + //print("offset=%lld v=%ld a1=%d\n", instoffset, v, o->a1); + o1 = c.olsr12u(p, int32(c.opldr12(p, p.As)), v, r, int(p.To.Reg)) + } + + case 22: /* movT (R)O!,R; movT O(R)!, R -> ldrT */ + if p.From.Reg != REGSP && p.From.Reg == p.To.Reg { + c.ctxt.Diag("constrained unpredictable behavior: %v", p) + } + + v := int32(p.From.Offset) + + if v < -256 || v > 255 { + c.ctxt.Diag("offset out of range [-255,254]: %v", p) + } + o1 = c.opldrpp(p, p.As) + if o.scond == C_XPOST { + o1 |= 1 << 10 + } else { + o1 |= 3 << 10 + } + o1 |= ((uint32(v) & 0x1FF) << 12) | (uint32(p.From.Reg&31) << 5) | uint32(p.To.Reg&31) + + case 23: /* movT R,(R)O!; movT O(R)!, R -> strT */ + if p.To.Reg != REGSP && p.From.Reg == p.To.Reg { + c.ctxt.Diag("constrained unpredictable behavior: %v", p) + } + + v := int32(p.To.Offset) + + if v < -256 || v > 255 { + c.ctxt.Diag("offset out of range [-255,254]: %v", p) + } + o1 = LD2STR(c.opldrpp(p, p.As)) + if o.scond == C_XPOST { + o1 |= 1 << 10 + } else { + o1 |= 3 << 10 + } + o1 |= ((uint32(v) & 0x1FF) << 12) | (uint32(p.To.Reg&31) << 5) | uint32(p.From.Reg&31) + + case 24: /* mov/mvn Rs,Rd -> add $0,Rs,Rd or orr Rs,ZR,Rd */ + rf := int(p.From.Reg) + rt := int(p.To.Reg) + s := rf == REGSP || rt == REGSP + if p.As == AMVN || p.As == AMVNW { + if s { + c.ctxt.Diag("illegal SP reference\n%v", p) + } + o1 = c.oprrr(p, p.As) + o1 |= (uint32(rf&31) << 16) | (REGZERO & 31 << 5) | uint32(rt&31) + } else if s { + o1 = c.opirr(p, p.As) + o1 |= (uint32(rf&31) << 5) | uint32(rt&31) + } else { + o1 = c.oprrr(p, p.As) + o1 |= (uint32(rf&31) << 16) | (REGZERO & 31 << 5) | uint32(rt&31) + } + + case 25: /* negX Rs, Rd -> subX Rs<<0, ZR, Rd */ + o1 = c.oprrr(p, p.As) + + rf := int(p.From.Reg) + if rf == C_NONE { + rf = int(p.To.Reg) + } + rt := int(p.To.Reg) + o1 |= (uint32(rf&31) << 16) | (REGZERO & 31 << 5) | uint32(rt&31) + + case 26: /* negX Rm< subX Rm<> 5) & 7 + if amount > 4 { + c.ctxt.Diag("shift amount out of range 0 to 4: %v", p) + } + o1 = c.opxrrr(p, p.As, true) + o1 |= c.encRegShiftOrExt(&p.From, p.From.Reg) /* includes reg, op, etc */ + } else { + o1 = c.opxrrr(p, p.As, false) + o1 |= uint32(p.From.Reg&31) << 16 + } + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + r := int(p.Reg) + if r == 0 { + r = rt + } + o1 |= (uint32(r&31) << 5) | uint32(rt&31) + + case 28: /* logop $vcon, [R], R (64 bit literal) */ + o := uint32(0) + num := uint8(0) + cls := oclass(&p.From) + if isANDWop(p.As) { + if !cmp(C_LCON, cls) { + c.ctxt.Diag("illegal combination: %v", p) + } + num = c.omovlconst(AMOVW, p, &p.From, REGTMP, os[:]) + } else { + num = c.omovlconst(AMOVD, p, &p.From, REGTMP, os[:]) + } + + if num == 0 { + c.ctxt.Diag("invalid constant: %v", p) + } + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + r := int(p.Reg) + if r == 0 { + r = rt + } + o = c.oprrr(p, p.As) + o |= REGTMP & 31 << 16 /* shift is 0 */ + o |= uint32(r&31) << 5 + o |= uint32(rt & 31) + + os[num] = o + o1 = os[0] + o2 = os[1] + o3 = os[2] + o4 = os[3] + o5 = os[4] + + case 29: /* op Rn, Rd */ + fc := c.aclass(&p.From) + tc := c.aclass(&p.To) + if (p.As == AFMOVD || p.As == AFMOVS) && (fc == C_REG || fc == C_ZCON || tc == C_REG || tc == C_ZCON) { + // FMOV Rx, Fy or FMOV Fy, Rx + o1 = FPCVTI(0, 0, 0, 0, 6) + if p.As == AFMOVD { + o1 |= 1<<31 | 1<<22 // 64-bit + } + if fc == C_REG || fc == C_ZCON { + o1 |= 1 << 16 // FMOV Rx, Fy + } + } else { + o1 = c.oprrr(p, p.As) + } + o1 |= uint32(p.From.Reg&31)<<5 | uint32(p.To.Reg&31) + + case 30: /* movT R,L(R) -> strT */ + // if offset L can be split into hi+lo, and both fit into instructions, do + // add $hi, R, Rtmp + // str R, lo(Rtmp) + // otherwise, use constant pool + // mov $L, Rtmp (from constant pool) + // str R, (R+Rtmp) + s := movesize(o.as) + if s < 0 { + c.ctxt.Diag("unexpected long move, op %v tab %v\n%v", p.As, o.as, p) + } + + r := int(p.To.Reg) + if r == 0 { + r = int(o.param) + } + + v := int32(c.regoff(&p.To)) + var hi int32 + if v < 0 || (v&((1<>uint(s))&0xFFF, REGTMP, int(p.From.Reg)) + break + + storeusepool: + if r == REGTMP || p.From.Reg == REGTMP { + c.ctxt.Diag("REGTMP used in large offset store: %v", p) + } + o1 = c.omovlit(AMOVD, p, &p.To, REGTMP) + o2 = c.olsxrr(p, int32(c.opstrr(p, p.As, false)), int(p.From.Reg), r, REGTMP) + + case 31: /* movT L(R), R -> ldrT */ + // if offset L can be split into hi+lo, and both fit into instructions, do + // add $hi, R, Rtmp + // ldr lo(Rtmp), R + // otherwise, use constant pool + // mov $L, Rtmp (from constant pool) + // ldr (R+Rtmp), R + s := movesize(o.as) + if s < 0 { + c.ctxt.Diag("unexpected long move, op %v tab %v\n%v", p.As, o.as, p) + } + + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + + v := int32(c.regoff(&p.From)) + var hi int32 + if v < 0 || (v&((1<>uint(s))&0xFFF, REGTMP, int(p.To.Reg)) + break + + loadusepool: + if r == REGTMP || p.From.Reg == REGTMP { + c.ctxt.Diag("REGTMP used in large offset load: %v", p) + } + o1 = c.omovlit(AMOVD, p, &p.From, REGTMP) + o2 = c.olsxrr(p, int32(c.opldrr(p, p.As, false)), int(p.To.Reg), r, REGTMP) + + case 32: /* mov $con, R -> movz/movn */ + o1 = c.omovconst(p.As, p, &p.From, int(p.To.Reg)) + + case 33: /* movk $uimm16 << pos */ + o1 = c.opirr(p, p.As) + + d := p.From.Offset + s := movcon(d) + if s < 0 || s >= 4 { + c.ctxt.Diag("bad constant for MOVK: %#x\n%v", uint64(d), p) + } + if (o1&S64) == 0 && s >= 2 { + c.ctxt.Diag("illegal bit position\n%v", p) + } + if ((d >> uint(s*16)) >> 16) != 0 { + c.ctxt.Diag("requires uimm16\n%v", p) + } + rt := int(p.To.Reg) + + o1 |= uint32((((d >> uint(s*16)) & 0xFFFF) << 5) | int64((uint32(s)&3)<<21) | int64(rt&31)) + + case 34: /* mov $lacon,R */ + o1 = c.omovlit(AMOVD, p, &p.From, REGTMP) + + if o1 == 0 { + break + } + o2 = c.opxrrr(p, AADD, false) + o2 |= REGTMP & 31 << 16 + o2 |= LSL0_64 + r := int(p.From.Reg) + if r == 0 { + r = int(o.param) + } + o2 |= uint32(r&31) << 5 + o2 |= uint32(p.To.Reg & 31) + + case 35: /* mov SPR,R -> mrs */ + o1 = c.oprrr(p, AMRS) + + // SysRegEnc function returns the system register encoding and accessFlags. + _, v, accessFlags := SysRegEnc(p.From.Reg) + if v == 0 { + c.ctxt.Diag("illegal system register:\n%v", p) + } + if (o1 & (v &^ (3 << 19))) != 0 { + c.ctxt.Diag("MRS register value overlap\n%v", p) + } + if accessFlags&SR_READ == 0 { + c.ctxt.Diag("system register is not readable: %v", p) + } + + o1 |= v + o1 |= uint32(p.To.Reg & 31) + + case 36: /* mov R,SPR */ + o1 = c.oprrr(p, AMSR) + + // SysRegEnc function returns the system register encoding and accessFlags. + _, v, accessFlags := SysRegEnc(p.To.Reg) + if v == 0 { + c.ctxt.Diag("illegal system register:\n%v", p) + } + if (o1 & (v &^ (3 << 19))) != 0 { + c.ctxt.Diag("MSR register value overlap\n%v", p) + } + if accessFlags&SR_WRITE == 0 { + c.ctxt.Diag("system register is not writable: %v", p) + } + + o1 |= v + o1 |= uint32(p.From.Reg & 31) + + case 37: /* mov $con,PSTATEfield -> MSR [immediate] */ + if (uint64(p.From.Offset) &^ uint64(0xF)) != 0 { + c.ctxt.Diag("illegal immediate for PSTATE field\n%v", p) + } + o1 = c.opirr(p, AMSR) + o1 |= uint32((p.From.Offset & 0xF) << 8) /* Crm */ + v := uint32(0) + for i := 0; i < len(pstatefield); i++ { + if pstatefield[i].reg == p.To.Reg { + v = pstatefield[i].enc + break + } + } + + if v == 0 { + c.ctxt.Diag("illegal PSTATE field for immediate move\n%v", p) + } + o1 |= v + + case 38: /* clrex [$imm] */ + o1 = c.opimm(p, p.As) + + if p.To.Type == obj.TYPE_NONE { + o1 |= 0xF << 8 + } else { + o1 |= uint32((p.To.Offset & 0xF) << 8) + } + + case 39: /* cbz R, rel */ + o1 = c.opirr(p, p.As) + + o1 |= uint32(p.From.Reg & 31) + o1 |= uint32(c.brdist(p, 0, 19, 2) << 5) + + case 40: /* tbz */ + o1 = c.opirr(p, p.As) + + v := int32(p.From.Offset) + if v < 0 || v > 63 { + c.ctxt.Diag("illegal bit number\n%v", p) + } + o1 |= ((uint32(v) & 0x20) << (31 - 5)) | ((uint32(v) & 0x1F) << 19) + o1 |= uint32(c.brdist(p, 0, 14, 2) << 5) + o1 |= uint32(p.Reg & 31) + + case 41: /* eret, nop, others with no operands */ + o1 = c.op0(p, p.As) + + case 42: /* bfm R,r,s,R */ + o1 = c.opbfm(p, p.As, int(p.From.Offset), int(p.GetFrom3().Offset), int(p.Reg), int(p.To.Reg)) + + case 43: /* bfm aliases */ + r := int(p.From.Offset) + s := int(p.GetFrom3().Offset) + rf := int(p.Reg) + rt := int(p.To.Reg) + if rf == 0 { + rf = rt + } + switch p.As { + case ABFI: + if r != 0 { + r = 64 - r + } + o1 = c.opbfm(p, ABFM, r, s-1, rf, rt) + + case ABFIW: + if r != 0 { + r = 32 - r + } + o1 = c.opbfm(p, ABFMW, r, s-1, rf, rt) + + case ABFXIL: + o1 = c.opbfm(p, ABFM, r, r+s-1, rf, rt) + + case ABFXILW: + o1 = c.opbfm(p, ABFMW, r, r+s-1, rf, rt) + + case ASBFIZ: + if r != 0 { + r = 64 - r + } + o1 = c.opbfm(p, ASBFM, r, s-1, rf, rt) + + case ASBFIZW: + if r != 0 { + r = 32 - r + } + o1 = c.opbfm(p, ASBFMW, r, s-1, rf, rt) + + case ASBFX: + o1 = c.opbfm(p, ASBFM, r, r+s-1, rf, rt) + + case ASBFXW: + o1 = c.opbfm(p, ASBFMW, r, r+s-1, rf, rt) + + case AUBFIZ: + if r != 0 { + r = 64 - r + } + o1 = c.opbfm(p, AUBFM, r, s-1, rf, rt) + + case AUBFIZW: + if r != 0 { + r = 32 - r + } + o1 = c.opbfm(p, AUBFMW, r, s-1, rf, rt) + + case AUBFX: + o1 = c.opbfm(p, AUBFM, r, r+s-1, rf, rt) + + case AUBFXW: + o1 = c.opbfm(p, AUBFMW, r, r+s-1, rf, rt) + + default: + c.ctxt.Diag("bad bfm alias\n%v", p) + break + } + + case 44: /* extr $b, Rn, Rm, Rd */ + o1 = c.opextr(p, p.As, int32(p.From.Offset), int(p.GetFrom3().Reg), int(p.Reg), int(p.To.Reg)) + + case 45: /* sxt/uxt[bhw] R,R; movT R,R -> sxtT R,R */ + rf := int(p.From.Reg) + + rt := int(p.To.Reg) + as := p.As + if rf == REGZERO { + as = AMOVWU /* clearer in disassembly */ + } + switch as { + case AMOVB, ASXTB: + o1 = c.opbfm(p, ASBFM, 0, 7, rf, rt) + + case AMOVH, ASXTH: + o1 = c.opbfm(p, ASBFM, 0, 15, rf, rt) + + case AMOVW, ASXTW: + o1 = c.opbfm(p, ASBFM, 0, 31, rf, rt) + + case AMOVBU, AUXTB: + o1 = c.opbfm(p, AUBFM, 0, 7, rf, rt) + + case AMOVHU, AUXTH: + o1 = c.opbfm(p, AUBFM, 0, 15, rf, rt) + + case AMOVWU: + o1 = c.oprrr(p, as) | (uint32(rf&31) << 16) | (REGZERO & 31 << 5) | uint32(rt&31) + + case AUXTW: + o1 = c.opbfm(p, AUBFM, 0, 31, rf, rt) + + case ASXTBW: + o1 = c.opbfm(p, ASBFMW, 0, 7, rf, rt) + + case ASXTHW: + o1 = c.opbfm(p, ASBFMW, 0, 15, rf, rt) + + case AUXTBW: + o1 = c.opbfm(p, AUBFMW, 0, 7, rf, rt) + + case AUXTHW: + o1 = c.opbfm(p, AUBFMW, 0, 15, rf, rt) + + default: + c.ctxt.Diag("bad sxt %v", as) + break + } + + case 46: /* cls */ + o1 = c.opbit(p, p.As) + + o1 |= uint32(p.From.Reg&31) << 5 + o1 |= uint32(p.To.Reg & 31) + + case 47: /* SWPx/LDADDx/LDANDx/LDEORx/LDORx Rs, (Rb), Rt */ + rs := p.From.Reg + rt := p.RegTo2 + rb := p.To.Reg + + fields := atomicInstructions[p.As] + // rt can't be sp. rt can't be r31 when field A is 0, A bit is the 23rd bit. + if rt == REG_RSP || (rt == REGZERO && (fields&(1<<23) == 0)) { + c.ctxt.Diag("illegal destination register: %v\n", p) + } + o1 |= fields | uint32(rs&31)<<16 | uint32(rb&31)<<5 | uint32(rt&31) + + case 48: /* ADD $C_ADDCON2, Rm, Rd */ + // NOTE: this case does not use REGTMP. If it ever does, + // remove the NOTUSETMP flag in optab. + op := c.opirr(p, p.As) + if op&Sbit != 0 { + c.ctxt.Diag("can not break addition/subtraction when S bit is set", p) + } + rt := int(p.To.Reg) + r := int(p.Reg) + if r == 0 { + r = rt + } + o1 = c.oaddi(p, int32(op), int32(c.regoff(&p.From))&0x000fff, r, rt) + o2 = c.oaddi(p, int32(op), int32(c.regoff(&p.From))&0xfff000, rt, rt) + + case 50: /* sys/sysl */ + o1 = c.opirr(p, p.As) + + if (p.From.Offset &^ int64(SYSARG4(0x7, 0xF, 0xF, 0x7))) != 0 { + c.ctxt.Diag("illegal SYS argument\n%v", p) + } + o1 |= uint32(p.From.Offset) + if p.To.Type == obj.TYPE_REG { + o1 |= uint32(p.To.Reg & 31) + } else if p.Reg != 0 { + o1 |= uint32(p.Reg & 31) + } else { + o1 |= 0x1F + } + + case 51: /* dmb */ + o1 = c.opirr(p, p.As) + + if p.From.Type == obj.TYPE_CONST { + o1 |= uint32((p.From.Offset & 0xF) << 8) + } + + case 52: /* hint */ + o1 = c.opirr(p, p.As) + + o1 |= uint32((p.From.Offset & 0x7F) << 5) + + case 53: /* and/or/eor/bic/tst/... $bitcon, Rn, Rd */ + a := p.As + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + r := int(p.Reg) + if r == 0 { + r = rt + } + mode := 64 + v := uint64(p.From.Offset) + switch p.As { + case AANDW, AORRW, AEORW, AANDSW, ATSTW: + mode = 32 + case ABIC, AORN, AEON, ABICS: + v = ^v + case ABICW, AORNW, AEONW, ABICSW: + v = ^v + mode = 32 + } + o1 = c.opirr(p, a) + o1 |= bitconEncode(v, mode) | uint32(r&31)<<5 | uint32(rt&31) + + case 54: /* floating point arith */ + o1 = c.oprrr(p, p.As) + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if (o1&(0x1F<<24)) == (0x1E<<24) && (o1&(1<<11)) == 0 { /* monadic */ + r = rf + rf = 0 + } else if r == 0 { + r = rt + } + o1 |= (uint32(rf&31) << 16) | (uint32(r&31) << 5) | uint32(rt&31) + + case 55: /* floating-point constant */ + var rf int + o1 = 0xf<<25 | 1<<21 | 1<<12 + rf = c.chipfloat7(p.From.Val.(float64)) + if rf < 0 { + c.ctxt.Diag("invalid floating-point immediate\n%v", p) + } + if p.As == AFMOVD { + o1 |= 1 << 22 + } + o1 |= (uint32(rf&0xff) << 13) | uint32(p.To.Reg&31) + + case 56: /* floating point compare */ + o1 = c.oprrr(p, p.As) + + var rf int + if p.From.Type == obj.TYPE_FCONST { + o1 |= 8 /* zero */ + rf = 0 + } else { + rf = int(p.From.Reg) + } + rt := int(p.Reg) + o1 |= uint32(rf&31)<<16 | uint32(rt&31)<<5 + + case 57: /* floating point conditional compare */ + o1 = c.oprrr(p, p.As) + + cond := int(p.From.Reg) + if cond < COND_EQ || cond > COND_NV { + c.ctxt.Diag("invalid condition\n%v", p) + } else { + cond -= COND_EQ + } + + nzcv := int(p.To.Offset) + if nzcv&^0xF != 0 { + c.ctxt.Diag("implausible condition\n%v", p) + } + rf := int(p.Reg) + if p.GetFrom3() == nil || p.GetFrom3().Reg < REG_F0 || p.GetFrom3().Reg > REG_F31 { + c.ctxt.Diag("illegal FCCMP\n%v", p) + break + } + rt := int(p.GetFrom3().Reg) + o1 |= uint32(rf&31)<<16 | uint32(cond&15)<<12 | uint32(rt&31)<<5 | uint32(nzcv) + + case 58: /* ldar/ldarb/ldarh/ldaxp/ldxp/ldaxr/ldxr */ + o1 = c.opload(p, p.As) + + o1 |= 0x1F << 16 + o1 |= uint32(p.From.Reg&31) << 5 + if p.As == ALDXP || p.As == ALDXPW || p.As == ALDAXP || p.As == ALDAXPW { + if int(p.To.Reg) == int(p.To.Offset) { + c.ctxt.Diag("constrained unpredictable behavior: %v", p) + } + o1 |= uint32(p.To.Offset&31) << 10 + } else { + o1 |= 0x1F << 10 + } + o1 |= uint32(p.To.Reg & 31) + + case 59: /* stxr/stlxr/stxp/stlxp */ + s := p.RegTo2 + n := p.To.Reg + t := p.From.Reg + if isSTLXRop(p.As) { + if s == t || (s == n && n != REGSP) { + c.ctxt.Diag("constrained unpredictable behavior: %v", p) + } + } else if isSTXPop(p.As) { + t2 := int16(p.From.Offset) + if (s == t || s == t2) || (s == n && n != REGSP) { + c.ctxt.Diag("constrained unpredictable behavior: %v", p) + } + } + if s == REG_RSP { + c.ctxt.Diag("illegal destination register: %v\n", p) + } + o1 = c.opstore(p, p.As) + + if p.RegTo2 != obj.REG_NONE { + o1 |= uint32(p.RegTo2&31) << 16 + } else { + o1 |= 0x1F << 16 + } + if isSTXPop(p.As) { + o1 |= uint32(p.From.Offset&31) << 10 + } + o1 |= uint32(p.To.Reg&31)<<5 | uint32(p.From.Reg&31) + + case 60: /* adrp label,r */ + d := c.brdist(p, 12, 21, 0) + + o1 = ADR(1, uint32(d), uint32(p.To.Reg)) + + case 61: /* adr label, r */ + d := c.brdist(p, 0, 21, 0) + + o1 = ADR(0, uint32(d), uint32(p.To.Reg)) + + case 62: /* op $movcon, [R], R -> mov $movcon, REGTMP + op REGTMP, [R], R */ + if p.Reg == REGTMP { + c.ctxt.Diag("cannot use REGTMP as source: %v\n", p) + } + if isADDWop(p.As) || isANDWop(p.As) { + o1 = c.omovconst(AMOVW, p, &p.From, REGTMP) + } else { + o1 = c.omovconst(AMOVD, p, &p.From, REGTMP) + } + + rt := int(p.To.Reg) + if p.To.Type == obj.TYPE_NONE { + rt = REGZERO + } + r := int(p.Reg) + if r == 0 { + r = rt + } + if p.To.Reg == REGSP || r == REGSP { + o2 = c.opxrrr(p, p.As, false) + o2 |= REGTMP & 31 << 16 + o2 |= LSL0_64 + } else { + o2 = c.oprrr(p, p.As) + o2 |= REGTMP & 31 << 16 /* shift is 0 */ + } + o2 |= uint32(r&31) << 5 + o2 |= uint32(rt & 31) + + /* reloc ops */ + case 64: /* movT R,addr -> adrp + add + movT R, (REGTMP) */ + o1 = ADR(1, 0, REGTMP) + o2 = c.opirr(p, AADD) | REGTMP&31<<5 | REGTMP&31 + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.To.Sym + rel.Add = p.To.Offset + rel.Type = objabi.R_ADDRARM64 + o3 = c.olsr12u(p, int32(c.opstr12(p, p.As)), 0, REGTMP, int(p.From.Reg)) + + case 65: /* movT addr,R -> adrp + add + movT (REGTMP), R */ + o1 = ADR(1, 0, REGTMP) + o2 = c.opirr(p, AADD) | REGTMP&31<<5 | REGTMP&31 + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.From.Sym + rel.Add = p.From.Offset + rel.Type = objabi.R_ADDRARM64 + o3 = c.olsr12u(p, int32(c.opldr12(p, p.As)), 0, REGTMP, int(p.To.Reg)) + + case 66: /* ldp O(R)!, (r1, r2); ldp (R)O!, (r1, r2) */ + v := int32(c.regoff(&p.From)) + r := int(p.From.Reg) + if r == obj.REG_NONE { + r = int(o.param) + } + if r == obj.REG_NONE { + c.ctxt.Diag("invalid ldp source: %v\n", p) + } + o1 |= c.opldpstp(p, o, v, uint32(r), uint32(p.To.Reg), uint32(p.To.Offset), 1) + + case 67: /* stp (r1, r2), O(R)!; stp (r1, r2), (R)O! */ + r := int(p.To.Reg) + if r == obj.REG_NONE { + r = int(o.param) + } + if r == obj.REG_NONE { + c.ctxt.Diag("invalid stp destination: %v\n", p) + } + v := int32(c.regoff(&p.To)) + o1 = c.opldpstp(p, o, v, uint32(r), uint32(p.From.Reg), uint32(p.From.Offset), 0) + + case 68: /* movT $vconaddr(SB), reg -> adrp + add + reloc */ + // NOTE: this case does not use REGTMP. If it ever does, + // remove the NOTUSETMP flag in optab. + if p.As == AMOVW { + c.ctxt.Diag("invalid load of 32-bit address: %v", p) + } + o1 = ADR(1, 0, uint32(p.To.Reg)) + o2 = c.opirr(p, AADD) | uint32(p.To.Reg&31)<<5 | uint32(p.To.Reg&31) + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.From.Sym + rel.Add = p.From.Offset + rel.Type = objabi.R_ADDRARM64 + + case 69: /* LE model movd $tlsvar, reg -> movz reg, 0 + reloc */ + o1 = c.opirr(p, AMOVZ) + o1 |= uint32(p.To.Reg & 31) + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 4 + rel.Sym = p.From.Sym + rel.Type = objabi.R_ARM64_TLS_LE + if p.From.Offset != 0 { + c.ctxt.Diag("invalid offset on MOVW $tlsvar") + } + + case 70: /* IE model movd $tlsvar, reg -> adrp REGTMP, 0; ldr reg, [REGTMP, #0] + relocs */ + o1 = ADR(1, 0, REGTMP) + o2 = c.olsr12u(p, int32(c.opldr12(p, AMOVD)), 0, REGTMP, int(p.To.Reg)) + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.From.Sym + rel.Add = 0 + rel.Type = objabi.R_ARM64_TLS_IE + if p.From.Offset != 0 { + c.ctxt.Diag("invalid offset on MOVW $tlsvar") + } + + case 71: /* movd sym@GOT, reg -> adrp REGTMP, #0; ldr reg, [REGTMP, #0] + relocs */ + o1 = ADR(1, 0, REGTMP) + o2 = c.olsr12u(p, int32(c.opldr12(p, AMOVD)), 0, REGTMP, int(p.To.Reg)) + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.From.Sym + rel.Add = 0 + rel.Type = objabi.R_ARM64_GOTPCREL + + case 72: /* vaddp/vand/vcmeq/vorr/vadd/veor/vfmla/vfmls/vbit/vbsl/vcmtst/vsub/vbif/vuzip1/vuzip2 Vm., Vn., Vd. */ + af := int((p.From.Reg >> 5) & 15) + af3 := int((p.Reg >> 5) & 15) + at := int((p.To.Reg >> 5) & 15) + if af != af3 || af != at { + c.ctxt.Diag("operand mismatch: %v", p) + break + } + o1 = c.oprrr(p, p.As) + rf := int((p.From.Reg) & 31) + rt := int((p.To.Reg) & 31) + r := int((p.Reg) & 31) + + Q := 0 + size := 0 + switch af { + case ARNG_16B: + Q = 1 + size = 0 + case ARNG_2D: + Q = 1 + size = 3 + case ARNG_2S: + Q = 0 + size = 2 + case ARNG_4H: + Q = 0 + size = 1 + case ARNG_4S: + Q = 1 + size = 2 + case ARNG_8B: + Q = 0 + size = 0 + case ARNG_8H: + Q = 1 + size = 1 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + + switch p.As { + case AVORR, AVAND, AVEOR, AVBIT, AVBSL, AVBIF: + if af != ARNG_16B && af != ARNG_8B { + c.ctxt.Diag("invalid arrangement: %v", p) + } + case AVFMLA, AVFMLS: + if af != ARNG_2D && af != ARNG_2S && af != ARNG_4S { + c.ctxt.Diag("invalid arrangement: %v", p) + } + } + switch p.As { + case AVAND, AVEOR: + size = 0 + case AVBSL: + size = 1 + case AVORR, AVBIT, AVBIF: + size = 2 + case AVFMLA, AVFMLS: + if af == ARNG_2D { + size = 1 + } else { + size = 0 + } + } + + o1 |= (uint32(Q&1) << 30) | (uint32(size&3) << 22) | (uint32(rf&31) << 16) | (uint32(r&31) << 5) | uint32(rt&31) + + case 73: /* vmov V.[index], R */ + rf := int(p.From.Reg) + rt := int(p.To.Reg) + imm5 := 0 + o1 = 7<<25 | 0xf<<10 + index := int(p.From.Index) + switch (p.From.Reg >> 5) & 15 { + case ARNG_B: + c.checkindex(p, index, 15) + imm5 |= 1 + imm5 |= index << 1 + case ARNG_H: + c.checkindex(p, index, 7) + imm5 |= 2 + imm5 |= index << 2 + case ARNG_S: + c.checkindex(p, index, 3) + imm5 |= 4 + imm5 |= index << 3 + case ARNG_D: + c.checkindex(p, index, 1) + imm5 |= 8 + imm5 |= index << 4 + o1 |= 1 << 30 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + o1 |= (uint32(imm5&0x1f) << 16) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 74: + // add $O, R, Rtmp or sub $O, R, Rtmp + // ldp (Rtmp), (R1, R2) + r := int(p.From.Reg) + if r == obj.REG_NONE { + r = int(o.param) + } + if r == obj.REG_NONE { + c.ctxt.Diag("invalid ldp source: %v", p) + } + v := int32(c.regoff(&p.From)) + + if v > 0 { + if v > 4095 { + c.ctxt.Diag("offset out of range: %v", p) + } + o1 = c.oaddi(p, int32(c.opirr(p, AADD)), v, r, REGTMP) + } + if v < 0 { + if v < -4095 { + c.ctxt.Diag("offset out of range: %v", p) + } + o1 = c.oaddi(p, int32(c.opirr(p, ASUB)), -v, r, REGTMP) + } + o2 |= c.opldpstp(p, o, 0, uint32(REGTMP), uint32(p.To.Reg), uint32(p.To.Offset), 1) + + case 75: + // mov $L, Rtmp (from constant pool) + // add Rtmp, R, Rtmp + // ldp (Rtmp), (R1, R2) + r := int(p.From.Reg) + if r == obj.REG_NONE { + r = int(o.param) + } + if r == obj.REG_NONE { + c.ctxt.Diag("invalid ldp source: %v", p) + } + o1 = c.omovlit(AMOVD, p, &p.From, REGTMP) + o2 = c.opxrrr(p, AADD, false) + o2 |= (REGTMP & 31) << 16 + o2 |= uint32(r&31) << 5 + o2 |= uint32(REGTMP & 31) + o3 |= c.opldpstp(p, o, 0, uint32(REGTMP), uint32(p.To.Reg), uint32(p.To.Offset), 1) + + case 76: + // add $O, R, Rtmp or sub $O, R, Rtmp + // stp (R1, R2), (Rtmp) + r := int(p.To.Reg) + if r == obj.REG_NONE { + r = int(o.param) + } + if r == obj.REG_NONE { + c.ctxt.Diag("invalid stp destination: %v", p) + } + v := int32(c.regoff(&p.To)) + if v > 0 { + if v > 4095 { + c.ctxt.Diag("offset out of range: %v", p) + } + o1 = c.oaddi(p, int32(c.opirr(p, AADD)), v, r, REGTMP) + } + if v < 0 { + if v < -4095 { + c.ctxt.Diag("offset out of range: %v", p) + } + o1 = c.oaddi(p, int32(c.opirr(p, ASUB)), -v, r, REGTMP) + } + o2 |= c.opldpstp(p, o, 0, uint32(REGTMP), uint32(p.From.Reg), uint32(p.From.Offset), 0) + + case 77: + // mov $L, Rtmp (from constant pool) + // add Rtmp, R, Rtmp + // stp (R1, R2), (Rtmp) + r := int(p.To.Reg) + if r == obj.REG_NONE { + r = int(o.param) + } + if r == obj.REG_NONE { + c.ctxt.Diag("invalid stp destination: %v", p) + } + o1 = c.omovlit(AMOVD, p, &p.To, REGTMP) + o2 = c.opxrrr(p, AADD, false) + o2 |= REGTMP & 31 << 16 + o2 |= uint32(r&31) << 5 + o2 |= uint32(REGTMP & 31) + o3 |= c.opldpstp(p, o, 0, uint32(REGTMP), uint32(p.From.Reg), uint32(p.From.Offset), 0) + + case 78: /* vmov R, V.[index] */ + rf := int(p.From.Reg) + rt := int(p.To.Reg) + imm5 := 0 + o1 = 1<<30 | 7<<25 | 7<<10 + index := int(p.To.Index) + switch (p.To.Reg >> 5) & 15 { + case ARNG_B: + c.checkindex(p, index, 15) + imm5 |= 1 + imm5 |= index << 1 + case ARNG_H: + c.checkindex(p, index, 7) + imm5 |= 2 + imm5 |= index << 2 + case ARNG_S: + c.checkindex(p, index, 3) + imm5 |= 4 + imm5 |= index << 3 + case ARNG_D: + c.checkindex(p, index, 1) + imm5 |= 8 + imm5 |= index << 4 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + o1 |= (uint32(imm5&0x1f) << 16) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 79: /* vdup Vn.[index], Vd. */ + rf := int(p.From.Reg) + rt := int(p.To.Reg) + o1 = 7<<25 | 1<<10 + var imm5, Q int + index := int(p.From.Index) + switch (p.To.Reg >> 5) & 15 { + case ARNG_16B: + c.checkindex(p, index, 15) + Q = 1 + imm5 = 1 + imm5 |= index << 1 + case ARNG_2D: + c.checkindex(p, index, 1) + Q = 1 + imm5 = 8 + imm5 |= index << 4 + case ARNG_2S: + c.checkindex(p, index, 3) + Q = 0 + imm5 = 4 + imm5 |= index << 3 + case ARNG_4H: + c.checkindex(p, index, 7) + Q = 0 + imm5 = 2 + imm5 |= index << 2 + case ARNG_4S: + c.checkindex(p, index, 3) + Q = 1 + imm5 = 4 + imm5 |= index << 3 + case ARNG_8B: + c.checkindex(p, index, 15) + Q = 0 + imm5 = 1 + imm5 |= index << 1 + case ARNG_8H: + c.checkindex(p, index, 7) + Q = 1 + imm5 = 2 + imm5 |= index << 2 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + o1 |= (uint32(Q&1) << 30) | (uint32(imm5&0x1f) << 16) + o1 |= (uint32(rf&31) << 5) | uint32(rt&31) + + case 80: /* vmov V.[index], Vn */ + rf := int(p.From.Reg) + rt := int(p.To.Reg) + imm5 := 0 + index := int(p.From.Index) + switch p.As { + case AVMOV: + o1 = 1<<30 | 15<<25 | 1<<10 + switch (p.From.Reg >> 5) & 15 { + case ARNG_B: + c.checkindex(p, index, 15) + imm5 |= 1 + imm5 |= index << 1 + case ARNG_H: + c.checkindex(p, index, 7) + imm5 |= 2 + imm5 |= index << 2 + case ARNG_S: + c.checkindex(p, index, 3) + imm5 |= 4 + imm5 |= index << 3 + case ARNG_D: + c.checkindex(p, index, 1) + imm5 |= 8 + imm5 |= index << 4 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + default: + c.ctxt.Diag("unsupported op %v", p.As) + } + o1 |= (uint32(imm5&0x1f) << 16) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 81: /* vld[1-4]|vld[1-4]r (Rn), [Vt1., Vt2., ...] */ + c.checkoffset(p, p.As) + r := int(p.From.Reg) + o1 = c.oprrr(p, p.As) + if o.scond == C_XPOST { + o1 |= 1 << 23 + if p.From.Index == 0 { + // immediate offset variant + o1 |= 0x1f << 16 + } else { + // register offset variant + if isRegShiftOrExt(&p.From) { + c.ctxt.Diag("invalid extended register op: %v\n", p) + } + o1 |= uint32(p.From.Index&0x1f) << 16 + } + } + o1 |= uint32(p.To.Offset) + // cmd/asm/internal/arch/arm64.go:ARM64RegisterListOffset + // add opcode(bit 12-15) for vld1, mask it off if it's not vld1 + o1 = c.maskOpvldvst(p, o1) + o1 |= uint32(r&31) << 5 + + case 82: /* vmov Rn, Vd. */ + rf := int(p.From.Reg) + rt := int(p.To.Reg) + o1 = 7<<25 | 3<<10 + var imm5, Q uint32 + switch (p.To.Reg >> 5) & 15 { + case ARNG_16B: + Q = 1 + imm5 = 1 + case ARNG_2D: + Q = 1 + imm5 = 8 + case ARNG_2S: + Q = 0 + imm5 = 4 + case ARNG_4H: + Q = 0 + imm5 = 2 + case ARNG_4S: + Q = 1 + imm5 = 4 + case ARNG_8B: + Q = 0 + imm5 = 1 + case ARNG_8H: + Q = 1 + imm5 = 2 + default: + c.ctxt.Diag("invalid arrangement on VMOV Rn, Vd.: %v\n", p) + } + o1 |= (Q & 1 << 30) | (imm5 & 0x1f << 16) + o1 |= (uint32(rf&31) << 5) | uint32(rt&31) + + case 83: /* vmov Vn., Vd. */ + af := int((p.From.Reg >> 5) & 15) + at := int((p.To.Reg >> 5) & 15) + if af != at { + c.ctxt.Diag("invalid arrangement: %v\n", p) + } + o1 = c.oprrr(p, p.As) + rf := int((p.From.Reg) & 31) + rt := int((p.To.Reg) & 31) + + var Q, size uint32 + switch af { + case ARNG_8B: + Q = 0 + size = 0 + case ARNG_16B: + Q = 1 + size = 0 + case ARNG_4H: + Q = 0 + size = 1 + case ARNG_8H: + Q = 1 + size = 1 + case ARNG_2S: + Q = 0 + size = 2 + case ARNG_4S: + Q = 1 + size = 2 + default: + c.ctxt.Diag("invalid arrangement: %v\n", p) + } + + if (p.As == AVMOV || p.As == AVRBIT || p.As == AVCNT) && (af != ARNG_16B && af != ARNG_8B) { + c.ctxt.Diag("invalid arrangement: %v", p) + } + + if p.As == AVREV32 && (af == ARNG_2S || af == ARNG_4S) { + c.ctxt.Diag("invalid arrangement: %v", p) + } + + if p.As == AVREV16 && af != ARNG_8B && af != ARNG_16B { + c.ctxt.Diag("invalid arrangement: %v", p) + } + + if p.As == AVMOV { + o1 |= uint32(rf&31) << 16 + } + + if p.As == AVRBIT { + size = 1 + } + + o1 |= (Q&1)<<30 | (size&3)<<22 | uint32(rf&31)<<5 | uint32(rt&31) + + case 84: /* vst[1-4] [Vt1., Vt2., ...], (Rn) */ + c.checkoffset(p, p.As) + r := int(p.To.Reg) + o1 = 3 << 26 + if o.scond == C_XPOST { + o1 |= 1 << 23 + if p.To.Index == 0 { + // immediate offset variant + o1 |= 0x1f << 16 + } else { + // register offset variant + if isRegShiftOrExt(&p.To) { + c.ctxt.Diag("invalid extended register: %v\n", p) + } + o1 |= uint32(p.To.Index&31) << 16 + } + } + o1 |= uint32(p.From.Offset) + // cmd/asm/internal/arch/arm64.go:ARM64RegisterListOffset + // add opcode(bit 12-15) for vst1, mask it off if it's not vst1 + o1 = c.maskOpvldvst(p, o1) + o1 |= uint32(r&31) << 5 + + case 85: /* vaddv/vuaddlv Vn., Vd*/ + af := int((p.From.Reg >> 5) & 15) + o1 = c.oprrr(p, p.As) + rf := int((p.From.Reg) & 31) + rt := int((p.To.Reg) & 31) + Q := 0 + size := 0 + switch af { + case ARNG_8B: + Q = 0 + size = 0 + case ARNG_16B: + Q = 1 + size = 0 + case ARNG_4H: + Q = 0 + size = 1 + case ARNG_8H: + Q = 1 + size = 1 + case ARNG_4S: + Q = 1 + size = 2 + default: + c.ctxt.Diag("invalid arrangement: %v\n", p) + } + o1 |= (uint32(Q&1) << 30) | (uint32(size&3) << 22) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 86: /* vmovi $imm8, Vd.*/ + at := int((p.To.Reg >> 5) & 15) + r := int(p.From.Offset) + if r > 255 || r < 0 { + c.ctxt.Diag("immediate constant out of range: %v\n", p) + } + rt := int((p.To.Reg) & 31) + Q := 0 + switch at { + case ARNG_8B: + Q = 0 + case ARNG_16B: + Q = 1 + default: + c.ctxt.Diag("invalid arrangement: %v\n", p) + } + o1 = 0xf<<24 | 0xe<<12 | 1<<10 + o1 |= (uint32(Q&1) << 30) | (uint32((r>>5)&7) << 16) | (uint32(r&0x1f) << 5) | uint32(rt&31) + + case 87: /* stp (r,r), addr(SB) -> adrp + add + stp */ + o1 = ADR(1, 0, REGTMP) + o2 = c.opirr(p, AADD) | REGTMP&31<<5 | REGTMP&31 + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.To.Sym + rel.Add = p.To.Offset + rel.Type = objabi.R_ADDRARM64 + o3 |= c.opldpstp(p, o, 0, uint32(REGTMP), uint32(p.From.Reg), uint32(p.From.Offset), 0) + + case 88: /* ldp addr(SB), (r,r) -> adrp + add + ldp */ + o1 = ADR(1, 0, REGTMP) + o2 = c.opirr(p, AADD) | REGTMP&31<<5 | REGTMP&31 + rel := obj.Addrel(c.cursym) + rel.Off = int32(c.pc) + rel.Siz = 8 + rel.Sym = p.From.Sym + rel.Add = p.From.Offset + rel.Type = objabi.R_ADDRARM64 + o3 |= c.opldpstp(p, o, 0, uint32(REGTMP), uint32(p.To.Reg), uint32(p.To.Offset), 1) + + case 89: /* vadd/vsub Vm, Vn, Vd */ + switch p.As { + case AVADD: + o1 = 5<<28 | 7<<25 | 7<<21 | 1<<15 | 1<<10 + + case AVSUB: + o1 = 7<<28 | 7<<25 | 7<<21 | 1<<15 | 1<<10 + + default: + c.ctxt.Diag("bad opcode: %v\n", p) + break + } + + rf := int(p.From.Reg) + rt := int(p.To.Reg) + r := int(p.Reg) + if r == 0 { + r = rt + } + o1 |= (uint32(rf&31) << 16) | (uint32(r&31) << 5) | uint32(rt&31) + + // This is supposed to be something that stops execution. + // It's not supposed to be reached, ever, but if it is, we'd + // like to be able to tell how we got there. Assemble as + // 0xbea71700 which is guaranteed to raise undefined instruction + // exception. + case 90: + o1 = 0xbea71700 + + case 91: /* prfm imm(Rn), */ + imm := uint32(p.From.Offset) + r := p.From.Reg + v := uint32(0xff) + if p.To.Type == obj.TYPE_CONST { + v = uint32(p.To.Offset) + if v > 31 { + c.ctxt.Diag("illegal prefetch operation\n%v", p) + } + } else { + for i := 0; i < len(prfopfield); i++ { + if prfopfield[i].reg == p.To.Reg { + v = prfopfield[i].enc + break + } + } + if v == 0xff { + c.ctxt.Diag("illegal prefetch operation:\n%v", p) + } + } + + o1 = c.opldrpp(p, p.As) + o1 |= (uint32(r&31) << 5) | (uint32((imm>>3)&0xfff) << 10) | (uint32(v & 31)) + + case 92: /* vmov Vn.[index], Vd.[index] */ + rf := int(p.From.Reg) + rt := int(p.To.Reg) + imm4 := 0 + imm5 := 0 + o1 = 3<<29 | 7<<25 | 1<<10 + index1 := int(p.To.Index) + index2 := int(p.From.Index) + if ((p.To.Reg >> 5) & 15) != ((p.From.Reg >> 5) & 15) { + c.ctxt.Diag("operand mismatch: %v", p) + } + switch (p.To.Reg >> 5) & 15 { + case ARNG_B: + c.checkindex(p, index1, 15) + c.checkindex(p, index2, 15) + imm5 |= 1 + imm5 |= index1 << 1 + imm4 |= index2 + case ARNG_H: + c.checkindex(p, index1, 7) + c.checkindex(p, index2, 7) + imm5 |= 2 + imm5 |= index1 << 2 + imm4 |= index2 << 1 + case ARNG_S: + c.checkindex(p, index1, 3) + c.checkindex(p, index2, 3) + imm5 |= 4 + imm5 |= index1 << 3 + imm4 |= index2 << 2 + case ARNG_D: + c.checkindex(p, index1, 1) + c.checkindex(p, index2, 1) + imm5 |= 8 + imm5 |= index1 << 4 + imm4 |= index2 << 3 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + o1 |= (uint32(imm5&0x1f) << 16) | (uint32(imm4&0xf) << 11) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 93: /* vpmull{2} Vm., Vn., Vd */ + af := int((p.From.Reg >> 5) & 15) + at := int((p.To.Reg >> 5) & 15) + a := int((p.Reg >> 5) & 15) + + var Q, size uint32 + if p.As == AVPMULL { + Q = 0 + } else { + Q = 1 + } + + var fArng int + switch at { + case ARNG_8H: + if Q == 0 { + fArng = ARNG_8B + } else { + fArng = ARNG_16B + } + size = 0 + case ARNG_1Q: + if Q == 0 { + fArng = ARNG_1D + } else { + fArng = ARNG_2D + } + size = 3 + default: + c.ctxt.Diag("invalid arrangement on Vd.: %v", p) + } + + if af != a || af != fArng { + c.ctxt.Diag("invalid arrangement: %v", p) + } + + o1 = c.oprrr(p, p.As) + rf := int((p.From.Reg) & 31) + rt := int((p.To.Reg) & 31) + r := int((p.Reg) & 31) + + o1 |= ((Q & 1) << 30) | ((size & 3) << 22) | (uint32(rf&31) << 16) | (uint32(r&31) << 5) | uint32(rt&31) + + case 94: /* vext $imm4, Vm., Vn., Vd. */ + af := int(((p.GetFrom3().Reg) >> 5) & 15) + at := int((p.To.Reg >> 5) & 15) + a := int((p.Reg >> 5) & 15) + index := int(p.From.Offset) + + if af != a || af != at { + c.ctxt.Diag("invalid arrangement: %v", p) + break + } + + var Q uint32 + var b int + if af == ARNG_8B { + Q = 0 + b = 7 + } else if af == ARNG_16B { + Q = 1 + b = 15 + } else { + c.ctxt.Diag("invalid arrangement, should be B8 or B16: %v", p) + break + } + + if index < 0 || index > b { + c.ctxt.Diag("illegal offset: %v", p) + } + + o1 = c.opirr(p, p.As) + rf := int((p.GetFrom3().Reg) & 31) + rt := int((p.To.Reg) & 31) + r := int((p.Reg) & 31) + + o1 |= ((Q & 1) << 30) | (uint32(r&31) << 16) | (uint32(index&15) << 11) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 95: /* vushr $shift, Vn., Vd. */ + at := int((p.To.Reg >> 5) & 15) + af := int((p.Reg >> 5) & 15) + shift := int(p.From.Offset) + + if af != at { + c.ctxt.Diag("invalid arrangement on op Vn., Vd.: %v", p) + } + + var Q uint32 + var imax, esize int + + switch af { + case ARNG_8B, ARNG_4H, ARNG_2S: + Q = 0 + case ARNG_16B, ARNG_8H, ARNG_4S, ARNG_2D: + Q = 1 + default: + c.ctxt.Diag("invalid arrangement on op Vn., Vd.: %v", p) + } + + switch af { + case ARNG_8B, ARNG_16B: + imax = 15 + esize = 8 + case ARNG_4H, ARNG_8H: + imax = 31 + esize = 16 + case ARNG_2S, ARNG_4S: + imax = 63 + esize = 32 + case ARNG_2D: + imax = 127 + esize = 64 + } + + imm := 0 + + switch p.As { + case AVUSHR, AVSRI: + imm = esize*2 - shift + if imm < esize || imm > imax { + c.ctxt.Diag("shift out of range: %v", p) + } + case AVSHL: + imm = esize + shift + if imm > imax { + c.ctxt.Diag("shift out of range: %v", p) + } + default: + c.ctxt.Diag("invalid instruction %v\n", p) + } + + o1 = c.opirr(p, p.As) + rt := int((p.To.Reg) & 31) + rf := int((p.Reg) & 31) + + o1 |= ((Q & 1) << 30) | (uint32(imm&127) << 16) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 96: /* vst1 Vt1.[index], offset(Rn) */ + af := int((p.From.Reg >> 5) & 15) + rt := int((p.From.Reg) & 31) + rf := int((p.To.Reg) & 31) + r := int(p.To.Index & 31) + index := int(p.From.Index) + offset := int32(c.regoff(&p.To)) + + if o.scond == C_XPOST { + if (p.To.Index != 0) && (offset != 0) { + c.ctxt.Diag("invalid offset: %v", p) + } + if p.To.Index == 0 && offset == 0 { + c.ctxt.Diag("invalid offset: %v", p) + } + } + + if offset != 0 { + r = 31 + } + + var Q, S, size int + var opcode uint32 + switch af { + case ARNG_B: + c.checkindex(p, index, 15) + if o.scond == C_XPOST && offset != 0 && offset != 1 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index >> 3 + S = (index >> 2) & 1 + size = index & 3 + opcode = 0 + case ARNG_H: + c.checkindex(p, index, 7) + if o.scond == C_XPOST && offset != 0 && offset != 2 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index >> 2 + S = (index >> 1) & 1 + size = (index & 1) << 1 + opcode = 2 + case ARNG_S: + c.checkindex(p, index, 3) + if o.scond == C_XPOST && offset != 0 && offset != 4 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index >> 1 + S = index & 1 + size = 0 + opcode = 4 + case ARNG_D: + c.checkindex(p, index, 1) + if o.scond == C_XPOST && offset != 0 && offset != 8 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index + S = 0 + size = 1 + opcode = 4 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + + if o.scond == C_XPOST { + o1 |= 27 << 23 + } else { + o1 |= 26 << 23 + } + + o1 |= (uint32(Q&1) << 30) | (uint32(r&31) << 16) | ((opcode & 7) << 13) | (uint32(S&1) << 12) | (uint32(size&3) << 10) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 97: /* vld1 offset(Rn), vt.[index] */ + at := int((p.To.Reg >> 5) & 15) + rt := int((p.To.Reg) & 31) + rf := int((p.From.Reg) & 31) + r := int(p.From.Index & 31) + index := int(p.To.Index) + offset := int32(c.regoff(&p.From)) + + if o.scond == C_XPOST { + if (p.From.Index != 0) && (offset != 0) { + c.ctxt.Diag("invalid offset: %v", p) + } + if p.From.Index == 0 && offset == 0 { + c.ctxt.Diag("invalid offset: %v", p) + } + } + + if offset != 0 { + r = 31 + } + + Q := 0 + S := 0 + size := 0 + var opcode uint32 + switch at { + case ARNG_B: + c.checkindex(p, index, 15) + if o.scond == C_XPOST && offset != 0 && offset != 1 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index >> 3 + S = (index >> 2) & 1 + size = index & 3 + opcode = 0 + case ARNG_H: + c.checkindex(p, index, 7) + if o.scond == C_XPOST && offset != 0 && offset != 2 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index >> 2 + S = (index >> 1) & 1 + size = (index & 1) << 1 + opcode = 2 + case ARNG_S: + c.checkindex(p, index, 3) + if o.scond == C_XPOST && offset != 0 && offset != 4 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index >> 1 + S = index & 1 + size = 0 + opcode = 4 + case ARNG_D: + c.checkindex(p, index, 1) + if o.scond == C_XPOST && offset != 0 && offset != 8 { + c.ctxt.Diag("invalid offset: %v", p) + } + Q = index + S = 0 + size = 1 + opcode = 4 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + + if o.scond == C_XPOST { + o1 |= 110 << 21 + } else { + o1 |= 106 << 21 + } + + o1 |= (uint32(Q&1) << 30) | (uint32(r&31) << 16) | ((opcode & 7) << 13) | (uint32(S&1) << 12) | (uint32(size&3) << 10) | (uint32(rf&31) << 5) | uint32(rt&31) + + case 98: /* MOVD (Rn)(Rm.SXTW[<, [Vt1., Vt2., ...], Vd. */ + af := int((p.From.Reg >> 5) & 15) + at := int((p.To.Reg >> 5) & 15) + if af != at { + c.ctxt.Diag("invalid arrangement: %v\n", p) + } + var q, len uint32 + switch af { + case ARNG_8B: + q = 0 + case ARNG_16B: + q = 1 + default: + c.ctxt.Diag("invalid arrangement: %v", p) + } + rf := int(p.From.Reg) + rt := int(p.To.Reg) + offset := int(p.GetFrom3().Offset) + opcode := (offset >> 12) & 15 + switch opcode { + case 0x7: + len = 0 // one register + case 0xa: + len = 1 // two register + case 0x6: + len = 2 // three registers + case 0x2: + len = 3 // four registers + default: + c.ctxt.Diag("invalid register numbers in ARM64 register list: %v", p) + } + o1 = q<<30 | 0xe<<24 | len<<13 + o1 |= (uint32(rf&31) << 16) | uint32(offset&31)<<5 | uint32(rt&31) + + case 101: // FOMVQ/FMOVD $vcon, Vd -> load from constant pool. + o1 = c.omovlit(p.As, p, &p.From, int(p.To.Reg)) + + case 102: /* vushll, vushll2, vuxtl, vuxtl2 */ + o1 = c.opirr(p, p.As) + rf := p.Reg + af := uint8((p.Reg >> 5) & 15) + at := uint8((p.To.Reg >> 5) & 15) + shift := int(p.From.Offset) + if p.As == AVUXTL || p.As == AVUXTL2 { + rf = p.From.Reg + af = uint8((p.From.Reg >> 5) & 15) + shift = 0 + } + + pack := func(q, x, y uint8) uint32 { + return uint32(q)<<16 | uint32(x)<<8 | uint32(y) + } + + var Q uint8 = uint8(o1>>30) & 1 + var immh, width uint8 + switch pack(Q, af, at) { + case pack(0, ARNG_8B, ARNG_8H): + immh, width = 1, 8 + case pack(1, ARNG_16B, ARNG_8H): + immh, width = 1, 8 + case pack(0, ARNG_4H, ARNG_4S): + immh, width = 2, 16 + case pack(1, ARNG_8H, ARNG_4S): + immh, width = 2, 16 + case pack(0, ARNG_2S, ARNG_2D): + immh, width = 4, 32 + case pack(1, ARNG_4S, ARNG_2D): + immh, width = 4, 32 + default: + c.ctxt.Diag("operand mismatch: %v\n", p) + } + if !(0 <= shift && shift <= int(width-1)) { + c.ctxt.Diag("shift amount out of range: %v\n", p) + } + o1 |= uint32(immh)<<19 | uint32(shift)<<16 | uint32(rf&31)<<5 | uint32(p.To.Reg&31) + } + out[0] = o1 + out[1] = o2 + out[2] = o3 + out[3] = o4 + out[4] = o5 +} + +/* + * basic Rm op Rn -> Rd (using shifted register with 0) + * also op Rn -> Rt + * also Rm*Rn op Ra -> Rd + * also Vm op Vn -> Vd + */ +func (c *ctxt7) oprrr(p *obj.Prog, a obj.As) uint32 { + switch a { + case AADC: + return S64 | 0<<30 | 0<<29 | 0xd0<<21 | 0<<10 + + case AADCW: + return S32 | 0<<30 | 0<<29 | 0xd0<<21 | 0<<10 + + case AADCS: + return S64 | 0<<30 | 1<<29 | 0xd0<<21 | 0<<10 + + case AADCSW: + return S32 | 0<<30 | 1<<29 | 0xd0<<21 | 0<<10 + + case ANGC, ASBC: + return S64 | 1<<30 | 0<<29 | 0xd0<<21 | 0<<10 + + case ANGCS, ASBCS: + return S64 | 1<<30 | 1<<29 | 0xd0<<21 | 0<<10 + + case ANGCW, ASBCW: + return S32 | 1<<30 | 0<<29 | 0xd0<<21 | 0<<10 + + case ANGCSW, ASBCSW: + return S32 | 1<<30 | 1<<29 | 0xd0<<21 | 0<<10 + + case AADD: + return S64 | 0<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case AADDW: + return S32 | 0<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case ACMN, AADDS: + return S64 | 0<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case ACMNW, AADDSW: + return S32 | 0<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case ASUB: + return S64 | 1<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case ASUBW: + return S32 | 1<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case ACMP, ASUBS: + return S64 | 1<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case ACMPW, ASUBSW: + return S32 | 1<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 0<<21 | 0<<10 + + case AAND: + return S64 | 0<<29 | 0xA<<24 + + case AANDW: + return S32 | 0<<29 | 0xA<<24 + + case AMOVD, AORR: + return S64 | 1<<29 | 0xA<<24 + + // case AMOVW: + case AMOVWU, AORRW: + return S32 | 1<<29 | 0xA<<24 + + case AEOR: + return S64 | 2<<29 | 0xA<<24 + + case AEORW: + return S32 | 2<<29 | 0xA<<24 + + case AANDS, ATST: + return S64 | 3<<29 | 0xA<<24 + + case AANDSW, ATSTW: + return S32 | 3<<29 | 0xA<<24 + + case ABIC: + return S64 | 0<<29 | 0xA<<24 | 1<<21 + + case ABICW: + return S32 | 0<<29 | 0xA<<24 | 1<<21 + + case ABICS: + return S64 | 3<<29 | 0xA<<24 | 1<<21 + + case ABICSW: + return S32 | 3<<29 | 0xA<<24 | 1<<21 + + case AEON: + return S64 | 2<<29 | 0xA<<24 | 1<<21 + + case AEONW: + return S32 | 2<<29 | 0xA<<24 | 1<<21 + + case AMVN, AORN: + return S64 | 1<<29 | 0xA<<24 | 1<<21 + + case AMVNW, AORNW: + return S32 | 1<<29 | 0xA<<24 | 1<<21 + + case AASR: + return S64 | OPDP2(10) /* also ASRV */ + + case AASRW: + return S32 | OPDP2(10) + + case ALSL: + return S64 | OPDP2(8) + + case ALSLW: + return S32 | OPDP2(8) + + case ALSR: + return S64 | OPDP2(9) + + case ALSRW: + return S32 | OPDP2(9) + + case AROR: + return S64 | OPDP2(11) + + case ARORW: + return S32 | OPDP2(11) + + case ACCMN: + return S64 | 0<<30 | 1<<29 | 0xD2<<21 | 0<<11 | 0<<10 | 0<<4 /* cond<<12 | nzcv<<0 */ + + case ACCMNW: + return S32 | 0<<30 | 1<<29 | 0xD2<<21 | 0<<11 | 0<<10 | 0<<4 + + case ACCMP: + return S64 | 1<<30 | 1<<29 | 0xD2<<21 | 0<<11 | 0<<10 | 0<<4 /* imm5<<16 | cond<<12 | nzcv<<0 */ + + case ACCMPW: + return S32 | 1<<30 | 1<<29 | 0xD2<<21 | 0<<11 | 0<<10 | 0<<4 + + case ACRC32B: + return S32 | OPDP2(16) + + case ACRC32H: + return S32 | OPDP2(17) + + case ACRC32W: + return S32 | OPDP2(18) + + case ACRC32X: + return S64 | OPDP2(19) + + case ACRC32CB: + return S32 | OPDP2(20) + + case ACRC32CH: + return S32 | OPDP2(21) + + case ACRC32CW: + return S32 | OPDP2(22) + + case ACRC32CX: + return S64 | OPDP2(23) + + case ACSEL: + return S64 | 0<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 0<<10 + + case ACSELW: + return S32 | 0<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 0<<10 + + case ACSET: + return S64 | 0<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 1<<10 + + case ACSETW: + return S32 | 0<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 1<<10 + + case ACSETM: + return S64 | 1<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 0<<10 + + case ACSETMW: + return S32 | 1<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 0<<10 + + case ACINC, ACSINC: + return S64 | 0<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 1<<10 + + case ACINCW, ACSINCW: + return S32 | 0<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 1<<10 + + case ACINV, ACSINV: + return S64 | 1<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 0<<10 + + case ACINVW, ACSINVW: + return S32 | 1<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 0<<10 + + case ACNEG, ACSNEG: + return S64 | 1<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 1<<10 + + case ACNEGW, ACSNEGW: + return S32 | 1<<30 | 0<<29 | 0xD4<<21 | 0<<11 | 1<<10 + + case AMUL, AMADD: + return S64 | 0<<29 | 0x1B<<24 | 0<<21 | 0<<15 + + case AMULW, AMADDW: + return S32 | 0<<29 | 0x1B<<24 | 0<<21 | 0<<15 + + case AMNEG, AMSUB: + return S64 | 0<<29 | 0x1B<<24 | 0<<21 | 1<<15 + + case AMNEGW, AMSUBW: + return S32 | 0<<29 | 0x1B<<24 | 0<<21 | 1<<15 + + case AMRS: + return SYSOP(1, 2, 0, 0, 0, 0, 0) + + case AMSR: + return SYSOP(0, 2, 0, 0, 0, 0, 0) + + case ANEG: + return S64 | 1<<30 | 0<<29 | 0xB<<24 | 0<<21 + + case ANEGW: + return S32 | 1<<30 | 0<<29 | 0xB<<24 | 0<<21 + + case ANEGS: + return S64 | 1<<30 | 1<<29 | 0xB<<24 | 0<<21 + + case ANEGSW: + return S32 | 1<<30 | 1<<29 | 0xB<<24 | 0<<21 + + case AREM, ASDIV: + return S64 | OPDP2(3) + + case AREMW, ASDIVW: + return S32 | OPDP2(3) + + case ASMULL, ASMADDL: + return OPDP3(1, 0, 1, 0) + + case ASMNEGL, ASMSUBL: + return OPDP3(1, 0, 1, 1) + + case ASMULH: + return OPDP3(1, 0, 2, 0) + + case AUMULL, AUMADDL: + return OPDP3(1, 0, 5, 0) + + case AUMNEGL, AUMSUBL: + return OPDP3(1, 0, 5, 1) + + case AUMULH: + return OPDP3(1, 0, 6, 0) + + case AUREM, AUDIV: + return S64 | OPDP2(2) + + case AUREMW, AUDIVW: + return S32 | OPDP2(2) + + case AAESE: + return 0x4E<<24 | 2<<20 | 8<<16 | 4<<12 | 2<<10 + + case AAESD: + return 0x4E<<24 | 2<<20 | 8<<16 | 5<<12 | 2<<10 + + case AAESMC: + return 0x4E<<24 | 2<<20 | 8<<16 | 6<<12 | 2<<10 + + case AAESIMC: + return 0x4E<<24 | 2<<20 | 8<<16 | 7<<12 | 2<<10 + + case ASHA1C: + return 0x5E<<24 | 0<<12 + + case ASHA1P: + return 0x5E<<24 | 1<<12 + + case ASHA1M: + return 0x5E<<24 | 2<<12 + + case ASHA1SU0: + return 0x5E<<24 | 3<<12 + + case ASHA256H: + return 0x5E<<24 | 4<<12 + + case ASHA256H2: + return 0x5E<<24 | 5<<12 + + case ASHA256SU1: + return 0x5E<<24 | 6<<12 + + case ASHA1H: + return 0x5E<<24 | 2<<20 | 8<<16 | 0<<12 | 2<<10 + + case ASHA1SU1: + return 0x5E<<24 | 2<<20 | 8<<16 | 1<<12 | 2<<10 + + case ASHA256SU0: + return 0x5E<<24 | 2<<20 | 8<<16 | 2<<12 | 2<<10 + + case ASHA512H: + return 0xCE<<24 | 3<<21 | 8<<12 + + case ASHA512H2: + return 0xCE<<24 | 3<<21 | 8<<12 | 4<<8 + + case ASHA512SU1: + return 0xCE<<24 | 3<<21 | 8<<12 | 8<<8 + + case ASHA512SU0: + return 0xCE<<24 | 3<<22 | 8<<12 + + case AFCVTZSD: + return FPCVTI(1, 0, 1, 3, 0) + + case AFCVTZSDW: + return FPCVTI(0, 0, 1, 3, 0) + + case AFCVTZSS: + return FPCVTI(1, 0, 0, 3, 0) + + case AFCVTZSSW: + return FPCVTI(0, 0, 0, 3, 0) + + case AFCVTZUD: + return FPCVTI(1, 0, 1, 3, 1) + + case AFCVTZUDW: + return FPCVTI(0, 0, 1, 3, 1) + + case AFCVTZUS: + return FPCVTI(1, 0, 0, 3, 1) + + case AFCVTZUSW: + return FPCVTI(0, 0, 0, 3, 1) + + case ASCVTFD: + return FPCVTI(1, 0, 1, 0, 2) + + case ASCVTFS: + return FPCVTI(1, 0, 0, 0, 2) + + case ASCVTFWD: + return FPCVTI(0, 0, 1, 0, 2) + + case ASCVTFWS: + return FPCVTI(0, 0, 0, 0, 2) + + case AUCVTFD: + return FPCVTI(1, 0, 1, 0, 3) + + case AUCVTFS: + return FPCVTI(1, 0, 0, 0, 3) + + case AUCVTFWD: + return FPCVTI(0, 0, 1, 0, 3) + + case AUCVTFWS: + return FPCVTI(0, 0, 0, 0, 3) + + case AFADDS: + return FPOP2S(0, 0, 0, 2) + + case AFADDD: + return FPOP2S(0, 0, 1, 2) + + case AFSUBS: + return FPOP2S(0, 0, 0, 3) + + case AFSUBD: + return FPOP2S(0, 0, 1, 3) + + case AFMADDD: + return FPOP3S(0, 0, 1, 0, 0) + + case AFMADDS: + return FPOP3S(0, 0, 0, 0, 0) + + case AFMSUBD: + return FPOP3S(0, 0, 1, 0, 1) + + case AFMSUBS: + return FPOP3S(0, 0, 0, 0, 1) + + case AFNMADDD: + return FPOP3S(0, 0, 1, 1, 0) + + case AFNMADDS: + return FPOP3S(0, 0, 0, 1, 0) + + case AFNMSUBD: + return FPOP3S(0, 0, 1, 1, 1) + + case AFNMSUBS: + return FPOP3S(0, 0, 0, 1, 1) + + case AFMULS: + return FPOP2S(0, 0, 0, 0) + + case AFMULD: + return FPOP2S(0, 0, 1, 0) + + case AFDIVS: + return FPOP2S(0, 0, 0, 1) + + case AFDIVD: + return FPOP2S(0, 0, 1, 1) + + case AFMAXS: + return FPOP2S(0, 0, 0, 4) + + case AFMINS: + return FPOP2S(0, 0, 0, 5) + + case AFMAXD: + return FPOP2S(0, 0, 1, 4) + + case AFMIND: + return FPOP2S(0, 0, 1, 5) + + case AFMAXNMS: + return FPOP2S(0, 0, 0, 6) + + case AFMAXNMD: + return FPOP2S(0, 0, 1, 6) + + case AFMINNMS: + return FPOP2S(0, 0, 0, 7) + + case AFMINNMD: + return FPOP2S(0, 0, 1, 7) + + case AFNMULS: + return FPOP2S(0, 0, 0, 8) + + case AFNMULD: + return FPOP2S(0, 0, 1, 8) + + case AFCMPS: + return FPCMP(0, 0, 0, 0, 0) + + case AFCMPD: + return FPCMP(0, 0, 1, 0, 0) + + case AFCMPES: + return FPCMP(0, 0, 0, 0, 16) + + case AFCMPED: + return FPCMP(0, 0, 1, 0, 16) + + case AFCCMPS: + return FPCCMP(0, 0, 0, 0) + + case AFCCMPD: + return FPCCMP(0, 0, 1, 0) + + case AFCCMPES: + return FPCCMP(0, 0, 0, 1) + + case AFCCMPED: + return FPCCMP(0, 0, 1, 1) + + case AFCSELS: + return 0x1E<<24 | 0<<22 | 1<<21 | 3<<10 + + case AFCSELD: + return 0x1E<<24 | 1<<22 | 1<<21 | 3<<10 + + case AFMOVS: + return FPOP1S(0, 0, 0, 0) + + case AFABSS: + return FPOP1S(0, 0, 0, 1) + + case AFNEGS: + return FPOP1S(0, 0, 0, 2) + + case AFSQRTS: + return FPOP1S(0, 0, 0, 3) + + case AFCVTSD: + return FPOP1S(0, 0, 0, 5) + + case AFCVTSH: + return FPOP1S(0, 0, 0, 7) + + case AFRINTNS: + return FPOP1S(0, 0, 0, 8) + + case AFRINTPS: + return FPOP1S(0, 0, 0, 9) + + case AFRINTMS: + return FPOP1S(0, 0, 0, 10) + + case AFRINTZS: + return FPOP1S(0, 0, 0, 11) + + case AFRINTAS: + return FPOP1S(0, 0, 0, 12) + + case AFRINTXS: + return FPOP1S(0, 0, 0, 14) + + case AFRINTIS: + return FPOP1S(0, 0, 0, 15) + + case AFMOVD: + return FPOP1S(0, 0, 1, 0) + + case AFABSD: + return FPOP1S(0, 0, 1, 1) + + case AFNEGD: + return FPOP1S(0, 0, 1, 2) + + case AFSQRTD: + return FPOP1S(0, 0, 1, 3) + + case AFCVTDS: + return FPOP1S(0, 0, 1, 4) + + case AFCVTDH: + return FPOP1S(0, 0, 1, 7) + + case AFRINTND: + return FPOP1S(0, 0, 1, 8) + + case AFRINTPD: + return FPOP1S(0, 0, 1, 9) + + case AFRINTMD: + return FPOP1S(0, 0, 1, 10) + + case AFRINTZD: + return FPOP1S(0, 0, 1, 11) + + case AFRINTAD: + return FPOP1S(0, 0, 1, 12) + + case AFRINTXD: + return FPOP1S(0, 0, 1, 14) + + case AFRINTID: + return FPOP1S(0, 0, 1, 15) + + case AFCVTHS: + return FPOP1S(0, 0, 3, 4) + + case AFCVTHD: + return FPOP1S(0, 0, 3, 5) + + case AVADD: + return 7<<25 | 1<<21 | 1<<15 | 1<<10 + + case AVSUB: + return 0x17<<25 | 1<<21 | 1<<15 | 1<<10 + + case AVADDP: + return 7<<25 | 1<<21 | 1<<15 | 15<<10 + + case AVAND: + return 7<<25 | 1<<21 | 7<<10 + + case AVCMEQ: + return 1<<29 | 0x71<<21 | 0x23<<10 + + case AVCNT: + return 0xE<<24 | 0x10<<17 | 5<<12 | 2<<10 + + case AVZIP1: + return 0xE<<24 | 3<<12 | 2<<10 + + case AVZIP2: + return 0xE<<24 | 1<<14 | 3<<12 | 2<<10 + + case AVEOR: + return 1<<29 | 0x71<<21 | 7<<10 + + case AVORR: + return 7<<25 | 5<<21 | 7<<10 + + case AVREV16: + return 3<<26 | 2<<24 | 1<<21 | 3<<11 + + case AVREV32: + return 11<<26 | 2<<24 | 1<<21 | 1<<11 + + case AVREV64: + return 3<<26 | 2<<24 | 1<<21 | 1<<11 + + case AVMOV: + return 7<<25 | 5<<21 | 7<<10 + + case AVADDV: + return 7<<25 | 3<<20 | 3<<15 | 7<<11 + + case AVUADDLV: + return 1<<29 | 7<<25 | 3<<20 | 7<<11 + + case AVFMLA: + return 7<<25 | 0<<23 | 1<<21 | 3<<14 | 3<<10 + + case AVFMLS: + return 7<<25 | 1<<23 | 1<<21 | 3<<14 | 3<<10 + + case AVPMULL, AVPMULL2: + return 0xE<<24 | 1<<21 | 0x38<<10 + + case AVRBIT: + return 0x2E<<24 | 1<<22 | 0x10<<17 | 5<<12 | 2<<10 + + case AVLD1, AVLD2, AVLD3, AVLD4: + return 3<<26 | 1<<22 + + case AVLD1R, AVLD3R: + return 0xD<<24 | 1<<22 + + case AVLD2R, AVLD4R: + return 0xD<<24 | 3<<21 + + case AVBIF: + return 1<<29 | 7<<25 | 7<<21 | 7<<10 + + case AVBIT: + return 1<<29 | 0x75<<21 | 7<<10 + + case AVBSL: + return 1<<29 | 0x73<<21 | 7<<10 + + case AVCMTST: + return 0xE<<24 | 1<<21 | 0x23<<10 + + case AVUZP1: + return 7<<25 | 3<<11 + + case AVUZP2: + return 7<<25 | 1<<14 | 3<<11 + } + + c.ctxt.Diag("%v: bad rrr %d %v", p, a, a) + return 0 +} + +/* + * imm -> Rd + * imm op Rn -> Rd + */ +func (c *ctxt7) opirr(p *obj.Prog, a obj.As) uint32 { + switch a { + /* op $addcon, Rn, Rd */ + case AMOVD, AADD: + return S64 | 0<<30 | 0<<29 | 0x11<<24 + + case ACMN, AADDS: + return S64 | 0<<30 | 1<<29 | 0x11<<24 + + case AMOVW, AADDW: + return S32 | 0<<30 | 0<<29 | 0x11<<24 + + case ACMNW, AADDSW: + return S32 | 0<<30 | 1<<29 | 0x11<<24 + + case ASUB: + return S64 | 1<<30 | 0<<29 | 0x11<<24 + + case ACMP, ASUBS: + return S64 | 1<<30 | 1<<29 | 0x11<<24 + + case ASUBW: + return S32 | 1<<30 | 0<<29 | 0x11<<24 + + case ACMPW, ASUBSW: + return S32 | 1<<30 | 1<<29 | 0x11<<24 + + /* op $imm(SB), Rd; op label, Rd */ + case AADR: + return 0<<31 | 0x10<<24 + + case AADRP: + return 1<<31 | 0x10<<24 + + /* op $bimm, Rn, Rd */ + case AAND, ABIC: + return S64 | 0<<29 | 0x24<<23 + + case AANDW, ABICW: + return S32 | 0<<29 | 0x24<<23 | 0<<22 + + case AORR, AORN: + return S64 | 1<<29 | 0x24<<23 + + case AORRW, AORNW: + return S32 | 1<<29 | 0x24<<23 | 0<<22 + + case AEOR, AEON: + return S64 | 2<<29 | 0x24<<23 + + case AEORW, AEONW: + return S32 | 2<<29 | 0x24<<23 | 0<<22 + + case AANDS, ABICS, ATST: + return S64 | 3<<29 | 0x24<<23 + + case AANDSW, ABICSW, ATSTW: + return S32 | 3<<29 | 0x24<<23 | 0<<22 + + case AASR: + return S64 | 0<<29 | 0x26<<23 /* alias of SBFM */ + + case AASRW: + return S32 | 0<<29 | 0x26<<23 | 0<<22 + + /* op $width, $lsb, Rn, Rd */ + case ABFI: + return S64 | 2<<29 | 0x26<<23 | 1<<22 + /* alias of BFM */ + + case ABFIW: + return S32 | 2<<29 | 0x26<<23 | 0<<22 + + /* op $imms, $immr, Rn, Rd */ + case ABFM: + return S64 | 1<<29 | 0x26<<23 | 1<<22 + + case ABFMW: + return S32 | 1<<29 | 0x26<<23 | 0<<22 + + case ASBFM: + return S64 | 0<<29 | 0x26<<23 | 1<<22 + + case ASBFMW: + return S32 | 0<<29 | 0x26<<23 | 0<<22 + + case AUBFM: + return S64 | 2<<29 | 0x26<<23 | 1<<22 + + case AUBFMW: + return S32 | 2<<29 | 0x26<<23 | 0<<22 + + case ABFXIL: + return S64 | 1<<29 | 0x26<<23 | 1<<22 /* alias of BFM */ + + case ABFXILW: + return S32 | 1<<29 | 0x26<<23 | 0<<22 + + case AEXTR: + return S64 | 0<<29 | 0x27<<23 | 1<<22 | 0<<21 + + case AEXTRW: + return S32 | 0<<29 | 0x27<<23 | 0<<22 | 0<<21 + + case ACBNZ: + return S64 | 0x1A<<25 | 1<<24 + + case ACBNZW: + return S32 | 0x1A<<25 | 1<<24 + + case ACBZ: + return S64 | 0x1A<<25 | 0<<24 + + case ACBZW: + return S32 | 0x1A<<25 | 0<<24 + + case ACCMN: + return S64 | 0<<30 | 1<<29 | 0xD2<<21 | 1<<11 | 0<<10 | 0<<4 /* imm5<<16 | cond<<12 | nzcv<<0 */ + + case ACCMNW: + return S32 | 0<<30 | 1<<29 | 0xD2<<21 | 1<<11 | 0<<10 | 0<<4 + + case ACCMP: + return S64 | 1<<30 | 1<<29 | 0xD2<<21 | 1<<11 | 0<<10 | 0<<4 /* imm5<<16 | cond<<12 | nzcv<<0 */ + + case ACCMPW: + return S32 | 1<<30 | 1<<29 | 0xD2<<21 | 1<<11 | 0<<10 | 0<<4 + + case AMOVK: + return S64 | 3<<29 | 0x25<<23 + + case AMOVKW: + return S32 | 3<<29 | 0x25<<23 + + case AMOVN: + return S64 | 0<<29 | 0x25<<23 + + case AMOVNW: + return S32 | 0<<29 | 0x25<<23 + + case AMOVZ: + return S64 | 2<<29 | 0x25<<23 + + case AMOVZW: + return S32 | 2<<29 | 0x25<<23 + + case AMSR: + return SYSOP(0, 0, 0, 4, 0, 0, 0x1F) /* MSR (immediate) */ + + case AAT, + ADC, + AIC, + ATLBI, + ASYS: + return SYSOP(0, 1, 0, 0, 0, 0, 0) + + case ASYSL: + return SYSOP(1, 1, 0, 0, 0, 0, 0) + + case ATBZ: + return 0x36 << 24 + + case ATBNZ: + return 0x37 << 24 + + case ADSB: + return SYSOP(0, 0, 3, 3, 0, 4, 0x1F) + + case ADMB: + return SYSOP(0, 0, 3, 3, 0, 5, 0x1F) + + case AISB: + return SYSOP(0, 0, 3, 3, 0, 6, 0x1F) + + case AHINT: + return SYSOP(0, 0, 3, 2, 0, 0, 0x1F) + + case AVEXT: + return 0x2E<<24 | 0<<23 | 0<<21 | 0<<15 + + case AVUSHR: + return 0x5E<<23 | 1<<10 + + case AVSHL: + return 0x1E<<23 | 21<<10 + + case AVSRI: + return 0x5E<<23 | 17<<10 + + case AVUSHLL, AVUXTL: + return 1<<29 | 15<<24 | 0x29<<10 + + case AVUSHLL2, AVUXTL2: + return 3<<29 | 15<<24 | 0x29<<10 + } + + c.ctxt.Diag("%v: bad irr %v", p, a) + return 0 +} + +func (c *ctxt7) opbit(p *obj.Prog, a obj.As) uint32 { + switch a { + case ACLS: + return S64 | OPBIT(5) + + case ACLSW: + return S32 | OPBIT(5) + + case ACLZ: + return S64 | OPBIT(4) + + case ACLZW: + return S32 | OPBIT(4) + + case ARBIT: + return S64 | OPBIT(0) + + case ARBITW: + return S32 | OPBIT(0) + + case AREV: + return S64 | OPBIT(3) + + case AREVW: + return S32 | OPBIT(2) + + case AREV16: + return S64 | OPBIT(1) + + case AREV16W: + return S32 | OPBIT(1) + + case AREV32: + return S64 | OPBIT(2) + + default: + c.ctxt.Diag("bad bit op\n%v", p) + return 0 + } +} + +/* + * add/subtract sign or zero-extended register + */ +func (c *ctxt7) opxrrr(p *obj.Prog, a obj.As, extend bool) uint32 { + extension := uint32(0) + if !extend { + switch a { + case AADD, ACMN, AADDS, ASUB, ACMP, ASUBS: + extension = LSL0_64 + + case AADDW, ACMNW, AADDSW, ASUBW, ACMPW, ASUBSW: + extension = LSL0_32 + } + } + + switch a { + case AADD: + return S64 | 0<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + + case AADDW: + return S32 | 0<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + + case ACMN, AADDS: + return S64 | 0<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + + case ACMNW, AADDSW: + return S32 | 0<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + + case ASUB: + return S64 | 1<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + + case ASUBW: + return S32 | 1<<30 | 0<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + + case ACMP, ASUBS: + return S64 | 1<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + + case ACMPW, ASUBSW: + return S32 | 1<<30 | 1<<29 | 0x0b<<24 | 0<<22 | 1<<21 | extension + } + + c.ctxt.Diag("bad opxrrr %v\n%v", a, p) + return 0 +} + +func (c *ctxt7) opimm(p *obj.Prog, a obj.As) uint32 { + switch a { + case ASVC: + return 0xD4<<24 | 0<<21 | 1 /* imm16<<5 */ + + case AHVC: + return 0xD4<<24 | 0<<21 | 2 + + case ASMC: + return 0xD4<<24 | 0<<21 | 3 + + case ABRK: + return 0xD4<<24 | 1<<21 | 0 + + case AHLT: + return 0xD4<<24 | 2<<21 | 0 + + case ADCPS1: + return 0xD4<<24 | 5<<21 | 1 + + case ADCPS2: + return 0xD4<<24 | 5<<21 | 2 + + case ADCPS3: + return 0xD4<<24 | 5<<21 | 3 + + case ACLREX: + return SYSOP(0, 0, 3, 3, 0, 2, 0x1F) + } + + c.ctxt.Diag("%v: bad imm %v", p, a) + return 0 +} + +func (c *ctxt7) brdist(p *obj.Prog, preshift int, flen int, shift int) int64 { + v := int64(0) + t := int64(0) + q := p.To.Target() + if q == nil { + // TODO: don't use brdist for this case, as it isn't a branch. + // (Calls from omovlit, and maybe adr/adrp opcodes as well.) + q = p.Pool + } + if q != nil { + v = (q.Pc >> uint(preshift)) - (c.pc >> uint(preshift)) + if (v & ((1 << uint(shift)) - 1)) != 0 { + c.ctxt.Diag("misaligned label\n%v", p) + } + v >>= uint(shift) + t = int64(1) << uint(flen-1) + if v < -t || v >= t { + c.ctxt.Diag("branch too far %#x vs %#x [%p]\n%v\n%v", v, t, c.blitrl, p, q) + panic("branch too far") + } + } + + return v & ((t << 1) - 1) +} + +/* + * pc-relative branches + */ +func (c *ctxt7) opbra(p *obj.Prog, a obj.As) uint32 { + switch a { + case ABEQ: + return OPBcc(0x0) + + case ABNE: + return OPBcc(0x1) + + case ABCS: + return OPBcc(0x2) + + case ABHS: + return OPBcc(0x2) + + case ABCC: + return OPBcc(0x3) + + case ABLO: + return OPBcc(0x3) + + case ABMI: + return OPBcc(0x4) + + case ABPL: + return OPBcc(0x5) + + case ABVS: + return OPBcc(0x6) + + case ABVC: + return OPBcc(0x7) + + case ABHI: + return OPBcc(0x8) + + case ABLS: + return OPBcc(0x9) + + case ABGE: + return OPBcc(0xa) + + case ABLT: + return OPBcc(0xb) + + case ABGT: + return OPBcc(0xc) + + case ABLE: + return OPBcc(0xd) /* imm19<<5 | cond */ + + case AB: + return 0<<31 | 5<<26 /* imm26 */ + + case obj.ADUFFZERO, obj.ADUFFCOPY, ABL: + return 1<<31 | 5<<26 + } + + c.ctxt.Diag("%v: bad bra %v", p, a) + return 0 +} + +func (c *ctxt7) opbrr(p *obj.Prog, a obj.As) uint32 { + switch a { + case ABL: + return OPBLR(1) /* BLR */ + + case AB: + return OPBLR(0) /* BR */ + + case obj.ARET: + return OPBLR(2) /* RET */ + } + + c.ctxt.Diag("%v: bad brr %v", p, a) + return 0 +} + +func (c *ctxt7) op0(p *obj.Prog, a obj.As) uint32 { + switch a { + case ADRPS: + return 0x6B<<25 | 5<<21 | 0x1F<<16 | 0x1F<<5 + + case AERET: + return 0x6B<<25 | 4<<21 | 0x1F<<16 | 0<<10 | 0x1F<<5 + + case ANOOP: + return SYSHINT(0) + + case AYIELD: + return SYSHINT(1) + + case AWFE: + return SYSHINT(2) + + case AWFI: + return SYSHINT(3) + + case ASEV: + return SYSHINT(4) + + case ASEVL: + return SYSHINT(5) + } + + c.ctxt.Diag("%v: bad op0 %v", p, a) + return 0 +} + +/* + * register offset + */ +func (c *ctxt7) opload(p *obj.Prog, a obj.As) uint32 { + switch a { + case ALDAR: + return LDSTX(3, 1, 1, 0, 1) | 0x1F<<10 + + case ALDARW: + return LDSTX(2, 1, 1, 0, 1) | 0x1F<<10 + + case ALDARB: + return LDSTX(0, 1, 1, 0, 1) | 0x1F<<10 + + case ALDARH: + return LDSTX(1, 1, 1, 0, 1) | 0x1F<<10 + + case ALDAXP: + return LDSTX(3, 0, 1, 1, 1) + + case ALDAXPW: + return LDSTX(2, 0, 1, 1, 1) + + case ALDAXR: + return LDSTX(3, 0, 1, 0, 1) | 0x1F<<10 + + case ALDAXRW: + return LDSTX(2, 0, 1, 0, 1) | 0x1F<<10 + + case ALDAXRB: + return LDSTX(0, 0, 1, 0, 1) | 0x1F<<10 + + case ALDAXRH: + return LDSTX(1, 0, 1, 0, 1) | 0x1F<<10 + + case ALDXR: + return LDSTX(3, 0, 1, 0, 0) | 0x1F<<10 + + case ALDXRB: + return LDSTX(0, 0, 1, 0, 0) | 0x1F<<10 + + case ALDXRH: + return LDSTX(1, 0, 1, 0, 0) | 0x1F<<10 + + case ALDXRW: + return LDSTX(2, 0, 1, 0, 0) | 0x1F<<10 + + case ALDXP: + return LDSTX(3, 0, 1, 1, 0) + + case ALDXPW: + return LDSTX(2, 0, 1, 1, 0) + + case AMOVNP: + return S64 | 0<<30 | 5<<27 | 0<<26 | 0<<23 | 1<<22 + + case AMOVNPW: + return S32 | 0<<30 | 5<<27 | 0<<26 | 0<<23 | 1<<22 + } + + c.ctxt.Diag("bad opload %v\n%v", a, p) + return 0 +} + +func (c *ctxt7) opstore(p *obj.Prog, a obj.As) uint32 { + switch a { + case ASTLR: + return LDSTX(3, 1, 0, 0, 1) | 0x1F<<10 + + case ASTLRB: + return LDSTX(0, 1, 0, 0, 1) | 0x1F<<10 + + case ASTLRH: + return LDSTX(1, 1, 0, 0, 1) | 0x1F<<10 + + case ASTLP: + return LDSTX(3, 0, 0, 1, 1) + + case ASTLPW: + return LDSTX(2, 0, 0, 1, 1) + + case ASTLRW: + return LDSTX(2, 1, 0, 0, 1) | 0x1F<<10 + + case ASTLXP: + return LDSTX(3, 0, 0, 1, 1) + + case ASTLXPW: + return LDSTX(2, 0, 0, 1, 1) + + case ASTLXR: + return LDSTX(3, 0, 0, 0, 1) | 0x1F<<10 + + case ASTLXRB: + return LDSTX(0, 0, 0, 0, 1) | 0x1F<<10 + + case ASTLXRH: + return LDSTX(1, 0, 0, 0, 1) | 0x1F<<10 + + case ASTLXRW: + return LDSTX(2, 0, 0, 0, 1) | 0x1F<<10 + + case ASTXR: + return LDSTX(3, 0, 0, 0, 0) | 0x1F<<10 + + case ASTXRB: + return LDSTX(0, 0, 0, 0, 0) | 0x1F<<10 + + case ASTXRH: + return LDSTX(1, 0, 0, 0, 0) | 0x1F<<10 + + case ASTXP: + return LDSTX(3, 0, 0, 1, 0) + + case ASTXPW: + return LDSTX(2, 0, 0, 1, 0) + + case ASTXRW: + return LDSTX(2, 0, 0, 0, 0) | 0x1F<<10 + + case AMOVNP: + return S64 | 0<<30 | 5<<27 | 0<<26 | 0<<23 | 1<<22 + + case AMOVNPW: + return S32 | 0<<30 | 5<<27 | 0<<26 | 0<<23 | 1<<22 + } + + c.ctxt.Diag("bad opstore %v\n%v", a, p) + return 0 +} + +/* + * load/store register (unsigned immediate) C3.3.13 + * these produce 64-bit values (when there's an option) + */ +func (c *ctxt7) olsr12u(p *obj.Prog, o int32, v int32, b int, r int) uint32 { + if v < 0 || v >= (1<<12) { + c.ctxt.Diag("offset out of range: %d\n%v", v, p) + } + o |= (v & 0xFFF) << 10 + o |= int32(b&31) << 5 + o |= int32(r & 31) + return uint32(o) +} + +func (c *ctxt7) opldr12(p *obj.Prog, a obj.As) uint32 { + switch a { + case AMOVD: + return LDSTR12U(3, 0, 1) /* imm12<<10 | Rn<<5 | Rt */ + + case AMOVW: + return LDSTR12U(2, 0, 2) + + case AMOVWU: + return LDSTR12U(2, 0, 1) + + case AMOVH: + return LDSTR12U(1, 0, 2) + + case AMOVHU: + return LDSTR12U(1, 0, 1) + + case AMOVB: + return LDSTR12U(0, 0, 2) + + case AMOVBU: + return LDSTR12U(0, 0, 1) + + case AFMOVS: + return LDSTR12U(2, 1, 1) + + case AFMOVD: + return LDSTR12U(3, 1, 1) + } + + c.ctxt.Diag("bad opldr12 %v\n%v", a, p) + return 0 +} + +func (c *ctxt7) opstr12(p *obj.Prog, a obj.As) uint32 { + return LD2STR(c.opldr12(p, a)) +} + +/* + * load/store register (unscaled immediate) C3.3.12 + */ +func (c *ctxt7) olsr9s(p *obj.Prog, o int32, v int32, b int, r int) uint32 { + if v < -256 || v > 255 { + c.ctxt.Diag("offset out of range: %d\n%v", v, p) + } + o |= (v & 0x1FF) << 12 + o |= int32(b&31) << 5 + o |= int32(r & 31) + return uint32(o) +} + +func (c *ctxt7) opldr9(p *obj.Prog, a obj.As) uint32 { + switch a { + case AMOVD: + return LDSTR9S(3, 0, 1) /* simm9<<12 | Rn<<5 | Rt */ + + case AMOVW: + return LDSTR9S(2, 0, 2) + + case AMOVWU: + return LDSTR9S(2, 0, 1) + + case AMOVH: + return LDSTR9S(1, 0, 2) + + case AMOVHU: + return LDSTR9S(1, 0, 1) + + case AMOVB: + return LDSTR9S(0, 0, 2) + + case AMOVBU: + return LDSTR9S(0, 0, 1) + + case AFMOVS: + return LDSTR9S(2, 1, 1) + + case AFMOVD: + return LDSTR9S(3, 1, 1) + } + + c.ctxt.Diag("bad opldr9 %v\n%v", a, p) + return 0 +} + +func (c *ctxt7) opstr9(p *obj.Prog, a obj.As) uint32 { + return LD2STR(c.opldr9(p, a)) +} + +func (c *ctxt7) opldrpp(p *obj.Prog, a obj.As) uint32 { + switch a { + case AMOVD: + return 3<<30 | 7<<27 | 0<<26 | 0<<24 | 1<<22 /* simm9<<12 | Rn<<5 | Rt */ + + case AMOVW: + return 2<<30 | 7<<27 | 0<<26 | 0<<24 | 2<<22 + + case AMOVWU: + return 2<<30 | 7<<27 | 0<<26 | 0<<24 | 1<<22 + + case AMOVH: + return 1<<30 | 7<<27 | 0<<26 | 0<<24 | 2<<22 + + case AMOVHU: + return 1<<30 | 7<<27 | 0<<26 | 0<<24 | 1<<22 + + case AMOVB: + return 0<<30 | 7<<27 | 0<<26 | 0<<24 | 2<<22 + + case AMOVBU: + return 0<<30 | 7<<27 | 0<<26 | 0<<24 | 1<<22 + + case AFMOVS: + return 2<<30 | 7<<27 | 1<<26 | 0<<24 | 1<<22 + + case AFMOVD: + return 3<<30 | 7<<27 | 1<<26 | 0<<24 | 1<<22 + + case APRFM: + return 0xf9<<24 | 2<<22 + + } + + c.ctxt.Diag("bad opldr %v\n%v", a, p) + return 0 +} + +// olsxrr attaches register operands to a load/store opcode supplied in o. +// The result either encodes a load of r from (r1+r2) or a store of r to (r1+r2). +func (c *ctxt7) olsxrr(p *obj.Prog, o int32, r int, r1 int, r2 int) uint32 { + o |= int32(r1&31) << 5 + o |= int32(r2&31) << 16 + o |= int32(r & 31) + return uint32(o) +} + +// opldrr returns the ARM64 opcode encoding corresponding to the obj.As opcode +// for load instruction with register offset. +// The offset register can be (Rn)(Rm.UXTW<<2) or (Rn)(Rm<<2) or (Rn)(Rm). +func (c *ctxt7) opldrr(p *obj.Prog, a obj.As, extension bool) uint32 { + OptionS := uint32(0x1a) + if extension { + OptionS = uint32(0) // option value and S value have been encoded into p.From.Offset. + } + switch a { + case AMOVD: + return OptionS<<10 | 0x3<<21 | 0x1f<<27 + case AMOVW: + return OptionS<<10 | 0x5<<21 | 0x17<<27 + case AMOVWU: + return OptionS<<10 | 0x3<<21 | 0x17<<27 + case AMOVH: + return OptionS<<10 | 0x5<<21 | 0x0f<<27 + case AMOVHU: + return OptionS<<10 | 0x3<<21 | 0x0f<<27 + case AMOVB: + return OptionS<<10 | 0x5<<21 | 0x07<<27 + case AMOVBU: + return OptionS<<10 | 0x3<<21 | 0x07<<27 + case AFMOVS: + return OptionS<<10 | 0x3<<21 | 0x17<<27 | 1<<26 + case AFMOVD: + return OptionS<<10 | 0x3<<21 | 0x1f<<27 | 1<<26 + } + c.ctxt.Diag("bad opldrr %v\n%v", a, p) + return 0 +} + +// opstrr returns the ARM64 opcode encoding corresponding to the obj.As opcode +// for store instruction with register offset. +// The offset register can be (Rn)(Rm.UXTW<<2) or (Rn)(Rm<<2) or (Rn)(Rm). +func (c *ctxt7) opstrr(p *obj.Prog, a obj.As, extension bool) uint32 { + OptionS := uint32(0x1a) + if extension { + OptionS = uint32(0) // option value and S value have been encoded into p.To.Offset. + } + switch a { + case AMOVD: + return OptionS<<10 | 0x1<<21 | 0x1f<<27 + case AMOVW, AMOVWU: + return OptionS<<10 | 0x1<<21 | 0x17<<27 + case AMOVH, AMOVHU: + return OptionS<<10 | 0x1<<21 | 0x0f<<27 + case AMOVB, AMOVBU: + return OptionS<<10 | 0x1<<21 | 0x07<<27 + case AFMOVS: + return OptionS<<10 | 0x1<<21 | 0x17<<27 | 1<<26 + case AFMOVD: + return OptionS<<10 | 0x1<<21 | 0x1f<<27 | 1<<26 + } + c.ctxt.Diag("bad opstrr %v\n%v", a, p) + return 0 +} + +func (c *ctxt7) oaddi(p *obj.Prog, o1 int32, v int32, r int, rt int) uint32 { + if (v & 0xFFF000) != 0 { + if v&0xFFF != 0 { + c.ctxt.Diag("%v misuses oaddi", p) + } + v >>= 12 + o1 |= 1 << 22 + } + + o1 |= ((v & 0xFFF) << 10) | (int32(r&31) << 5) | int32(rt&31) + return uint32(o1) +} + +/* + * load a literal value into dr + */ +func (c *ctxt7) omovlit(as obj.As, p *obj.Prog, a *obj.Addr, dr int) uint32 { + var o1 int32 + if p.Pool == nil { /* not in literal pool */ + c.aclass(a) + c.ctxt.Logf("omovlit add %d (%#x)\n", c.instoffset, uint64(c.instoffset)) + + /* TODO: could be clever, and use general constant builder */ + o1 = int32(c.opirr(p, AADD)) + + v := int32(c.instoffset) + if v != 0 && (v&0xFFF) == 0 { + v >>= 12 + o1 |= 1 << 22 /* shift, by 12 */ + } + + o1 |= ((v & 0xFFF) << 10) | (REGZERO & 31 << 5) | int32(dr&31) + } else { + fp, w := 0, 0 + switch as { + case AFMOVS: + fp = 1 + w = 0 /* 32-bit SIMD/FP */ + + case AFMOVD: + fp = 1 + w = 1 /* 64-bit SIMD/FP */ + + case AFMOVQ: + fp = 1 + w = 2 /* 128-bit SIMD/FP */ + + case AMOVD: + if p.Pool.As == ADWORD { + w = 1 /* 64-bit */ + } else if p.Pool.To.Offset < 0 { + w = 2 /* 32-bit, sign-extended to 64-bit */ + } else if p.Pool.To.Offset >= 0 { + w = 0 /* 32-bit, zero-extended to 64-bit */ + } else { + c.ctxt.Diag("invalid operand %v in %v", a, p) + } + + case AMOVBU, AMOVHU, AMOVWU: + w = 0 /* 32-bit, zero-extended to 64-bit */ + + case AMOVB, AMOVH, AMOVW: + w = 2 /* 32-bit, sign-extended to 64-bit */ + + default: + c.ctxt.Diag("invalid operation %v in %v", as, p) + } + + v := int32(c.brdist(p, 0, 19, 2)) + o1 = (int32(w) << 30) | (int32(fp) << 26) | (3 << 27) + o1 |= (v & 0x7FFFF) << 5 + o1 |= int32(dr & 31) + } + + return uint32(o1) +} + +// load a constant (MOVCON or BITCON) in a into rt +func (c *ctxt7) omovconst(as obj.As, p *obj.Prog, a *obj.Addr, rt int) (o1 uint32) { + if cls := oclass(a); cls == C_BITCON || cls == C_ABCON || cls == C_ABCON0 { + // or $bitcon, REGZERO, rt + mode := 64 + var as1 obj.As + switch as { + case AMOVW: + as1 = AORRW + mode = 32 + case AMOVD: + as1 = AORR + } + o1 = c.opirr(p, as1) + o1 |= bitconEncode(uint64(a.Offset), mode) | uint32(REGZERO&31)<<5 | uint32(rt&31) + return o1 + } + + if as == AMOVW { + d := uint32(a.Offset) + s := movcon(int64(d)) + if s < 0 || 16*s >= 32 { + d = ^d + s = movcon(int64(d)) + if s < 0 || 16*s >= 32 { + c.ctxt.Diag("impossible 32-bit move wide: %#x\n%v", uint32(a.Offset), p) + } + o1 = c.opirr(p, AMOVNW) + } else { + o1 = c.opirr(p, AMOVZW) + } + o1 |= MOVCONST(int64(d), s, rt) + } + if as == AMOVD { + d := a.Offset + s := movcon(d) + if s < 0 || 16*s >= 64 { + d = ^d + s = movcon(d) + if s < 0 || 16*s >= 64 { + c.ctxt.Diag("impossible 64-bit move wide: %#x\n%v", uint64(a.Offset), p) + } + o1 = c.opirr(p, AMOVN) + } else { + o1 = c.opirr(p, AMOVZ) + } + o1 |= MOVCONST(d, s, rt) + } + return o1 +} + +// load a 32-bit/64-bit large constant (LCON or VCON) in a.Offset into rt +// put the instruction sequence in os and return the number of instructions. +func (c *ctxt7) omovlconst(as obj.As, p *obj.Prog, a *obj.Addr, rt int, os []uint32) (num uint8) { + switch as { + case AMOVW: + d := uint32(a.Offset) + // use MOVZW and MOVKW to load a constant to rt + os[0] = c.opirr(p, AMOVZW) + os[0] |= MOVCONST(int64(d), 0, rt) + os[1] = c.opirr(p, AMOVKW) + os[1] |= MOVCONST(int64(d), 1, rt) + return 2 + + case AMOVD: + d := a.Offset + dn := ^d + var immh [4]uint64 + var i int + zeroCount := int(0) + negCount := int(0) + for i = 0; i < 4; i++ { + immh[i] = uint64((d >> uint(i*16)) & 0xffff) + if immh[i] == 0 { + zeroCount++ + } else if immh[i] == 0xffff { + negCount++ + } + } + + if zeroCount == 4 || negCount == 4 { + c.ctxt.Diag("the immediate should be MOVCON: %v", p) + } + switch { + case zeroCount == 3: + // one MOVZ + for i = 0; i < 4; i++ { + if immh[i] != 0 { + os[0] = c.opirr(p, AMOVZ) + os[0] |= MOVCONST(d, i, rt) + break + } + } + return 1 + + case negCount == 3: + // one MOVN + for i = 0; i < 4; i++ { + if immh[i] != 0xffff { + os[0] = c.opirr(p, AMOVN) + os[0] |= MOVCONST(dn, i, rt) + break + } + } + return 1 + + case zeroCount == 2: + // one MOVZ and one MOVK + for i = 0; i < 4; i++ { + if immh[i] != 0 { + os[0] = c.opirr(p, AMOVZ) + os[0] |= MOVCONST(d, i, rt) + i++ + break + } + } + for ; i < 4; i++ { + if immh[i] != 0 { + os[1] = c.opirr(p, AMOVK) + os[1] |= MOVCONST(d, i, rt) + } + } + return 2 + + case negCount == 2: + // one MOVN and one MOVK + for i = 0; i < 4; i++ { + if immh[i] != 0xffff { + os[0] = c.opirr(p, AMOVN) + os[0] |= MOVCONST(dn, i, rt) + i++ + break + } + } + for ; i < 4; i++ { + if immh[i] != 0xffff { + os[1] = c.opirr(p, AMOVK) + os[1] |= MOVCONST(d, i, rt) + } + } + return 2 + + case zeroCount == 1: + // one MOVZ and two MOVKs + for i = 0; i < 4; i++ { + if immh[i] != 0 { + os[0] = c.opirr(p, AMOVZ) + os[0] |= MOVCONST(d, i, rt) + i++ + break + } + } + + for j := 1; i < 4; i++ { + if immh[i] != 0 { + os[j] = c.opirr(p, AMOVK) + os[j] |= MOVCONST(d, i, rt) + j++ + } + } + return 3 + + case negCount == 1: + // one MOVN and two MOVKs + for i = 0; i < 4; i++ { + if immh[i] != 0xffff { + os[0] = c.opirr(p, AMOVN) + os[0] |= MOVCONST(dn, i, rt) + i++ + break + } + } + + for j := 1; i < 4; i++ { + if immh[i] != 0xffff { + os[j] = c.opirr(p, AMOVK) + os[j] |= MOVCONST(d, i, rt) + j++ + } + } + return 3 + + default: + // one MOVZ and 3 MOVKs + os[0] = c.opirr(p, AMOVZ) + os[0] |= MOVCONST(d, 0, rt) + for i = 1; i < 4; i++ { + os[i] = c.opirr(p, AMOVK) + os[i] |= MOVCONST(d, i, rt) + } + return 4 + } + default: + return 0 + } +} + +func (c *ctxt7) opbfm(p *obj.Prog, a obj.As, r int, s int, rf int, rt int) uint32 { + var b uint32 + o := c.opirr(p, a) + if (o & (1 << 31)) == 0 { + b = 32 + } else { + b = 64 + } + if r < 0 || uint32(r) >= b { + c.ctxt.Diag("illegal bit number\n%v", p) + } + o |= (uint32(r) & 0x3F) << 16 + if s < 0 || uint32(s) >= b { + c.ctxt.Diag("illegal bit number\n%v", p) + } + o |= (uint32(s) & 0x3F) << 10 + o |= (uint32(rf&31) << 5) | uint32(rt&31) + return o +} + +func (c *ctxt7) opextr(p *obj.Prog, a obj.As, v int32, rn int, rm int, rt int) uint32 { + var b uint32 + o := c.opirr(p, a) + if (o & (1 << 31)) != 0 { + b = 63 + } else { + b = 31 + } + if v < 0 || uint32(v) > b { + c.ctxt.Diag("illegal bit number\n%v", p) + } + o |= uint32(v) << 10 + o |= uint32(rn&31) << 5 + o |= uint32(rm&31) << 16 + o |= uint32(rt & 31) + return o +} + +/* genrate instruction encoding for LDP/LDPW/LDPSW/STP/STPW */ +func (c *ctxt7) opldpstp(p *obj.Prog, o *Optab, vo int32, rbase, rl, rh, ldp uint32) uint32 { + wback := false + if o.scond == C_XPOST || o.scond == C_XPRE { + wback = true + } + switch p.As { + case ALDP, ALDPW, ALDPSW: + c.checkUnpredictable(p, true, wback, p.From.Reg, p.To.Reg, int16(p.To.Offset)) + case ASTP, ASTPW: + if wback == true { + c.checkUnpredictable(p, false, true, p.To.Reg, p.From.Reg, int16(p.From.Offset)) + } + case AFLDPD, AFLDPS: + c.checkUnpredictable(p, true, false, p.From.Reg, p.To.Reg, int16(p.To.Offset)) + } + var ret uint32 + // check offset + switch p.As { + case AFLDPD, AFSTPD: + if vo < -512 || vo > 504 || vo%8 != 0 { + c.ctxt.Diag("invalid offset %v\n", p) + } + vo /= 8 + ret = 1<<30 | 1<<26 + case ALDP, ASTP: + if vo < -512 || vo > 504 || vo%8 != 0 { + c.ctxt.Diag("invalid offset %v\n", p) + } + vo /= 8 + ret = 2 << 30 + case AFLDPS, AFSTPS: + if vo < -256 || vo > 252 || vo%4 != 0 { + c.ctxt.Diag("invalid offset %v\n", p) + } + vo /= 4 + ret = 1 << 26 + case ALDPW, ASTPW: + if vo < -256 || vo > 252 || vo%4 != 0 { + c.ctxt.Diag("invalid offset %v\n", p) + } + vo /= 4 + ret = 0 + case ALDPSW: + if vo < -256 || vo > 252 || vo%4 != 0 { + c.ctxt.Diag("invalid offset %v\n", p) + } + vo /= 4 + ret = 1 << 30 + default: + c.ctxt.Diag("invalid instruction %v\n", p) + } + // check register pair + switch p.As { + case AFLDPD, AFLDPS, AFSTPD, AFSTPS: + if rl < REG_F0 || REG_F31 < rl || rh < REG_F0 || REG_F31 < rh { + c.ctxt.Diag("invalid register pair %v\n", p) + } + case ALDP, ALDPW, ALDPSW: + if rl < REG_R0 || REG_R30 < rl || rh < REG_R0 || REG_R30 < rh { + c.ctxt.Diag("invalid register pair %v\n", p) + } + case ASTP, ASTPW: + if rl < REG_R0 || REG_R31 < rl || rh < REG_R0 || REG_R31 < rh { + c.ctxt.Diag("invalid register pair %v\n", p) + } + } + // other conditional flag bits + switch o.scond { + case C_XPOST: + ret |= 1 << 23 + case C_XPRE: + ret |= 3 << 23 + default: + ret |= 2 << 23 + } + ret |= 5<<27 | (ldp&1)<<22 | uint32(vo&0x7f)<<15 | (rh&31)<<10 | (rbase&31)<<5 | (rl & 31) + return ret +} + +func (c *ctxt7) maskOpvldvst(p *obj.Prog, o1 uint32) uint32 { + if p.As == AVLD1 || p.As == AVST1 { + return o1 + } + + o1 &^= 0xf000 // mask out "opcode" field (bit 12-15) + switch p.As { + case AVLD1R, AVLD2R: + o1 |= 0xC << 12 + case AVLD3R, AVLD4R: + o1 |= 0xE << 12 + case AVLD2, AVST2: + o1 |= 8 << 12 + case AVLD3, AVST3: + o1 |= 4 << 12 + case AVLD4, AVST4: + default: + c.ctxt.Diag("unsupported instruction:%v\n", p.As) + } + return o1 +} + +/* + * size in log2(bytes) + */ +func movesize(a obj.As) int { + switch a { + case AMOVD: + return 3 + + case AMOVW, AMOVWU: + return 2 + + case AMOVH, AMOVHU: + return 1 + + case AMOVB, AMOVBU: + return 0 + + case AFMOVS: + return 2 + + case AFMOVD: + return 3 + + default: + return -1 + } +} + +// rm is the Rm register value, o is the extension, amount is the left shift value. +func roff(rm int16, o uint32, amount int16) uint32 { + return uint32(rm&31)<<16 | o<<13 | uint32(amount)<<10 +} + +// encRegShiftOrExt returns the encoding of shifted/extended register, Rx<> 5) & 7 + rm = r & 31 + switch { + case REG_UXTB <= r && r < REG_UXTH: + return roff(rm, 0, num) + case REG_UXTH <= r && r < REG_UXTW: + return roff(rm, 1, num) + case REG_UXTW <= r && r < REG_UXTX: + if a.Type == obj.TYPE_MEM { + if num == 0 { + return roff(rm, 2, 2) + } else { + return roff(rm, 2, 6) + } + } else { + return roff(rm, 2, num) + } + case REG_UXTX <= r && r < REG_SXTB: + return roff(rm, 3, num) + case REG_SXTB <= r && r < REG_SXTH: + return roff(rm, 4, num) + case REG_SXTH <= r && r < REG_SXTW: + return roff(rm, 5, num) + case REG_SXTW <= r && r < REG_SXTX: + if a.Type == obj.TYPE_MEM { + if num == 0 { + return roff(rm, 6, 2) + } else { + return roff(rm, 6, 6) + } + } else { + return roff(rm, 6, num) + } + case REG_SXTX <= r && r < REG_SPECIAL: + if a.Type == obj.TYPE_MEM { + if num == 0 { + return roff(rm, 7, 2) + } else { + return roff(rm, 7, 6) + } + } else { + return roff(rm, 7, num) + } + case REG_LSL <= r && r < (REG_LSL+1<<8): + return roff(rm, 3, 6) + default: + c.ctxt.Diag("unsupported register extension type.") + } + + return 0 +} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/doc.go b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/doc.go new file mode 100644 index 00000000..75152175 --- /dev/null +++ b/vendor/github.com/twitchyliquid64/golang-asm/obj/arm64/doc.go @@ -0,0 +1,249 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +/* +Package arm64 implements an ARM64 assembler. Go assembly syntax is different from GNU ARM64 +syntax, but we can still follow the general rules to map between them. + +Instructions mnemonics mapping rules + +1. Most instructions use width suffixes of instruction names to indicate operand width rather than +using different register names. + + Examples: + ADC R24, R14, R12 <=> adc x12, x24 + ADDW R26->24, R21, R15 <=> add w15, w21, w26, asr #24 + FCMPS F2, F3 <=> fcmp s3, s2 + FCMPD F2, F3 <=> fcmp d3, d2 + FCVTDH F2, F3 <=> fcvt h3, d2 + +2. Go uses .P and .W suffixes to indicate post-increment and pre-increment. + + Examples: + MOVD.P -8(R10), R8 <=> ldr x8, [x10],#-8 + MOVB.W 16(R16), R10 <=> ldrsb x10, [x16,#16]! + MOVBU.W 16(R16), R10 <=> ldrb x10, [x16,#16]! + +3. Go uses a series of MOV instructions as load and store. + +64-bit variant ldr, str, stur => MOVD; +32-bit variant str, stur, ldrsw => MOVW; +32-bit variant ldr => MOVWU; +ldrb => MOVBU; ldrh => MOVHU; +ldrsb, sturb, strb => MOVB; +ldrsh, sturh, strh => MOVH. + +4. Go moves conditions into opcode suffix, like BLT. + +5. Go adds a V prefix for most floating-point and SIMD instructions, except cryptographic extension +instructions and floating-point(scalar) instructions. + + Examples: + VADD V5.H8, V18.H8, V9.H8 <=> add v9.8h, v18.8h, v5.8h + VLD1.P (R6)(R11), [V31.D1] <=> ld1 {v31.1d}, [x6], x11 + VFMLA V29.S2, V20.S2, V14.S2 <=> fmla v14.2s, v20.2s, v29.2s + AESD V22.B16, V19.B16 <=> aesd v19.16b, v22.16b + SCVTFWS R3, F16 <=> scvtf s17, w6 + +6. Align directive + +Go asm supports the PCALIGN directive, which indicates that the next instruction should be aligned +to a specified boundary by padding with NOOP instruction. The alignment value supported on arm64 +must be a power of 2 and in the range of [8, 2048]. + + Examples: + PCALIGN $16 + MOVD $2, R0 // This instruction is aligned with 16 bytes. + PCALIGN $1024 + MOVD $3, R1 // This instruction is aligned with 1024 bytes. + +PCALIGN also changes the function alignment. If a function has one or more PCALIGN directives, +its address will be aligned to the same or coarser boundary, which is the maximum of all the +alignment values. + +In the following example, the function Add is aligned with 128 bytes. + Examples: + TEXT ·Add(SB),$40-16 + MOVD $2, R0 + PCALIGN $32 + MOVD $4, R1 + PCALIGN $128 + MOVD $8, R2 + RET + +On arm64, functions in Go are aligned to 16 bytes by default, we can also use PCALGIN to set the +function alignment. The functions that need to be aligned are preferably using NOFRAME and NOSPLIT +to avoid the impact of the prologues inserted by the assembler, so that the function address will +have the same alignment as the first hand-written instruction. + +In the following example, PCALIGN at the entry of the function Add will align its address to 2048 bytes. + + Examples: + TEXT ·Add(SB),NOSPLIT|NOFRAME,$0 + PCALIGN $2048 + MOVD $1, R0 + MOVD $1, R1 + RET + +Special Cases. + +(1) umov is written as VMOV. + +(2) br is renamed JMP, blr is renamed CALL. + +(3) No need to add "W" suffix: LDARB, LDARH, LDAXRB, LDAXRH, LDTRH, LDXRB, LDXRH. + +(4) In Go assembly syntax, NOP is a zero-width pseudo-instruction serves generic purpose, nothing +related to real ARM64 instruction. NOOP serves for the hardware nop instruction. NOOP is an alias of +HINT $0. + + Examples: + VMOV V13.B[1], R20 <=> mov x20, v13.b[1] + VMOV V13.H[1], R20 <=> mov w20, v13.h[1] + JMP (R3) <=> br x3 + CALL (R17) <=> blr x17 + LDAXRB (R19), R16 <=> ldaxrb w16, [x19] + NOOP <=> nop + + +Register mapping rules + +1. All basic register names are written as Rn. + +2. Go uses ZR as the zero register and RSP as the stack pointer. + +3. Bn, Hn, Dn, Sn and Qn instructions are written as Fn in floating-point instructions and as Vn +in SIMD instructions. + + +Argument mapping rules + +1. The operands appear in left-to-right assignment order. + +Go reverses the arguments of most instructions. + + Examples: + ADD R11.SXTB<<1, RSP, R25 <=> add x25, sp, w11, sxtb #1 + VADD V16, V19, V14 <=> add d14, d19, d16 + +Special Cases. + +(1) Argument order is the same as in the GNU ARM64 syntax: cbz, cbnz and some store instructions, +such as str, stur, strb, sturb, strh, sturh stlr, stlrb. stlrh, st1. + + Examples: + MOVD R29, 384(R19) <=> str x29, [x19,#384] + MOVB.P R30, 30(R4) <=> strb w30, [x4],#30 + STLRH R21, (R19) <=> stlrh w21, [x19] + +(2) MADD, MADDW, MSUB, MSUBW, SMADDL, SMSUBL, UMADDL, UMSUBL , , , + + Examples: + MADD R2, R30, R22, R6 <=> madd x6, x22, x2, x30 + SMSUBL R10, R3, R17, R27 <=> smsubl x27, w17, w10, x3 + +(3) FMADDD, FMADDS, FMSUBD, FMSUBS, FNMADDD, FNMADDS, FNMSUBD, FNMSUBS , , , + + Examples: + FMADDD F30, F20, F3, F29 <=> fmadd d29, d3, d30, d20 + FNMSUBS F7, F25, F7, F22 <=> fnmsub s22, s7, s7, s25 + +(4) BFI, BFXIL, SBFIZ, SBFX, UBFIZ, UBFX $, , $, + + Examples: + BFIW $16, R20, $6, R0 <=> bfi w0, w20, #16, #6 + UBFIZ $34, R26, $5, R20 <=> ubfiz x20, x26, #34, #5 + +(5) FCCMPD, FCCMPS, FCCMPED, FCCMPES , Fm. Fn, $ + + Examples: + FCCMPD AL, F8, F26, $0 <=> fccmp d26, d8, #0x0, al + FCCMPS VS, F29, F4, $4 <=> fccmp s4, s29, #0x4, vs + FCCMPED LE, F20, F5, $13 <=> fccmpe d5, d20, #0xd, le + FCCMPES NE, F26, F10, $0 <=> fccmpe s10, s26, #0x0, ne + +(6) CCMN, CCMNW, CCMP, CCMPW , , $, $ + + Examples: + CCMP MI, R22, $12, $13 <=> ccmp x22, #0xc, #0xd, mi + CCMNW AL, R1, $11, $8 <=> ccmn w1, #0xb, #0x8, al + +(7) CCMN, CCMNW, CCMP, CCMPW , , , $ + + Examples: + CCMN VS, R13, R22, $10 <=> ccmn x13, x22, #0xa, vs + CCMPW HS, R19, R14, $11 <=> ccmp w19, w14, #0xb, cs + +(9) CSEL, CSELW, CSNEG, CSNEGW, CSINC, CSINCW , , , ; +FCSELD, FCSELS , , , + + Examples: + CSEL GT, R0, R19, R1 <=> csel x1, x0, x19, gt + CSNEGW GT, R7, R17, R8 <=> csneg w8, w7, w17, gt + FCSELD EQ, F15, F18, F16 <=> fcsel d16, d15, d18, eq + +(10) TBNZ, TBZ $, ,